7CEIA

The endonuclease domain of colicin e7 in complex with its inhibitor im7 protein
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
87
structure length
87
Chain Sequence
b'MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (COLICIN E7 IMMUNITY PROTEIN)
publication title The crystal structure of the DNase domain of colicin E7 in complex with its inhibitor Im7 protein.
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
molecule tags Immune system
total genus 28
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1998-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 7ceiA00
1GXGA 2GYKA 2GZFA 1GXHA 2K0DX 3GKLC 2JAZA 1ZNVA 2VLOA 2VLQA 3U43A 2JB0A 2K5XA 1UNKA 1IMPA 2VLPA 2GZJA 2GZIA 1UJZA 2NO8A 7CEIA 2WPTA 1MZ8A 4QKOA 4UHPB 3GJNA 4F37A 1IMQA 1FR2A 1EMVA 1AYIA 1BXIA 2ERHA 1CEIA 2VLNA 5EW5E 1E0HA 2GZEA 2GZGA 2JBGA
chains in the Genus database with same CATH superfamily
1KLPA 2LF4A 1M90Q 1VQ9P 1KC8Q 4WYMA 3CC7P 1RNIA 2LMLA 2KORA 3CXCO 1DNYA 1M1KQ 3CCLP 2K93A 2GDWA 3MGEA 5I4TG 2GZGA 1ZMBA 2MY5A 1K30A 3EJEA 2Z45A 2X2BA 5JPAA 3G6EP 2WPTA 2JYGA 3DS4A 4U0BA 2KGCA 1QVFO 2FQ2A 1K9MQ 3NY7B 1KD1Q 2QA4P 2LIWA 2FVFA 2LTEA 2LKIA 2FVAA 4IPYA 2JO0A 2QNWA 2VSQA 2L22A 2N98A 2PEIA 2LIUA 2ERHA 3H4EA 2JBGA 2PY8A 2KWLA 2K0YA 2K0XA 1ZNVA 2N6ZA 4BPHA 2LPKA 3CD6P 2AF8A 2ROQA 2GZJA 2FVEA 1IMQA 1EMVA 5KP7B 2KOPA 2BHVA 1OR5A 4U0AA 2M8PA 5BS2A 3Q20A 1YHQP 2MVVA 2GYKA 3GKLC 2CWOA 2QEXP 4M0IA 2AFDA 2JAZA 3NTEA 2GDXA 3CC2P 2KGAA 4H2YC 2K5XA 2P9XA 4U0EA 1UNKA 4R0MA 5F2NA 2Z44A 3CCUP 3GJNA 1EOQA 2JU2A 2JGPA 4PH0A 2FACA 3CMAP 1QVGO 1M6NA 5HGNA 1Q7YQ 1N8RQ 1L0IA 3G26A 1VQLP 2MF4A 3DPHA 1YJNP 4H2XC 2M5RA 1GPJA 2XZ0D 2KGEA 3CCMP 2N5IA 1VQMP 1AYIA 2DNWA 1A43A 3CCSP 2DGYA 2PEMA 2EIAA 5HGLA 2FQ0A 4U0FA 5EJDA 2KGDA 1VQ7P 4DG9A 1VQNP 4GR6A 2BUOA 2EHSA 2KG8A 2GDYA 2M8NA 5DCKA 2L6EA 2MVUA 4PH1A 2OTJP 2MR8A 1F80D 4COPA 2MD9A 4F37A 1YJ9P 2OARA 1KQSO 2XT1A 1VQPP 2Z46A 2KR5A 4BPFA 3G28A 2PNGA 1Q82Q 2GZFA 1VQ6P 3OW2O 3DS3A 5KP8B 1D1DA 3DS5A 4XFZA 3G1IA 1UJZA 1Z6MA 1VQ5P 1S72P 1MZ8A 3HYBA 4HKGA 2CGQA 1BXIA 3VRLC 5EW5E 1E0HA 1DV5A 2MR7A 2FADA 2N5HA 1GXHA 2N50A 3EJBA 2VLQA 1K8AQ 1ACPA 3U43A 3GZLA 2KOQA 4XROA 3I56P 4XFXA 3RG6C 3CPWO 2PEJA 2XV6A 1L0HA 1E6JP 1K73Q 2PEQA 3CMEP 4H2WC 4U0DA 2K0DX 1QRJA 2AFEA 2JU1A 1YI2P 2PEOA 4GR2A 3E2DA 2PEKA 4XFYA 5HVCA 3CCVP 3CCEP 1FR2A 2K2QA 1CEIA 1IUQA 3G1GA 3WBHA 2LL8A 2XXMA 1GXGA 2FAEA 4IZ6A 1YITP 2FQ1A 3GZMA 1RO0A 2PENA 3G29A 2CG5B 4MRTC 3CE7A 1Q86Q 5HGOA 4PXHB 2VLPA 3LRYA 3M1MA 3LMOA 2L9FA 4UHPB 2KW2A 3G4SP 4NEOA 3DS1A 1VQOP 2OTLP 