6YGIA

Duck hepatitis b virus capsid mutant r124e_delta78-122
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
148
structure length
148
Chain Sequence
MDINASRALANVYDLPDDFFPKIDDLVRDAKDALEPYWKSDSIKKHVLIATHFVDLIEDFWQTTQGMHEIAESLRAVGGSGGAEIHAHLKAYAKINEESLDRARRLLWWHYNCLLWGEAQVTNYISRLRTWLSTPEKYRGRDAPTIEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus like particle
molecule keywords Capsid protein,Capsid protein
publication title Slowly folding surface extension in the prototypic avian hepatitis B virus capsid governs stability.
pubmed doi rcsb
source organism Hepatitis b virus duck/dhbv-16
total genus 51
structure length 148
sequence length 148
chains with identical sequence B, C, D, E, H
ec nomenclature
pdb deposition date 2020-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00906 Hepatitis_core Hepatitis core antigen
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...