7CEIA

The endonuclease domain of colicin e7 in complex with its inhibitor im7 protein
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
87
structure length
87
Chain Sequence
MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (COLICIN E7 IMMUNITY PROTEIN)
publication title The crystal structure of the DNase domain of colicin E7 in complex with its inhibitor Im7 protein.
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
molecule tags Immune system
total genus 28
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1998-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 7ceiA00
1GXGA 1BXIA 2VLOA 1UNKA 2VLQA 1AYIA 7CEIA 1IMPA 2JB0A 1UJZA 2JAZA 1MZ8A 1IMQA 2VLNA 4QKOA 1ZNVA 4UHPB 2GYKA 3U43A 4F37A 2NO8A 1EMVA 1GXHA 1FR2A 1E0HA 2VLPA 5EW5E 3GKLC 2K0DX 1CEIA 2K5XA 2WPTA 2GZFA 2GZEA 3GJNA 2GZGA 2GZIA 2JBGA 2GZJA 2ERHA
chains in the Genus database with same CATH superfamily
3LMOA 3G4SP 4NEOA 1MZ8A 1VQ8P 3CE7A 3DS3A 2EHTA 3G29A 4U0EA 3DS1A 4UHPB 2GYKA 3U43A 5HV8A 1YJ9P 3H4EA 1E0HA 4BPFA 4BPGA 1RO0A 3EJBA 3WBHA 3DS5A 1S72P 2XXMA 2VLOA 2P9XA 1Q86Q 2XZ1C 1VQMP 1W2BO 2JB0A 2MY5A 1AF8A 5JPAA 3CCLP 2N6ZA 3Q20A 2CQ8A 2M8NA 2K0YA 3H0DA 2FVAA 3HZQA 4U0BA 3CCQP 2GZFA 2ONTA 3GZMA 3CPWO 1KC8Q 1EIAA 2KG9A 2PENA 3CMEP 3I55P 1VQ4P 3DS4A 1E6JP 2FADA 1BAJA 2KORA 2K93A 1Q7YQ 2LTEA 2KGAA 2DNWA 5DCKA 2PEJA 1M90Q 5HGNA 1M1KQ 2LMLA 2AFDA 3CCVP 2M5RA 2GZJA 1YHQP 5F2KA 3DTJA 1YJWP 2MR7A 1HY8A 2MVVA 3CCJP 4QKOA 1VQPP 1X3OA 3G26A 5HGLA 2MF4A 2M8PA 2EFJA 3CCUP 2BUOA 2MR8A 2CG5B 2WPTA 3NTEA 4U0FA 3GZLA 2GDYA 3HYBA 2AFEA 5HVCA 2Z44A 4PH0A 2KR5A 1VKUA 2L0QA 2VLQA 3LRYA 2GDXA 4COPA 1DV5A 5HGMA 3E2DA 2JYLA 2QEXP 2LF4A 4HKGA 4U0AA 5KP8B 4IPYA 4WYMA 2K94A 2GZGA 2FVEA 1K30A 3VRLC 2KOPA 1VQ6P 1UJZA 1KQSO 2JQ4A 2OTLP 4IZ6A 2KGEA 1YIJP 2VLPA 2FACA 2KW2A 5EW5E 4H2WC 2JBGA 2QNWA 4H2YC 1L0HA 2FQ0A 2XV6A 1A8OA 3RG2A 5HGOA 1VQOP 2KGDA 2KG6A 5CZDB 3CCSP 2VSQA 2N98A 2XT1A 2FQ1A 1ACPA 4H2XC 3DS0A 1Z6MA 3I56P 4XFYA 4MRTC 1GPJA 4XRQA 2ERHA 2EIAA 2ROQA 1BXIA 2EG5A 4PWVB 1IMPA 3CD6P 2K2QA 2FVFA 2KODA 3OW2O 4M0IA 1HQBA 4PXHB 3CMAP 2JU2A 1QRJA 1KD1Q 4XFZA 2GDWA 2LPKA 2JGPA 3DS2A 2Z45A 4BPHA 4CA3A 2FQ2A 3EJDA 3EJEA 2LIWA 2X2BA 3G71P 2L9FA 3G21A 2KG8A 4U0CA 2OARA 3CC4P 2PEIA 3CC7P 1AYIA 1OR5A 3MGEA 4R0MA 2DGYA 2PEOA 2KWLA 3P05A 3CC2P 1Q81Q 1YI2P 1DNYA 4U0DA 3B5IA 2AVAA 5BS2A 1QVGO 1IUQA 1M6EX 2KOSA 1VQ9P 2JU1A 1A43A 5EJDA 1RNIA 1AUMA 2MD9A 1ZMBA 3G1IA 1KLPA 3H47A 2L6EA 1IMQA 2VLNA 3CCEP 2MVUA 2E1MA 4QNBA 2BHVA 2PY8A 2LL8A 2FHSC 3NY7B 3GKLC 1VQLP 2Z46A 1VQ5P 1M74A 1JJ2O 1N8RQ 