3CCJP 2L0QA 1M6EX 2K94A 3H0DA 2CQ8A 2K92A 4QNBA 1EIAA 3CCRP 1BAJA 2E1MA 3G71P 5F2OA 3B4QA 1M74A 3B5IA 3EJDA 2ONTA 2N6YA 5HGMA 3RG2A 2GZEA 4BPGA 1RO2A 1AF8A 2M8LA 2KG6A 1X3OA 4XRQA 3DTJA 3G0VA 3H47A 5BS1A 3DS2A 1JJ2O 2EHTA 2NO8A 1W2BO 4QKOA 3CCQP 5KP6B 3G21A 2VLNA 3HZQA 2FHSC 3I55P 1A8OA 5F2KA 3DS0A 2JYLA 1HY8A 4PWVB 5HV8A 4CA3A 2LOLA 1HQBA 1IMPA 2KOSA 1YIJP 1VQ8P 1Q81Q 2KOOA 1YJWP 1VQKP 3CC4P 2VLOA 2XZ1C 4COCA 2JB0A 5CZDB 2EFJA 2CNRA 1NJIQ 2GZIA 7CEIA 2KG9A 3P05A 2EG5A 1VQ4P 1NQ4A 1VKUA 1AUMA 1T8KA 2KODA 4U0CA 1VHNA 2AVAA 2JQ4A 2L4BA
chains in the Genus database with same CATH topology
1GXGA 2GYKA 2GZFA 1GXHA 2K0DX 3GKLC 2JAZA 1ZNVA 2VLOA 2VLQA 3U43A 2JB0A 2K5XA 1UNKA 1IMPA 2VLPA 2GZJA 2GZIA 1UJZA 2NO8A 7CEIA 2WPTA 1MZ8A 4QKOA 4UHPB 3GJNA 4F37A 1IMQA 1FR2A 1EMVA 1AYIA 1BXIA 2ERHA 1CEIA 2VLNA 5EW5E 1E0HA 2GZEA 2GZGA 2JBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXG A;  2GYK A;  2GZF A;  1GXH A;  2K0D X;  3GKL C;  2JAZ A;  1ZNV A;  2VLO A;  2VLQ A;  3U43 A;  2JB0 A;  2K5X A;  1UNK A;  1IMP A;  2VLP A;  2GZJ A;  2GZI A;  1UJZ A;  2NO8 A;  7CEI A;  2WPT A;  1MZ8 A;  4QKO A;  4UHP B;  3GJN A;  4F37 A;  1IMQ A;  1FR2 A;  1EMV A;  1AYI A;  1BXI A;  2ERH A;  1CEI A;  2VLN A;  5EW5 E;  1E0H A;  2GZE A;  2GZG A;  2JBG A; 
#chains in the Genus database with same CATH topology
 1KLP A;  2LF4 A;  1M90 Q;  1VQ9 P;  1KC8 Q;  4WYM A;  3CC7 P;  1RNI A;  2LML A;  2KOR A;  3CXC O;  1DNY A;  1M1K Q;  3CCL P;  2K93 A;  2GDW A;  3MGE A;  5I4T G;  2GZG A;  1ZMB A;  2MY5 A;  1K30 A;  3EJE A;  2Z45 A;  2X2B A;  5JPA A;  3G6E P;  2WPT A;  2JYG A;  3DS4 A;  4U0B A;  2KGC A;  1QVF O;  2FQ2 A;  1K9M Q;  3NY7 B;  1KD1 Q;  2QA4 P;  2LIW A;  2FVF A;  2LTE A;  2LKI A;  2FVA A;  4IPY A;  2JO0 A;  2QNW A;  2VSQ A;  2L22 A;  2N98 A;  2PEI A;  2LIU A;  2ERH A;  3H4E A;  2JBG A;  2PY8 A;  2KWL A;  2K0Y A;  2K0X A;  1ZNV A;  2N6Z A;  4BPH A;  2LPK A;  3CD6 P;  2AF8 A;  2ROQ A;  2GZJ A;  2FVE A;  1IMQ A;  1EMV A;  5KP7 B;  2KOP A;  2BHV A;  1OR5 A;  4U0A A;  2M8P A;  5BS2 A;  3Q20 A;  1YHQ P;  2MVV A;  2GYK A;  3GKL C;  2CWO A;  2QEX P;  4M0I A;  2AFD A;  2JAZ A;  3NTE A;  2GDX A;  3CC2 P;  2KGA A;  4H2Y C;  2K5X A;  2P9X A;  4U0E A;  1UNK A;  4R0M A;  5F2N A;  2Z44 A;  3CCU P;  3GJN A;  1EOQ A;  2JU2 A;  2JGP A;  4PH0 A;  2FAC A;  3CMA P;  1QVG O;  1M6N A;  5HGN A;  1Q7Y Q;  1N8R Q;  1L0I A;  3G26 A;  1VQL P;  2MF4 A;  3DPH A;  1YJN P;  4H2X C;  2M5R A;  1GPJ A;  2XZ0 D;  2KGE A;  3CCM P;  2N5I A;  1VQM P;  1AYI A;  2DNW A;  1A43 A;  3CCS P;  2DGY A;  