7CEIA

The endonuclease domain of colicin e7 in complex with its inhibitor im7 protein
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
87
structure length
87
Chain Sequence
MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the DNase domain of colicin E7 in complex with its inhibitor Im7 protein.
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
molecule tags Immune system
molecule keywords PROTEIN (COLICIN E7 IMMUNITY PROTEIN)
total genus 28
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1998-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 7ceiA00
1BXIA 1IMPA 1FR2A 2ERHA 2JB0A 2GZJA 2GZGA 2GZEA 3U43A 2NO8A 2GZFA 2K0DX 1UNKA 1IMQA 7CEIA 4F37A 5EW5E 2VLNA 1AYIA 2GZIA 1CEIA 2JAZA 4UHPB 1MZ8A 1E0HA 1GXGA 1GXHA 2GYKA 2WPTA 1UJZA 2K5XA 2VLOA 2VLQA 2VLPA 1ZNVA 2JBGA 3GKLC 3GJNA 1EMVA 4QKOA
chains in the Genus database with same CATH superfamily
1FR2A 4XROA 1VQMP 2KR5A 1RO0A 3CMAP 3H0DA 1VQ4P 2MF4A 2KGEA 5EW5E 2PENA 2GZIA 4COPA 2KG6A 4PH0A 1KQSO 2K5XA 2EHTA 1VQKP 1JJ2O 1W2BO 3GZMA 2MR8A 3HYBA 2ERHA 3U43A 2DGYA 3I56P 2GZFA 3EJDA 1YJWP 2PEKA 4U0CA 3CC7P 2MD9A 3B4QA 2FAEA 3CCSP 3G21A 2K2QA 1UJZA 3EJEA 3GKLC 4U0EA 1ACPA 1KD1Q 3B5IA 2N6YA 2M5RA 1VQ9P 2K94A 1AF8A 3G28A 1A8OA 5KP6B 2KOPA 1VKUA 2AF8A 5BS2A 2MVVA 4WYMA 2FVAA 1M1KQ 2GDWA 1ZNVA 1K9MQ 3CCVP 2M8PA 3CC4P 2JB0A 1S72P 2K0DX 2L6EA 2JGPA 3DPHA 1CEIA 4DG9A 2LOLA 3G6EP 1E0HA 3CC2P 2FQ1A 2LPKA 2LMLA 4U0DA 2KOQA 2L0QA 1YITP 2KGAA 2GZGA 7CEIA 3VRLC 1BAJA 5HV8A 2FVFA 1N8RQ 2PEJA 2XT1A 1M6NA 1NJIQ 4M0IA 2BUOA 2N98A 3G26A 1BXIA 2JU2A 1RNIA 2N5HA 1L0HA 2VLNA 1DNYA 1X3OA 4IZ6A 2QA4P 2JYLA 2PEMA 2JO0A 3CMEP 5F2OA 2LTEA 4H2XC 2FACA 2AFEA 2N5IA 2N50A 2LL8A 4COCA 2EHSA 2XZ0D 5CZDB 4F37A 2K0XA 2OARA 4QNBA 1GPJA 3E2DA 1GXGA 3DS3A 5HGNA 4H2WC 2MY5A 3WBHA 1YIJP 4CA3A 2L4BA 1VQ7P 2GZJA 3HZQA 1D1DA 2AFDA 1A43A 2PNGA 2FADA 4XFYA 4BPFA 3Q20A 5KP7B 3CCEP 5F2NA 2Z45A 3EJBA 1YHQP 2WPTA 2CWOA 2VLPA 3CCQP 1K8AQ 2KOSA 4U0FA 2FHSC 2P9XA 3CCRP 1YJNP 2MVUA 2LF4A 2JYGA 2PEOA 2PY8A 2EG5A 2QEXP 2FQ2A 2XZ1C 2M8NA 3CCMP 3DS4A 4PXHB 1QVFO 3GZLA 2ONTA 1VQPP 4QKOA 3CCLP 2K93A 1M6EX 3CCJP 2PEIA 3DTJA 2EIAA 1VQ6P 1MZ8A 1T8KA 5JPAA 1Q7YQ 1M74A 3NY7B 2BHVA 3CE7A 2AVAA 3G4SP 3H47A 4NEOA 2CG5B 1RO2A 2KG9A 2LKIA 1YJ9P 3DS1A 5KP8B 1KLPA 1VQLP 1OR5A 1ZMBA 1GXHA 3DS0A 2KGCA 3CD6P 4MRTC 5F2KA 1EMVA 3RG6C 2KOOA 2X2BA 1K30A 2EFJA 1UNKA 1EOQA 2M8LA 1AYIA 2XXMA 1Q81Q 3G1GA 1VHNA 1KC8Q 2KODA 1YI2P 1Z6MA 2KW2A 3LMOA 1QVGO 2CQ8A 1HY8A 2DNWA 4PH1A 2JU1A 1QRJA 1IMPA 1EIAA 2LIWA 1IMQA 1HQBA 3CXCO 5BS1A 2JAZA 4UHPB 