7FDRA

7-fe ferredoxin from azotobacter vinelandii, na dithionite reduced, ph 8.5, 1.4a resolution, 100 k
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oxidized and reduced Azotobacter vinelandii ferredoxin I at 1.4 A resolution: conformational change of surface residues without significant change in the [3Fe-4S]+/0 cluster.
pubmed doi rcsb
molecule keywords PROTEIN (7-FE FERREDOXIN I)
molecule tags Electron transport
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1998-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 7fdrA00
2Y0SD 3PNIA 1BLUA 3OR1B 3MM9A 5CH7B 2VPYB 1SIWB 3MM6B 3MM5A 1KQFB 1FDBA 2UZAA 2FJEB 1GAOA 4XDDA 1FRXA 2WSFC 2C3PA 1BD6A 1BQXA 4DHVA 1FD2A 1FDAA 1IQZA 3MMCA 1FXDA 1C4AA 1K0TA 1FRIA 4ID8A 2FJDB 2GMJA 1JB0C 1F2GA 1Y5IB 1GT8A 5FD1A 1CLFA 1HFEL 1R27B 1FXRA 1XERA 2WSCC 6FDRA 1G6BA 2V4JA 1FRLA 4XK8C 1B0TA 2VPXB 1H98A 5BYSA 2IVFB 3MMAB 1KEKA 1F5BA 1AXQA 4OV1A 2O01C 2FJAB 5CHCB 1IR0A 4CI0B 3OR1A 4OMFG 3MMAA 3MM6A 3EGWB 2FGOA 1DAXA 5E7OB 1GTEA 1BC6A 1A6LA 5BYRA 2WB1D 1FDNA 1SIZA 2ZVSA 1VJWA 2XSJB 1Y5LB 1B0PA 1H7WA 2C42A 3OR2B 1KQGB 2PMZD 2WAQD 4L6V3 1GTHA 3MMCB 1FRHA 1JNRB 7FD1A 2GMHA 1PC5A 3GYXB 1FDDA 1WTFA 1DURA 2PA8D 2XSJA 1RGVA 4XDCA 1D3WA 2VPZB 3MM7B 1B0VA 3MMBB 3OR2A 5BYQA 2FDNA 2VPWB 1G3OA 1Q16B 2C3OA 4Y28C 2C3UA 1SJ1A 2FD2A 1Y5NB 3IR6B 1JNZB 3MM7A 3MMBA 1F5CA 1DFDA 2PDAA 4KT0C 1H0HB 1H7XA 1BWEA 7FDRA 2FJBB 3EUNA 3MM8B 2V4JB 2VKRA 2WSEC 1FF2A 3HKZD 1FEHA 1FRMA 1ROFA 1Y4ZB 3MM9B 1FRJA 3IR5B 2C3MA 1FTCA 2Z8QA 3LW5C 6FD1A 1FRKA 2V2KA 1C4CA 3MM5B 4RKUC 5L8RC 1FERA 3C8YA 4AYBD 3IR7B 1PC4A 3EXYA 3MM8A 4YDDB 2C3YA 1FCAA
chains in the Genus database with same CATH superfamily
