6YNZd1

Cryo-em structure of tetrahymena thermophila mitochondrial atp synthase - f1fo composite tetramer model
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
134
structure length
134
Chain Sequence
TKKQKMEVTLRTPYKEYLANFDGFSRITAKTNEASLVIQNKTPASLYVLPPGPLKIRFTSEVKNVSGDFLHTGGWVIVHADNTCEINVMDLFDRKEVRADQFEKGNIQDLDTLAGKYAAKSRKSTVRLFTKATT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Ymf66
publication title Type III ATP synthase is pseudo-symmetric and oligomerizes through luminal linkers
rcsb
total genus 21
structure length 134
sequence length 134
chains with identical sequence d2, d4, d5
ec nomenclature
pdb deposition date 2020-04-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...