6ZIY6

Respiratory complex i from thermus thermophilus, nadh dataset, major state
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
166
structure length
166
Chain Sequence
REGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSEVFRASPRQADVMIVAGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRGQAYNERGERLPPVAAWKRTRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords NADH-quinone oxidoreductase subunit 1
publication title Key role of quinone in the mechanism of respiratory complex I.
pubmed doi rcsb
total genus 35
structure length 166
sequence length 166
ec nomenclature ec 7.1.1.-:
pdb deposition date 2020-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
6 PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...