5EX0A 1Q79A 5CZXA 4J9LA 1Z2LA 1VQ7S 1NXIA 1RTJA 4LFCF 5BJRA 1PJ7A 4FBTA 1M1GA 5F8HA 3CGIA 3PW4A 3IAS9 2DNKA 1LW0B 4XTTA 4IRKA 3TUPA 3TRGA 5HLFB 2YKAA 4LF5J 1NK5A 2LQJA 4LRDA 1OJ4A 2YX1A 2RKIA 4L3KA 3GIRA 1X5SA 2W9CB 3Q8RB 1U48A 2VZ9A 1OWXA 1A6LA 4CH7A 1NDPA 3OJUA 1CJVB 2JC0A 3MFIA 1M5PC 2DR5A 3IWLA 1QAYA 2C2EA 4PWWA 4CQ1A 3GE9A 2HYIB 4KGZB 5I3UB 3HVRA 2ZZNA 3KJNB 1TR0A 5A8KB 2QGFB 1BGXT 1YJ7A 4K4SA 1Q86T 1IR2A 1HW8A 2WVEA 4F50A 1IM4A 4NLDA 2MY7A 3ZNUA 4B17A 1JXVA 2KI2A 3GCXP 4QR2A 8AT1B 4O44A 2BKPA 3H2UB 1N5QA 3IO1A 4I69A 3KK3B 4YB6A 4J5OA 5FLXU 2OEJA 2DRDA 1HNVB 3PR4A 1NCLA 2MYFA 1FXLA 4FYWB 2VF3A 4IQMA 3WX4A 4HHUA 3A13A 1JLCB 3GR1A 1VQ4S 2V4JA 2DO4A 1IKVA 3UN3A 4NMLA 4C8OA 2GJFA 2DGXA 1KDNA 2R8IA 1NJIT 2KN4A 2EPIA 1N4LA 2VUGA 4X62J 5K5MA 2E1PA 1RZMA 4ECRA 1EQ0A 4AXIA 2R7TA 1PG5B 5GAEI 1S1WA 2FHJD 2DBBA 4WFZA 4JYAF 2MQNA 2ZUGA 2DEJA 2C3OA 2C2ZB 5IV4A 1OSCA 1NMEB 3TANA 2VBWA 1VRTB 4TYAA 3QIPB 1X5OA 1FRMA 2DHSA 2RF2B 4ZKAA 3HVTB 5HAOA 5KG6A 4DR6F 2RDIA 1UFKA 1TUGB 5ETOA 5T7LB 2LU1A 1T95A 2B4VA 2DEIA 1R0AB 2GVZB 3UQSA 3KLEB 3MD3A 1U7LA 5E3AA 2XLKA 4KPCA 1ZPVA 3EE3A 1P6TA 2CA9A 4I56A 1U0HB 2QMWA 2BQUA 3RJMB 2ZBIA 1I6JA 3VAFA 1LKZA 2V94A 5I42B 2OKQA 1HQUB 2UU9J 5IS2A 3JTNA 1RXOB 4DI6A 3EVMA 2I5JA 2BABA 2DHXA 4URSA 2WAQD 2H54B 4DL3A 1I51B 3DYAB 1IWGA 3EM1A 1NB7A 2IM3A 1KTVA 2M52A 3M2UA 2F4VJ 1N34J 3MM7A 2X7IA 2LP4A 1AT1B 5HQLA 3NOCA 7FDRA 5IOLA 2X3DA 4LFAJ 3CF5Q 4DV3J 1SH2A 1AROP 1HNXJ 3V4MA 1ZZFA 2AHOB 1U47A 3ITHA 3RRKA 3KK1A 3S7RA 2XQCA 3R6LB 2DO0A 4Q8FA 5DG9A 1VBKA 3FDSA 4I2QB 4MKAA 4ENOA 2AYGA 2F8HA 1RAGB 1RT4B 1FI4A 3NKYA 1IKYB 2F4FA 4ECXA 1CBKA 3SXLA 2ASJA 5DQIA 2FLNA 2Y9HA 3G9CA 4DV4J 3J7Z5 1F9EB 2MQLA 2ZFHA 4A8FA 2G1DA 2KT2A 5GMKa 3AD8C 4DG1A 1VIXA 4QYRA 4U6PA 3FQLA 4M95A 3BQ2A 1YRXA 4ZPVR 5EWEA 3K5PA 4F04B 4ED0A 3SCLE 2KJVA 2V2KA 1HBMA 2Q6BA 2W2PP 4ETXA 2K06A 1B7FA 2E29A 3QO9A 1C1BB 3HFVA 4OYXA 3WBZA 1NO8A 3G8QA 1VC5A 4KGKA 4ZN1A 1T94A 3BSNA 2ZOMA 4LF9F 1U1OA 2DNMA 1CLFA 3DOMA 4LREA 2RU9A 2VA3A 2IA0A 3UCZP 1LW0A 4J9VA 1F5BA 3WDOA 5HLFA 2X51A 2UXBJ 3H40A 5EN1A 3GILA 2ZITA 4KBIA 3L7UA 2CQDA 2XSJB 2G13A 4ED7A 2V2VA 3T6BA 4DFKA 2W9CA 1XQIA 1HA1A 3R7SB 4CRJA 1R8BA 1CJVA 3VALA 1FJ7A 1REVB 2I2YA 3I0RB 2OMOA 4K0KF 5I3UA 1U1LA 1K44A 5A8KA 