2OTLP 3MGEA 3P05A 4U0BA 2VSQA 3G29A 1Q86Q 2Z44A 5HGLA 2PEQA 2VLQA 2KORA 5EJDA 4BPGA 2MR7A 4GR2A 4R0MA 2L9FA 5DCKA 3G1IA 3I55P 2CNRA 3CCUP 2FVEA 1AUMA 2CGQA 2K0YA 2N6ZA 2Z46A 3OW2O 4H2YC 4HKGA 2FQ0A 2XV6A 2VLOA 5HGOA 3DS2A 2JBGA 2LIUA 3GJNA 1NQ4A 2L22A 1DV5A 2QNWA 2ROQA 2KWLA 4U0AA 4BPHA 2OTJP 3M1MA 3G0VA 4PWVB 1L0IA 1IUQA 4XFXA 5HGMA 2E1MA 4GR6A 2JQ4A 2GDXA 1VQNP 1K73Q 2KGDA 3LRYA 4XRQA 2KG8A 1VQ5P 2GZEA 2NO8A 2K92A 1E6JP 1M90Q 5HVCA 3NTEA 5I4TG 2GDYA 4IPYA 3DS5A 1VQOP 1VQ8P 2GYKA 3RG2A 3CPWO 3G71P 1F80D 1Q82Q 4XFZA 3H4EA
chains in the Genus database with same CATH topology
1BXIA 1IMPA 1FR2A 2ERHA 2JB0A 2GZJA 2GZGA 2GZEA 3U43A 2NO8A 2GZFA 2K0DX 1UNKA 1IMQA 7CEIA 4F37A 5EW5E 2VLNA 1AYIA 2GZIA 1CEIA 2JAZA 4UHPB 1MZ8A 1E0HA 1GXGA 1GXHA 2GYKA 2WPTA 1UJZA 2K5XA 2VLOA 2VLQA 2VLPA 1ZNVA 2JBGA 3GKLC 3GJNA 1EMVA 4QKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BXI A;  1IMP A;  1FR2 A;  2ERH A;  2JB0 A;  2GZJ A;  2GZG A;  2GZE A;  3U43 A;  2NO8 A;  2GZF A;  2K0D X;  1UNK A;  1IMQ A;  7CEI A;  4F37 A;  5EW5 E;  2VLN A;  1AYI A;  2GZI A;  1CEI A;  2JAZ A;  4UHP B;  1MZ8 A;  1E0H A;  1GXG A;  1GXH A;  2GYK A;  2WPT A;  1UJZ A;  2K5X A;  2VLO A;  2VLQ A;  2VLP A;  1ZNV A;  2JBG A;  3GKL C;  3GJN A;  1EMV A;  4QKO A; 
#chains in the Genus database with same CATH topology
 1FR2 A;  4XRO A;  1VQM P;  2KR5 A;  1RO0 A;  3CMA P;  3H0D A;  1VQ4 P;  2MF4 A;  2KGE A;  5EW5 E;  2PEN A;  2GZI A;  4COP A;  2KG6 A;  4PH0 A;  1KQS O;  2K5X A;  2EHT A;  1VQK P;  1JJ2 O;  1W2B O;  3GZM A;  2MR8 A;  3HYB A;  2ERH A;  3U43 A;  2DGY A;  3I56 P;  2GZF A;  3EJD A;  1YJW P;  2PEK A;  4U0C A;  3CC7 P;  2MD9 A;  3B4Q A;  2FAE A;  3CCS P;  3G21 A;  2K2Q A;  1UJZ A;  3EJE A;  3GKL C;  4U0E A;  1ACP A;  1KD1 Q;  3B5I A;  2N6Y A;  2M5R A;  1VQ9 P;  2K94 A;  1AF8 A;  3G28 A;  1A8O A;  5KP6 B;  2KOP A;  1VKU A;  2AF8 A;  5BS2 A;  2MVV A;  4WYM A;  2FVA A;  1M1K Q;  2GDW A;  1ZNV A;  1K9M Q;  3CCV P;  2M8P A;  3CC4 P;  2JB0 A;  1S72 P;  2K0D X;  2L6E A;  2JGP A;  3DPH A;  1CEI A;  4DG9 A;  2LOL A;  3G6E P;  1E0H A;  3CC2 P;  2FQ1 A;  2LPK A;  2LML A;  4U0D A;  2KOQ A;  2L0Q A;  1YIT P;  2KGA A;  2GZG A;  7CEI A;  3VRL C;  1BAJ A;  5HV8 A;  2FVF A;  1N8R Q;  2PEJ A;  2XT1 A;  1M6N A;  1NJI Q;  4M0I A;  2BUO A;  2N98 A;  3G26 A;  1BXI A;  2JU2 A;  1RNI A;  2N5H A;  1L0H A;  2VLN A;  1DNY A;  1X3O A;  4IZ6 A;  2QA4 P;  2JYL A;  2PEM A;  2JO0 A;  3CME P;  5F2O A;  2LTE A;  4H2X C;  2FAC A;  2AFE A;  2N5I A;  2N50 A;  2LL8 A;  4COC A;  2EHS A;  2XZ0 D;  5CZD B;  