6ZYXd

Outer dynein arm-shulin complex - shulin region from tetrahymena thermophila
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
114
structure length
91
Chain Sequence
LEPKNPQAPKNITVYDYYTRKFKTDELVDQMIVHFSMDGDYIWKESNEYKTQEEIRDTKKALIKERNKFNYNTRECQTINPSIRERGVSTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Shulin packages axonemal outer dynein arms for ciliary targeting.
rcsb
molecule tags Motor protein
source organism Tetrahymena thermophila cu428
molecule keywords Dynein heavy chain, outer arm protein
total genus 10
structure length 91
sequence length 114
ec nomenclature
pdb deposition date 2020-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...