2L4BA 3M1MA 2FAEA 2PEKA 1VQNP 2KOOA 1EMVA 1M6NA 1K9MQ 2LOLA 1VQKP 2GZIA 1GXGA 7CEIA 2PEMA 2N5HA 2JO0A 4GR2A 2N50A 1EOQA 2NO8A 2N6YA 3G28A 4XFXA 2K0DX 1YJNP 2K5XA 2PNGA 1F80D 2AF8A 1T8KA 2M8LA 4COCA 3G1GA 1NQ4A 3CCMP 2JYGA 5F2NA 1K73Q 1Q82Q 1D1DA 4GR6A 4F37A 1YITP 4PH1A 2LIUA 2QA4P 1CEIA 3G0VA 3RG6C 2N5IA 3GJNA 1L0IA 5F2OA 2GZEA 5I4TG 2CWOA 5BS1A 2CNRA 3CXCO 2CGQA 2JAZA 2KOQA 4XROA 5KP6B 2K92A 4DG9A 1VQ7P 2EHSA 3B4QA 1QVFO 2PEQA 5KP7B 2XZ0D 1UNKA 2L22A 2KGCA 2OTJP 1RO2A 3CCRP 1ZNVA 3DPHA 2K0XA 1VHNA 1GXHA 1FR2A 1K8AQ 2LKIA 3G6EP 1NJIQ
chains in the Genus database with same CATH topology
1GXGA 1BXIA 2VLOA 1UNKA 2VLQA 1AYIA 7CEIA 1IMPA 2JB0A 1UJZA 2JAZA 1MZ8A 1IMQA 2VLNA 4QKOA 1ZNVA 4UHPB 2GYKA 3U43A 4F37A 2NO8A 1EMVA 1GXHA 1FR2A 1E0HA 2VLPA 5EW5E 3GKLC 2K0DX 1CEIA 2K5XA 2WPTA 2GZFA 2GZEA 3GJNA 2GZGA 2GZIA 2JBGA 2GZJA 2ERHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXG A;  1BXI A;  2VLO A;  1UNK A;  2VLQ A;  1AYI A;  7CEI A;  1IMP A;  2JB0 A;  1UJZ A;  2JAZ A;  1MZ8 A;  1IMQ A;  2VLN A;  4QKO A;  1ZNV A;  4UHP B;  2GYK A;  3U43 A;  4F37 A;  2NO8 A;  1EMV A;  1GXH A;  1FR2 A;  1E0H A;  2VLP A;  5EW5 E;  3GKL C;  2K0D X;  1CEI A;  2K5X A;  2WPT A;  2GZF A;  2GZE A;  3GJN A;  2GZG A;  2GZI A;  2JBG A;  2GZJ A;  2ERH A; 
#chains in the Genus database with same CATH topology
 3LMO A;  3G4S P;  4NEO A;  1MZ8 A;  1VQ8 P;  3CE7 A;  3DS3 A;  2EHT A;  3G29 A;  4U0E A;  3DS1 A;  4UHP B;  2GYK A;  3U43 A;  5HV8 A;  1YJ9 P;  3H4E A;  1E0H A;  4BPF A;  4BPG A;  1RO0 A;  3EJB A;  3WBH A;  3DS5 A;  1S72 P;  2XXM A;  2VLO A;  2P9X A;  1Q86 Q;  2XZ1 C;  1VQM P;  1W2B O;  2JB0 A;  2MY5 A;  1AF8 A;  5JPA A;  3CCL P;  2N6Z A;  3Q20 A;  2CQ8 A;  2M8N A;  2K0Y A;  3H0D A;  2FVA A;  3HZQ A;  4U0B A;  3CCQ P;  2GZF A;  2ONT A;  3GZM A;  3CPW O;  1KC8 Q;  1EIA A;  2KG9 A;  2PEN A;  3CME P;  3I55 P;  1VQ4 P;  3DS4 A;  1E6J P;  2FAD A;  1BAJ A;  2KOR A;  2K93 A;  1Q7Y Q;  2LTE A;  2KGA A;  2DNW A;  5DCK A;  2PEJ A;  1M90 Q;  5HGN A;  1M1K Q;  2LML A;  2AFD A;  3CCV P;  2M5R A;  2GZJ A;  1YHQ P;  5F2K A;  3DTJ A;  1YJW P;  2MR7 A;  1HY8 A;  2MVV A;  3CCJ P;  4QKO A;  1VQP P;  1X3O A;  3G26 A;  5HGL A;  2MF4 A;  2M8P A;  2EFJ A;  3CCU P;  2BUO A;  2MR8 A;  2CG5 B;  2WPT A;  3NTE A;  4U0F A;  3GZL A;  2GDY A;  3HYB A;  2AFE A;  5HVC A;  2Z44 A;  4PH0 A;  2KR5 A;  1VKU A;  2L0Q A;  2VLQ A;  3LRY A;  2GDX A;  4COP A;  1DV5 A;  5HGM A;  3E2D A;  2JYL A;  2QEX P;  2LF4 A;  4HKG A;  4U0A A;  5KP8 B;  4IPY A;  4WYM A;  2K94 A;  2GZG A;  2FVE A;  1K30 A;  3VRL