4F37 A;  2K0X A;  2OAR A;  4QNB A;  1GPJ A;  3E2D A;  1GXG A;  3DS3 A;  5HGN A;  4H2W C;  2MY5 A;  3WBH A;  1YIJ P;  4CA3 A;  2L4B A;  1VQ7 P;  2GZJ A;  3HZQ A;  1D1D A;  2AFD A;  1A43 A;  2PNG A;  2FAD A;  4XFY A;  4BPF A;  3Q20 A;  5KP7 B;  3CCE P;  5F2N A;  2Z45 A;  3EJB A;  1YHQ P;  2WPT A;  2CWO A;  2VLP A;  3CCQ P;  1K8A Q;  2KOS A;  4U0F A;  2FHS C;  2P9X A;  3CCR P;  1YJN P;  2MVU A;  2LF4 A;  2JYG A;  2PEO A;  2PY8 A;  2EG5 A;  2QEX P;  2FQ2 A;  2XZ1 C;  2M8N A;  3CCM P;  3DS4 A;  4PXH B;  1QVF O;  3GZL A;  2ONT A;  1VQP P;  4QKO A;  3CCL P;  2K93 A;  1M6E X;  3CCJ P;  2PEI A;  3DTJ A;  2EIA A;  1VQ6 P;  1MZ8 A;  1T8K A;  5JPA A;  1Q7Y Q;  1M74 A;  3NY7 B;  2BHV A;  3CE7 A;  2AVA A;  3G4S P;  3H47 A;  4NEO A;  2CG5 B;  1RO2 A;  2KG9 A;  2LKI A;  1YJ9 P;  3DS1 A;  5KP8 B;  1KLP A;  1VQL P;  1OR5 A;  1ZMB A;  1GXH A;  3DS0 A;  2KGC A;  3CD6 P;  4MRT C;  5F2K A;  1EMV A;  3RG6 C;  2KOO A;  2X2B A;  1K30 A;  2EFJ A;  1UNK A;  1EOQ A;  2M8L A;  1AYI A;  2XXM A;  1Q81 Q;  3G1G A;  1VHN A;  1KC8 Q;  2KOD A;  1YI2 P;  1Z6M A;  2KW2 A;  3LMO A;  1QVG O;  2CQ8 A;  1HY8 A;  2DNW A;  4PH1 A;  2JU1 A;  1QRJ A;  1IMP A;  1EIA A;  2LIW A;  1IMQ A;  1HQB A;  3CXC O;  5BS1 A;  2JAZ A;  4UHP B;  2OTL P;  3MGE A;  3P05 A;  4U0B A;  2VSQ A;  3G29 A;  1Q86 Q;  2Z44 A;  5HGL A;  2PEQ A;  2VLQ A;  2KOR A;  5EJD A;  4BPG A;  2MR7 A;  4GR2 A;  4R0M A;  2L9F A;  5DCK A;  3G1I A;  3I55 P;  2CNR A;  3CCU P;  2FVE A;  1AUM A;  2CGQ A;  2K0Y A;  2N6Z A;  2Z46 A;  3OW2 O;  4H2Y C;  4HKG A;  2FQ0 A;  2XV6 A;  2VLO A;  5HGO A;  3DS2 A;  2JBG A;  2LIU A;  3GJN A;  1NQ4 A;  2L22 A;  1DV5 A;  2QNW A;  2ROQ A;  2KWL A;  4U0A A;  4BPH A;  2OTJ P;  3M1M A;  3G0V A;  4PWV B;  1L0I A;  1IUQ A;  4XFX A;  5HGM A;  2E1M A;  4GR6 A;  2JQ4 A;  2GDX A;  1VQN P;  1K73 Q;  2KGD A;  3LRY A;  4XRQ A;  2KG8 A;  1VQ5 P;  2GZE A;  2NO8 A;  2K92 A;  1E6J P;  1M90 Q;  5HVC A;  3NTE A;  5I4T G;  2GDY A;  4IPY A;  3DS5 A;  1VQO P;  1VQ8 P;  2GYK A;  3RG2 A;  3CPW O;  3G71 P;  1F80 D;  1Q82 Q;  4XFZ A;  3H4E A; 
#chains in the Genus database with same CATH homology
 1BXI A;  1IMP A;  1FR2 A;  2ERH A;  2JB0 A;  2GZJ A;  2GZG A;  2GZE A;  3U43 A;  2NO8 A;  2GZF A;  2K0D X;  1UNK A;  1IMQ A;  7CEI A;  4F37 A;  5EW5 E;  2VLN A;  1AYI A;  2GZI A;  1CEI A;  2JAZ A;  4UHP B;  1MZ8 A;  1E0H A;  1GXG A;  1GXH A;  2GYK A;  2WPT A;  1UJZ A;  2K5X A;  2VLO A;  2VLQ A;  2VLP A;  1ZNV A;  2JBG A;  3GKL C;  3GJN A;  1EMV A;  4QKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...