7CEIA

The endonuclease domain of colicin e7 in complex with its inhibitor im7 protein
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
87
structure length
87
Chain Sequence
MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (COLICIN E7 IMMUNITY PROTEIN)
publication title The crystal structure of the DNase domain of colicin E7 in complex with its inhibitor Im7 protein.
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
molecule tags Immune system
total genus 28
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1998-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 7ceiA00
1BXIA 1MZ8A 2VLNA 2JAZA 2K5XA 4QKOA 2GZEA 1GXGA 1GXHA 1UJZA 1CEIA 1AYIA 2GZIA 1FR2A 2GYKA 2VLPA 5EW5E 1IMPA 2K0DX 2NO8A 2VLOA 1EMVA 4UHPB 2ERHA 1IMQA 2VLQA 4F37A 7CEIA 2WPTA 3GKLC 1E0HA 2JB0A 3GJNA 1UNKA 2GZJA 1ZNVA 2GZGA 2JBGA 3U43A 2GZFA
chains in the Genus database with same CATH superfamily
4XFXA 1F80D 1HY8A 5F2NA 2PEIA 2MF4A 4U0CA 1K8AQ 4CA3A 2JU2A 1GXHA 1K73Q 5HGLA 2GYKA 4NEOA 1JJ2O 2LIUA 3EJBA 2L4BA 1VHNA 2QEXP 1M90Q 2L0QA 5KP6B 1E0HA 2K94A 3G4SP 3RG6C 4XFYA 4BPHA 1L0IA 4BPGA 2KG8A 1L0HA 3CCQP 1A8OA 2KGEA 1MZ8A 1E6JP 1OR5A 2CG5B 2N6YA 1QVGO 3CMEP 2K0DX 1M6NA 1VKUA 4GR2A 1IUQA 2JB0A 4H2WC 1ZNVA 5DCKA 1BAJA 2AVAA 3CE7A 2GZFA 3G1GA 4U0EA 2KOOA 2DGYA 2BHVA 3HZQA 2LKIA 2KOQA 5KP8B 2LOLA 2MVVA 3GZLA 2AFDA 1YJNP 3CCSP 2FHSC 2XZ1C 1VQ5P 4WYMA 2DNWA 3I55P 1K30A 2KOPA 2GDXA 2K93A 2LPKA 2Z45A 3GZMA 4U0AA 2JAZA 3DPHA 2FQ1A 3CCMP 2K92A 2E1MA 1UJZA 3LRYA 2NO8A 2VLOA 1M74A 3NY7B 5HGMA 1QVFO 3EJDA 5EJDA 5I4TG 1VQOP 1W2BO 3H47A 1NQ4A 1QRJA 2M8PA 3B5IA 1Z6MA 2FACA 3CC2P 2JYGA 1IMPA 2MR8A 3G26A 1VQ6P 2PEMA 2FVAA 1VQ4P 2JO0A 4GR6A 2CWOA 2KGCA 2Z46A 1YI2P 2XV6A 1KLPA 2VLNA 3DS1A 3CCUP 1EOQA 3CCJP 2GZIA 1AYIA 2XT1A 2OTLP 5BS2A 2EG5A 3CC7P 2FADA 3HYBA 4MRTC 4XRQA 2N5HA 1VQKP 3G21A 1YIJP 3B4QA 2LL8A 3G6EP 1AF8A 2CQ8A 1BXIA 3CD6P 2VSQA 1RNIA 3DS4A 2FVFA 2LMLA 5CZDB 2ERHA 1VQ8P 2JQ4A 2FQ2A 1YJ9P 3G28A 2GZJA 2KG6A 4M0IA 2JYLA 3G1IA 2KOSA 1M1KQ 2QNWA 2EHTA 1HQBA 2N6ZA 1KQSO 2AFEA 3EJEA 3H4EA 2KGDA 3RG2A 1Q7YQ 2BUOA 5F2KA 1YJWP 3I56P 1K9MQ 2JGPA 4COPA 2X2BA 2M8NA 2XZ0D 5JPAA 1VQ9P 4IZ6A 1RO0A 2FAEA 2PNGA 3G0VA 4HKGA 2EFJA 5HGOA 3M1MA 1VQNP 2KR5A 1EMVA 4UHPB 3NTEA 2VLQA 2WPTA 4PH1A 2KW2A 1VQ7P 2N50A 2FVEA 4XFZA 4U0BA 2L22A 1GXGA 3CCRP 1N8RQ 2PEJA 1AUMA 1VQLP 3CXCO 1X3OA 2CGQA 3P05A 4H2YC 1GPJA 2N98A 3MGEA 3U43A 3OW2O 2AF8A 4DG9A 2GDWA 2PENA 2LTEA 2KG9A 5F2OA 7CEIA 4U0DA 2PY8A 2ROQA 5BS1A 1ACPA 1DNYA 2JU1A 2PEQA 2M8LA 1NJIQ 3LMOA 2XXMA 1FR2A 5EW5E 4IPYA 2OTJP 1EIAA 