6Z8EA

Human picobirnavirus ht-cp vlp
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
506
structure length
506
Chain Sequence
RNDVAWYARYPHILEEATRLPFAYPIGQYYDTGYSVASATEWSKYVDTSLTIPGVMCVNFTPTPGESYNKNSPINIAAQNVYTYVRHMNSGHANYEQADLMMYLLAMDSLYIFHSYVRKILAISKLYTPVNKYFPRALLVALGVDPEDVFANQAQWEYFVNMVAYRAGAFAAPASMTYYERHAWMSNGLYVDQDVTRAQIYMFKPTMLWKYENLGTTGTKLVPLMMPKAGDNRKLVDFQVLFNNLVSTMLGDEDFGIMSGDVFKAFGADGLVKLLAVDSTTMTLPTYDPLILAQIHSARAVGAPILETSTLTGFPGRQWQITQNPDVNNGAIIFHPSFGYDGQDHEELSFRAMCSNMILNLPGEAHSAEMIIEATRLATMFQVKAVPAGDTSKPVLYLPNGFGTEVVNDYTMISVDKATPHDLTIHTFFNNILVPNAKENYVANLELLNNIIQFDWAPQLYLTYGIAQESFGPFAQLNDWTILTGETLARMHEVCVTSMFDVPQMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus like particle
molecule keywords Capsid protein precursor
publication title Cryo-EM structure, assembly and mechanics show morphogenesis of the human picobirnavirus
rcsb
source organism Human picobirnavirus
total genus 126
structure length 506
sequence length 506
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-06-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...