6ZI1AAA

Crystal structure of the isolated h. influenzae vapd toxin (d7n mutant)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
93
structure length
83
Chain Sequence
AMYAIAFNLVVVQEAYTDIGAVLAKFGFVRTQGSLYTNMNEDMANLFQAMNALKQLAWISQSVRDIRAFRIEQWSDFTDFIRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Endoribonuclease VapD
publication title Structural Basis for Toxin Inhibition in the VapXD Toxin-Antitoxin System
rcsb
source organism Haemophilus influenzae 86-028np
total genus 22
structure length 83
sequence length 93
chains with identical sequence BBB
ec nomenclature
pdb deposition date 2020-06-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...