C;  2KOP A;  1VQ6 P;  1UJZ A;  1KQS O;  2JQ4 A;  2OTL P;  4IZ6 A;  2KGE A;  1YIJ P;  2VLP A;  2FAC A;  2KW2 A;  5EW5 E;  4H2W C;  2JBG A;  2QNW A;  4H2Y C;  1L0H A;  2FQ0 A;  2XV6 A;  1A8O A;  3RG2 A;  5HGO A;  1VQO P;  2KGD A;  2KG6 A;  5CZD B;  3CCS P;  2VSQ A;  2N98 A;  2XT1 A;  2FQ1 A;  1ACP A;  4H2X C;  3DS0 A;  1Z6M A;  3I56 P;  4XFY A;  4MRT C;  1GPJ A;  4XRQ A;  2ERH A;  2EIA A;  2ROQ A;  1BXI A;  2EG5 A;  4PWV B;  1IMP A;  3CD6 P;  2K2Q A;  2FVF A;  2KOD A;  3OW2 O;  4M0I A;  1HQB A;  4PXH B;  3CMA P;  2JU2 A;  1QRJ A;  1KD1 Q;  4XFZ A;  2GDW A;  2LPK A;  2JGP A;  3DS2 A;  2Z45 A;  4BPH A;  4CA3 A;  2FQ2 A;  3EJD A;  3EJE A;  2LIW A;  2X2B A;  3G71 P;  2L9F A;  3G21 A;  2KG8 A;  4U0C A;  2OAR A;  3CC4 P;  2PEI A;  3CC7 P;  1AYI A;  1OR5 A;  3MGE A;  4R0M A;  2DGY A;  2PEO A;  2KWL A;  3P05 A;  3CC2 P;  1Q81 Q;  1YI2 P;  1DNY A;  4U0D A;  3B5I A;  2AVA A;  5BS2 A;  1QVG O;  1IUQ A;  1M6E X;  2KOS A;  1VQ9 P;  2JU1 A;  1A43 A;  5EJD A;  1RNI A;  1AUM A;  2MD9 A;  1ZMB A;  3G1I A;  1KLP A;  3H47 A;  2L6E A;  1IMQ A;  2VLN A;  3CCE P;  2MVU A;  2E1M A;  4QNB A;  2BHV A;  2PY8 A;  2LL8 A;  2FHS C;  3NY7 B;  3GKL C;  1VQL P;  2Z46 A;  1VQ5 P;  1M74 A;  1JJ2 O;  1N8R Q;  2L4B A;  3M1M A;  2FAE A;  2PEK A;  1VQN P;  2KOO A;  1EMV A;  1M6N A;  1K9M Q;  2LOL A;  1VQK P;  2GZI A;  1GXG A;  7CEI A;  2PEM A;  2N5H A;  2JO0 A;  4GR2 A;  2N50 A;  1EOQ A;  2NO8 A;  2N6Y A;  3G28 A;  4XFX A;  2K0D X;  1YJN P;  2K5X A;  2PNG A;  1F80 D;  2AF8 A;  1T8K A;  2M8L A;  4COC A;  3G1G A;  1NQ4 A;  3CCM P;  2JYG A;  5F2N A;  1K73 Q;  1Q82 Q;  1D1D A;  4GR6 A;  4F37 A;  1YIT P;  4PH1 A;  2LIU A;  2QA4 P;  1CEI A;  3G0V A;  3RG6 C;  2N5I A;  3GJN A;  1L0I A;  5F2O A;  2GZE A;  5I4T G;  2CWO A;  5BS1 A;  2CNR A;  3CXC O;  2CGQ A;  2JAZ A;  2KOQ A;  4XRO A;  5KP6 B;  2K92 A;  4DG9 A;  1VQ7 P;  2EHS A;  3B4Q A;  1QVF O;  2PEQ A;  5KP7 B;  2XZ0 D;  1UNK A;  2L22 A;  2KGC A;  2OTJ P;  1RO2 A;  3CCR P;  1ZNV A;  3DPH A;  2K0X A;  1VHN A;  1GXH A;  1FR2 A;  1K8A Q;  2LKI A;  3G6E P;  1NJI Q; 
#chains in the Genus database with same CATH homology
 1GXG A;  1BXI A;  2VLO A;  1UNK A;  2VLQ A;  1AYI A;  7CEI A;  1IMP A;  2JB0 A;  1UJZ A;  2JAZ A;  1MZ8 A;  1IMQ A;  2VLN A;  4QKO A;  1ZNV A;  4UHP B;  2GYK A;  3U43 A;  4F37 A;  2NO8 A;  1EMV A;  1GXH A;  1FR2 A;  1E0H A;  2VLP A;  5EW5 E;  3GKL C;  2K0D X;  1CEI A;  2K5X A;  2WPT A;  2GZF A;  2GZE A;  3GJN A;  2GZG A;  2GZI A;  2JBG A;  2GZJ A;  2ERH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...