6ZG3D

The structure of ecf pant transporter in a complex with a nanobody
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
260
structure length
260
Chain Sequence
IGRYLPGTTFVYRVDPRAKLLTTFYFIIMIFLANNWVSYLVISIFGLAYVFATGLKARVFWDGVKPMIWMIVFTSLLQTFFMAGGKVYWHWWIFTLSSEGLINGLYVFIRFAMIILVSTVMTVTTKPLEIADAMEWMLTPLKLFKVNVGMISLVISIALRFVPTLFDQTVKIMNAQRSRGADFNDGGLVKRAKSVVPMLVPLFIDSLEVALDLSTAMESRGYKGSEGRTRYRILEWSKVDLIPVAYCLLLTILMITTRKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Energy-coupling factor transporter ATP-binding protein EcfA1
publication title In vitro reconstitution of dynamically interacting integral membrane subunits of energy-coupling factor transporters.
pubmed doi rcsb
source organism Lactobacillus delbrueckii subsp. bulgaricus atcc 11842 = jcm 1002
total genus 86
structure length 260
sequence length 260
chains with identical sequence I
ec nomenclature
pdb deposition date 2020-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02361 CbiQ Cobalt transport protein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...