2PEM A;  2EIA A;  5HGL A;  2FQ0 A;  4U0F A;  5EJD A;  2KGD A;  1VQ7 P;  4DG9 A;  1VQN P;  4GR6 A;  2BUO A;  2EHS A;  2KG8 A;  2GDY A;  2M8N A;  5DCK A;  2L6E A;  2MVU A;  4PH1 A;  2OTJ P;  2MR8 A;  1F80 D;  4COP A;  2MD9 A;  4F37 A;  1YJ9 P;  2OAR A;  1KQS O;  2XT1 A;  1VQP P;  2Z46 A;  2KR5 A;  4BPF A;  3G28 A;  2PNG A;  1Q82 Q;  2GZF A;  1VQ6 P;  3OW2 O;  3DS3 A;  5KP8 B;  1D1D A;  3DS5 A;  4XFZ A;  3G1I A;  1UJZ A;  1Z6M A;  1VQ5 P;  1S72 P;  1MZ8 A;  3HYB A;  4HKG A;  2CGQ A;  1BXI A;  3VRL C;  5EW5 E;  1E0H A;  1DV5 A;  2MR7 A;  2FAD A;  2N5H A;  1GXH A;  2N50 A;  3EJB A;  2VLQ A;  1K8A Q;  1ACP A;  3U43 A;  3GZL A;  2KOQ A;  4XRO A;  3I56 P;  4XFX A;  3RG6 C;  3CPW O;  2PEJ A;  2XV6 A;  1L0H A;  1E6J P;  1K73 Q;  2PEQ A;  3CME P;  4H2W C;  4U0D A;  2K0D X;  1QRJ A;  2AFE A;  2JU1 A;  1YI2 P;  2PEO A;  4GR2 A;  3E2D A;  2PEK A;  4XFY A;  5HVC A;  3CCV P;  3CCE P;  1FR2 A;  2K2Q A;  1CEI A;  1IUQ A;  3G1G A;  3WBH A;  2LL8 A;  2XXM A;  1GXG A;  2FAE A;  4IZ6 A;  1YIT P;  2FQ1 A;  3GZM A;  1RO0 A;  2PEN A;  3G29 A;  2CG5 B;  4MRT C;  3CE7 A;  1Q86 Q;  5HGO A;  4PXH B;  2VLP A;  3LRY A;  3M1M A;  3LMO A;  2L9F A;  4UHP B;  2KW2 A;  3G4S P;  4NEO A;  3DS1 A;  1VQO P;  2OTL P;  3CCJ P;  2L0Q A;  1M6E X;  2K94 A;  3H0D A;  2CQ8 A;  2K92 A;  4QNB A;  1EIA A;  3CCR P;  1BAJ A;  2E1M A;  3G71 P;  5F2O A;  3B4Q A;  1M74 A;  3B5I A;  3EJD A;  2ONT A;  2N6Y A;  5HGM A;  3RG2 A;  2GZE A;  4BPG A;  1RO2 A;  1AF8 A;  2M8L A;  2KG6 A;  1X3O A;  4XRQ A;  3DTJ A;  3G0V A;  3H47 A;  5BS1 A;  3DS2 A;  1JJ2 O;  2EHT A;  2NO8 A;  1W2B O;  4QKO A;  3CCQ P;  5KP6 B;  3G21 A;  2VLN A;  3HZQ A;  2FHS C;  3I55 P;  1A8O A;  5F2K A;  3DS0 A;  2JYL A;  1HY8 A;  4PWV B;  5HV8 A;  4CA3 A;  2LOL A;  1HQB A;  1IMP A;  2KOS A;  1YIJ P;  1VQ8 P;  1Q81 Q;  2KOO A;  1YJW P;  1VQK P;  3CC4 P;  2VLO A;  2XZ1 C;  4COC A;  2JB0 A;  5CZD B;  2EFJ A;  2CNR A;  1NJI Q;  2GZI A;  7CEI A;  2KG9 A;  3P05 A;  2EG5 A;  1VQ4 P;  1NQ4 A;  1VKU A;  1AUM A;  1T8K A;  2KOD A;  4U0C A;  1VHN A;  2AVA A;  2JQ4 A;  2L4B A; 
#chains in the Genus database with same CATH homology
 1GXG A;  2GYK A;  2GZF A;  1GXH A;  2K0D X;  3GKL C;  2JAZ A;  1ZNV A;  2VLO A;  2VLQ A;  3U43 A;  2JB0 A;  2K5X A;  1UNK A;  1IMP A;  2VLP A;  2GZJ A;  2GZI A;  1UJZ A;  2NO8 A;  7CEI A;  2WPT A;  1MZ8 A;  4QKO A;  4UHP B;  3GJN A;  4F37 A;  1IMQ A;  1FR2 A;  1EMV A;  1AYI A;  1BXI A;  2ERH A;  1CEI A;  2VLN A;  5EW5 E;  1E0H A;  2GZE A;  2GZG A;  2JBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...