6YNZP

Cryo-em structure of tetrahymena thermophila mitochondrial atp synthase - f1fo composite tetramer model
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
150
structure length
150
Chain Sequence
SNIFLELQDGDKTVYTHTSLIEESKQEQIQAIYDKVPQWTNGGRFLGFWLSMEAVNRVQSVAKLPIYYRAGIVATSTLLGGLVSSLVFWKSGNENQVAKLANGAPVYLKKWEVPELSKLYFFLDDDNNFKPSLNHHAVTQGRQYYKIYQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Ymf66
publication title Type III ATP synthase is pseudo-symmetric and oligomerizes through luminal linkers
rcsb
total genus 42
structure length 150
sequence length 150
chains with identical sequence P3, p, p3
ec nomenclature
pdb deposition date 2020-04-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...