6YDWCL

55s mammalian mitochondrial ribosome with mtefg1 and two trnamet (ti-post)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
45
structure length
45
Chain Sequence
EALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into mammalian mitochondrial translation elongation catalyzed by mtEFG1.
pubmed doi rcsb
molecule keywords Uncharacterized protein
molecule tags Translation
source organism Homo sapiens
total genus 11
structure length 45
sequence length 45
chains with identical sequence DL, EL, FL, GL, HL, LL
ec nomenclature
pdb deposition date 2020-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
CL PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
CL PF16320 Ribosomal_L12_N Ribosomal protein L7/L12 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...