6YGTAAA

Crystal structure of variant t52p of the intracellular chorismate mutase from mycobacterium tuberculosis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
76
structure length
76
Chain Sequence
EIDTLREEIDRLDAEILALVKRRAEVSKAIGKARMASGGPRLVHSREMKVIERYSELGPDGKDLAILLLRLGRGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Intracellular chorismate mutase
publication title Crystal structure of variant T52P of the intracellular chorismate mutase from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
total genus 30
structure length 76
sequence length 76
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2020-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
AAA PF01817 CM_2 Chorismate mutase type II
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...