1Q81Q 2EHSA 2K2QA 1Q82Q 4COCA 1T8KA 4H2XC 2MR7A 1UNKA 4QNBA 5HV8A 2GZGA 4PXHB 2EIAA 3CCLP 4QKOA 2GZEA 1D1DA 1KC8Q 1ZMBA 2MVUA 1M6EX 2CNRA 2LIWA 2KWLA 1VQMP 4PWVB 1A43A 4F37A 3CCEP 3DS5A 3CMAP 2P9XA 2QA4P 3GJNA 3G71P 3H0DA 2JBGA 2PEKA 4R0MA 2FQ0A 2K0YA 2K0XA 5KP7B 1CEIA 2KGAA 4U0FA 2PEOA 5HVCA 3DS0A 1DV5A 3CPWO 3DS3A 2KORA 2ONTA 1KD1Q 2L6EA 3CC4P 4XROA 4PH0A 2N5IA 2GDYA 2K5XA 2VLPA 1YITP 1VQPP 5HGNA 1IMQA 3Q20A 3DTJA 2Z44A 2MY5A 1YHQP 2M5RA 3E2DA 1Q86Q 1S72P 3WBHA 3DS2A 3G29A 3VRLC 2KODA 2L9FA 2LF4A 3CCVP 4BPFA 3GKLC 2MD9A 2OARA 1RO2A
chains in the Genus database with same CATH topology
1BXIA 1MZ8A 2VLNA 2JAZA 2K5XA 4QKOA 2GZEA 1GXGA 1GXHA 1UJZA 1CEIA 1AYIA 2GZIA 1FR2A 2GYKA 2VLPA 5EW5E 1IMPA 2K0DX 2NO8A 2VLOA 1EMVA 4UHPB 2ERHA 1IMQA 2VLQA 4F37A 7CEIA 2WPTA 3GKLC 1E0HA 2JB0A 3GJNA 1UNKA 2GZJA 1ZNVA 2GZGA 2JBGA 3U43A 2GZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BXI A;  1MZ8 A;  2VLN A;  2JAZ A;  2K5X A;  4QKO A;  2GZE A;  1GXG A;  1GXH A;  1UJZ A;  1CEI A;  1AYI A;  2GZI A;  1FR2 A;  2GYK A;  2VLP A;  5EW5 E;  1IMP A;  2K0D X;  2NO8 A;  2VLO A;  1EMV A;  4UHP B;  2ERH A;  1IMQ A;  2VLQ A;  4F37 A;  7CEI A;  2WPT A;  3GKL C;  1E0H A;  2JB0 A;  3GJN A;  1UNK A;  2GZJ A;  1ZNV A;  2GZG A;  2JBG A;  3U43 A;  2GZF A; 
#chains in the Genus database with same CATH topology
 4XFX A;  1F80 D;  1HY8 A;  5F2N A;  2PEI A;  2MF4 A;  4U0C A;  1K8A Q;  4CA3 A;  2JU2 A;  1GXH A;  1K73 Q;  5HGL A;  2GYK A;  4NEO A;  1JJ2 O;  2LIU A;  3EJB A;  2L4B A;  1VHN A;  2QEX P;  1M90 Q;  2L0Q A;  5KP6 B;  1E0H A;  2K94 A;  3G4S P;  3RG6 C;  4XFY A;  4BPH A;  1L0I A;  4BPG A;  2KG8 A;  1L0H A;  3CCQ P;  1A8O A;  2KGE A;  1MZ8 A;  1E6J P;  1OR5 A;  2CG5 B;  2N6Y A;  1QVG O;  3CME P;  2K0D X;  1M6N A;  1VKU A;  4GR2 A;  1IUQ A;  2JB0 A;  4H2W C;  1ZNV A;  5DCK A;  1BAJ A;  2AVA A;  3CE7 A;  2GZF A;  3G1G A;  4U0E A;  2KOO A;  2DGY A;  2BHV A;  3HZQ A;  2LKI A;  2KOQ A;  5KP8 B;  2LOL A;  2MVV A;  3GZL A;  2AFD A;  1YJN P;  3CCS P;  2FHS C;  2XZ1 C;  1VQ5 P;  4WYM A;  2DNW A;  3I55 P;  1K30 A;  2KOP A;  2GDX A;  2K93 A;  2LPK A;  2Z45 A;  3GZM A;  4U0A A;  2JAZ A;  3DPH A;  2FQ1 A;  3CCM P;  2K92 A;  2E1M A;  1UJZ A;  3LRY A;  2NO8 A;  2VLO A;  1M74 A;  3NY7 B;  5HGM A;  1QVF O;  3EJD A;  5EJD A;  5I4T G;  1VQO P;  1W2B O;  3H47 A;  1NQ4 A;  1QRJ A;  2M8P A;  3B5I A;  1Z6M A;  2FAC A;  3CC2 P;  2JYG A;  1IMP A;  2MR8 A;  3G26 A;  1VQ6 P;  2PEM A;  2FVA A;  1VQ4 P;  2JO0 A;  4GR6 A;  2CWO A;  2KGC A;  2Z46 A;  1YI2 P;  2XV6 A;  1KLP A;  2VLN A;  