6Y7OA

The complex between the eight-bladed symmetrical designer protein tako8 and the silicotungstic acid keggin (sta)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
318
structure length
318
Chain Sequence
SLRTLQGHQSAVTSLQFNDNIVVSGSDDSTVKVWDIKTGQSLRTLQGHQSAVTSLQFNDNIVVSGSDDSTVKVWDIKTGQSLRTLQGHQSAVTSLQFNDNIVVSGSDDSTVKVWDIKTGQSLRTLQGHQSAVTSLQFNDNIVVSGSDDSTVKVWDIKTGQSLRTLQGHQSAVTSLQFNDNIVVSGSDDSTVKVWDIKTGQSLRTLQGHQSAVTSLQFNDNIVVSGSDDSTVKVWDIKTGQSLRTLQGHQSAVTSLQFNDNIVVSGSDDSTVKVWDIKTGQSLRTLQGHQSAVTSLQFNDNIVVSGSDDSTVKVWDIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Tako8
publication title Shape and Size Complementarity-Induced Formation of Supramolecular Protein Assemblies with Metal-Oxo Clusters
doi rcsb
source organism Synthetic construct
total genus 86
structure length 318
sequence length 318
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2020-03-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...