6YUXA

Crystal structure of malus domestica double bond reductase (mddbr) ternary complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
350
structure length
342
Chain Sequence
MAAASTEGVISNKQVILKDYVTGFPKESDMQLTTATTKLKLPEGSKGVLVKNLYLSCDPYMRSRMTKRAASFDAGSPIVGYGVAKVLESGDPKFKKGDLIWGMTGWEEYSVITSTESLFKIQHIDVPLSYYTGILGMPGMTAYAGFYEICNPKKGETVFVSAASGAVGQLVGQFAKLLGCYVVGSAGSKEKVDLLKNKFGFDNAFNYKEEPDLDAALKRYFPEGIDIYFENVGGVMLDAVLPNMRVHGRIAVCGLISQYNIDEGCHNLMYLIIKQVRMQGFLVFSYYHLYEKFLEMVLPAIKEGKLTYVEDVVEGLESAPAALIGLYAGRNVGKQVVVVSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Double Bond Reductase
publication title The structural and functional characterization of Malus domestica double bond reductase MdDBR provides insights towards the identification of its substrates.
pubmed doi rcsb
source organism Malus domestica
total genus 121
structure length 342
sequence length 350
ec nomenclature
pdb deposition date 2020-04-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...