6YS8A

Structure of gldlm, the proton-powered motor that drives protein transport and gliding motility
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
218
Chain Sequence
TPRQKMINLMYLVFIAMLAMNVSKEVISAFGLMNEKFEAANTSSVTTNESLLTSLDQKAAEAKGEFAKAAETAHKVQAASKEFYDYIGTLKTQAVKGFEVDKETGKMPYEAMDRGDNIDDWFTGDGYTKKGNEIIAKIEKYKSDIKAALGTDKKYAGIISEVEKKFDVSDVKNKEGIKEKYLAYHFKGFPAIASAAKLSAWQNDVKKTEADVYNSALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Motor protein
molecule keywords GldM
publication title Structure of a proton-powered molecular motor that drives protein transport and gliding motility
rcsb
source organism Flavobacterium johnsoniae
total genus 76
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-04-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...