3DS1 A;  3CCU P;  1EOQ A;  3CCJ P;  2GZI A;  1AYI A;  2XT1 A;  2OTL P;  5BS2 A;  2EG5 A;  3CC7 P;  2FAD A;  3HYB A;  4MRT C;  4XRQ A;  2N5H A;  1VQK P;  3G21 A;  1YIJ P;  3B4Q A;  2LL8 A;  3G6E P;  1AF8 A;  2CQ8 A;  1BXI A;  3CD6 P;  2VSQ A;  1RNI A;  3DS4 A;  2FVF A;  2LML A;  5CZD B;  2ERH A;  1VQ8 P;  2JQ4 A;  2FQ2 A;  1YJ9 P;  3G28 A;  2GZJ A;  2KG6 A;  4M0I A;  2JYL A;  3G1I A;  2KOS A;  1M1K Q;  2QNW A;  2EHT A;  1HQB A;  2N6Z A;  1KQS O;  2AFE A;  3EJE A;  3H4E A;  2KGD A;  3RG2 A;  1Q7Y Q;  2BUO A;  5F2K A;  1YJW P;  3I56 P;  1K9M Q;  2JGP A;  4COP A;  2X2B A;  2M8N A;  2XZ0 D;  5JPA A;  1VQ9 P;  4IZ6 A;  1RO0 A;  2FAE A;  2PNG A;  3G0V A;  4HKG A;  2EFJ A;  5HGO A;  3M1M A;  1VQN P;  2KR5 A;  1EMV A;  4UHP B;  3NTE A;  2VLQ A;  2WPT A;  4PH1 A;  2KW2 A;  1VQ7 P;  2N50 A;  2FVE A;  4XFZ A;  4U0B A;  2L22 A;  1GXG A;  3CCR P;  1N8R Q;  2PEJ A;  1AUM A;  1VQL P;  3CXC O;  1X3O A;  2CGQ A;  3P05 A;  4H2Y C;  1GPJ A;  2N98 A;  3MGE A;  3U43 A;  3OW2 O;  2AF8 A;  4DG9 A;  2GDW A;  2PEN A;  2LTE A;  2KG9 A;  5F2O A;  7CEI A;  4U0D A;  2PY8 A;  2ROQ A;  5BS1 A;  1ACP A;  1DNY A;  2JU1 A;  2PEQ A;  2M8L A;  1NJI Q;  3LMO A;  2XXM A;  1FR2 A;  5EW5 E;  4IPY A;  2OTJ P;  1EIA A;  1Q81 Q;  2EHS A;  2K2Q A;  1Q82 Q;  4COC A;  1T8K A;  4H2X C;  2MR7 A;  1UNK A;  4QNB A;  5HV8 A;  2GZG A;  4PXH B;  2EIA A;  3CCL P;  4QKO A;  2GZE A;  1D1D A;  1KC8 Q;  1ZMB A;  2MVU A;  1M6E X;  2CNR A;  2LIW A;  2KWL A;  1VQM P;  4PWV B;  1A43 A;  4F37 A;  3CCE P;  3DS5 A;  3CMA P;  2P9X A;  2QA4 P;  3GJN A;  3G71 P;  3H0D A;  2JBG A;  2PEK A;  4R0M A;  2FQ0 A;  2K0Y A;  2K0X A;  5KP7 B;  1CEI A;  2KGA A;  4U0F A;  2PEO A;  5HVC A;  3DS0 A;  1DV5 A;  3CPW O;  3DS3 A;  2KOR A;  2ONT A;  1KD1 Q;  2L6E A;  3CC4 P;  4XRO A;  4PH0 A;  2N5I A;  2GDY A;  2K5X A;  2VLP A;  1YIT P;  1VQP P;  5HGN A;  1IMQ A;  3Q20 A;  3DTJ A;  2Z44 A;  2MY5 A;  1YHQ P;  2M5R A;  3E2D A;  1Q86 Q;  1S72 P;  3WBH A;  3DS2 A;  3G29 A;  3VRL C;  2KOD A;  2L9F A;  2LF4 A;  3CCV P;  4BPF A;  3GKL C;  2MD9 A;  2OAR A;  1RO2 A; 
#chains in the Genus database with same CATH homology
 1BXI A;  1MZ8 A;  2VLN A;  2JAZ A;  2K5X A;  4QKO A;  2GZE A;  1GXG A;  1GXH A;  1UJZ A;  1CEI A;  1AYI A;  2GZI A;  1FR2 A;  2GYK A;  2VLP A;  5EW5 E;  1IMP A;  2K0D X;  2NO8 A;  2VLO A;  1EMV A;  4UHP B;  2ERH A;  1IMQ A;  2VLQ A;  4F37 A;  7CEI A;  2WPT A;  3GKL C;  1E0H A;  2JB0 A;  3GJN A;  1UNK A;  2GZJ A;  1ZNV A;  2GZG A;  2JBG A;  3U43 A;  2GZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...