6Y68A

Structure of maporal virus envelope glycoprotein gc in postfusion conformation
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
413
structure length
413
Chain Sequence
EPGWSDTAHGVGEVPLKTDLELDFSLPSSSSYSYRRKLTNPANKEESIPFHFQMDKQVIHAEVQVLGHWMDATFNIKTAFHCYGACQKYSYPWQTAKCFFEKDYQYENGWGCNPGDCPGVGTGCTACGIYLDKLKSVGKAYKIISLKYSRKVCIQLGTEQTCKHIDANDCLVTPSVKVCMVGTVSKLQPADTILFLGPLEQGGIILKQWCTTSCTFGDPGDIMSTTAGMRCPEHTGSFRKICAFATTPVCEYQGNTISGYKRMMATKDSFQSFNLTDPHLTTNKLEWIDPDGNTRDHVNLVLNRDVSFQDLSDNPCKVDLHTQSIEGAWGSGVGFTLTCTVSLTECPSFMTSIKACDMAMCYGSTVTNLARGSNTVKVVGKGGHSGSAFKCCHDTDCSTEGLAASAPHLERVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Envelope polyprotein
publication title The Hantavirus Surface Glycoprotein Lattice and Its Fusion Control Mechanism.
pubmed doi rcsb
source organism Maporal virus
total genus 87
structure length 413
sequence length 413
ec nomenclature
pdb deposition date 2020-02-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...