6YJ6B

Structure of the tfiiic subcomplex taua
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
647
structure length
508
Chain Sequence
IADEFTLDLPRIPSLELPLNVSTKHSSIQKAIKMCGGIEKVKEAFKEHGPIESQHGLQLYLNDDTDSDGSKSYFNEHPVIGKRVPFRDESVILKVTMPKGTLSKNNNSVKDSIKSLKDSNKLRVTPVSIVDNTIKFREMSDFQIKLDNVPSAREFKSSFGSLEWNNFKSFVNSVPDNDSQPQENIGNLILDRSVKIPSTDFQLPPPPKLSMVTYIKNYQLFVHDLSDKTVIPSQAHEQVLYDFEVAKKTKVYPGTKSDSKFYESLEECLKILRELFARRPIWVKRHLDGIVPKKIHHTMKIALALISYRFTMGPWRNTYIKFGIDPRSSVEYAQYQTEYFKIERKLLSSPIVKKNVPKPPPLVFESDTPGGIDSRFKFDGKRIPWYLMLQIDLLIGEPNIAEVFHNVEYLDKANELTGWFKELDLVKIRRIVKYELGCMVQGNYEYNKYKLKYFKTMLFGAITEEPDDAALENEEMDTDQNLKVPAXXXXXXXXXXXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcription factor tau 131 kDa subunit
publication title Structure of the TFIIIC subcomplex tauA provides insights into RNA polymerase III pre-initiation complex formation
rcsb
source organism Saccharomyces cerevisiae
total genus 75
structure length 508
sequence length 647
ec nomenclature
pdb deposition date 2020-04-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...