6Z05A

Campylobacter jejuni serine protease htra
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
434
structure length
434
Chain Sequence
VLSYHDSIKDAKKSVVNISTSKTITRANRPSPLDDFFNDPYFKQFFDFDFPQRKGKNDKEVVSSLGSGVIISKDGYIVTNNHVVDDADTITVNLPGSDIEYKAKLIGKDPKTDLAVIKIEANNLSAITFTNSDDLMEGDVVFALGNPFGVGFSVTSGIISALNKDNIGLNQYENFIQTDASINPGNSGGALVDSRGYLVGINSAILSRGGGNNGIGFAIPSNMVKDIAKKLIEKGKIDRGFLGVTILALQGDTKKAYKNQEGALITDVQKGSSADEAGLKRGDLVTKVNNKVIKSPIDLKNYIGTLEIGQKISLSYERDGENKQASFILKGEKENPKGVQSDLIDGLSLRNLDPRLKDRLQIPKDVNGVLVDSVKEKSKGKNSGFQEGDIIIGVGQSEIKNLKDLEQALKQVNKKEFTKVWVYRNGFATLLVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords DegQ family serine endoprotease
publication title Functional analysis and cryo-electron microscopy of Campylobacter jejuni serine protease HtrA.
pubmed doi rcsb
source organism Campylobacter jejuni
total genus 112
structure length 434
sequence length 434
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2020-05-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...