6Z94A

[4fe-4s]-dependent thiouracil desulfidase tuds (duf523vcz)(s-sad data)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
150
structure length
150
Chain Sequence
EKIIVSACLLGQPVRYDGQSKGIVSNWLDALGAEGRALAFCPEVAGGLPTPRPPAERQGEHVVTESGLDVTAEFDRGAELALGLCLAQGIRFALLKEGSPSCGSGRIYNGRFEGVSMAGEGKTTALLRRHGIQVFSEDQLPELALALSLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DUF523 domain-containing protein
publication title Structural evidence for a [4Fe-5S] intermediate in the non-redox desulfuration of thiouracil.
pubmed doi rcsb
source organism Uncultured bacterium
total genus 51
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-06-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...