4TY8B 3DLEB 3GIKA 2RHQB 3MR7A 5GAHU 3ISND 2FQQB 4PG8A 1UVMA 1OQ3A 4OX9F 2B9XA 1HI8A 1SKSA 4JV0A 2MQQA 5KFXA 3KK3A 3Q24A 2YWFA 5ETKA 4LBIA 2QE5A 4HHJA 3AY0A 4JUZA 1HNVA 1R27B 2X1AA 4UW2A 3GTYX 4C8MA 4F67A 2YKNB 2B4PA 3ZZRA 1FX2A 1JLCA 3ZTRA 4LRAA 5DDOC 2GO9A 3MOZA 3J7YI 2IMOA 4P2XA 3LH2S 4PZVA 3KG4A 4Y6IA 5HJYA 3D0GE 2XMUA 3HJVA 3AH6A 2Y8WA 3Q86A 3T3FA 3PDNA 4WTYA 1CVJA 1OSDA 2MJNA 3R1HA 4CLTA 4YOEA 3T1YJ 1V9OA 2ALYB 2CQGA 2LEBA 4X2BA 4DFJA 2QA2A 2WRMA 3M1VB 5IQQA 1H2UX 2MB0B 2BX6A 3CIZA 2B6AB 4JI7J 5C24B 3GV5B 2XO6A 4HH0A 4G6VB 5D4OA 3R5BA 1NJYA 4HACB 3HHNB 4FF3A 2J9DE 2WBRA 5KFMA 3TZXA 2JEIA 1VRTA 3RB3A 3QIPA 3I82A 4DMZA 1WI8A 2RF2A 3HVTA 4HVZA 3ZZYA 1FD2A 3KHRA 5HI7A 3J7AN 2LKZA 2VQEJ 2WOMB 5T7LA 2VFUA 2V67A 1A0OB 1QJHA 1QAJA 1Y7PA 1CEZA 1U6FA 3OTBA 1XERA 1R0AA 4EEYA 1MU2A 2GVZA 1MMNA 2LDYA 3KLEA 2V9WA 5KG2A 3FCHA 1SCJB 4DR7F 3LUYA 2IVFB 3DLKB 3HHLC 2HHUA 2ASYA 3OTCA 4TQRA 3G71S 4AQYJ 2CG8A 2H5JB 1U0HA 4QCLA 3I4PA 2DXDA 2QX0A 3BQ1A 5I42A 2CQCA 1RBLA 3PYEA 1HQUA 5KFQA 2Z56B 4H54A 1WEYA 2IJNA 2CG4A 2KYXA 1UKUA 1TELA 4LSNB 1KFSA 2C2DA 3UD3P 4LF4F 4ED2A 1QSLA 5LT5A 4ZMMA 1KS2A 5KT7A 3DYAA 4OZ0A 3CVKA 3P6YC 5ETSA 1K47A 1EHWA 3W2VB 3EWGA 4N76A 2V50A 3QYYA 1FESA 1WOOA 1MNEA 4QR0A 4AYBD 1FCAA 3OR1B 3DU5A 1WSRA 1R3NA 3M8WA 1EAYC 1SJRA 2HZCA 3UNYA 4X4OA 4O0IA 2DNRA 3ONQA 3OL6A 3MD1A 3ZFVA 5A8RB 1XBWA 1N5SA 4F0HA 2VPXB 4I2QA 2HHSA 3L95X 3FBEA 3BKFA 1WDDA 3H5XA 3PACA 1RT4A 3NY0A 1IKYA 1S4EA 3I4HX 2LDIA 2EVZA 3NGUA 2MTLA 5DZ7A 1YSJA 4ECYA 4LF6J 3KLFB 2V6AA 3MCNA 5E33A 3HULA 4JV1A 2BQRA 2VG5A 1T05B 1JLGB 2FZGB 3UW1A 3BB5A 2KB2A 1NK4A 2FTRA 4PUOB 1S6UA 5B08A 1X9WA 2HLTA 5DM7Q 1P9YA 4C3LA 4KQZA 1MN7A 4LQ9A 4P52A 1JLEA 5DM6Q 2BRKA 4NASA 3MM6B 4C97A 5C5JA 4JI6J 3HK2A 2LMIA 3FEYB 3W1YC 1C1BA 1UA1A 3MR5A 1GT8A 2ZKUA 4QW9A 3IM8A 2X3GA 1S79A 3LO3A 1RB0A 4C0OC 3L7PA 5MAOA 4YY3J 1N5VA 3CDWA 4ECVA 2ZKTA 4ILMA 4GC6A 2ZH7A 4DUZJ 3CDEA 3KG1A 4G1IA 2FGOA 1K73T 1SJQA 3UE2A 1FNMA 2CUYA 2HKEA 2XSJA 5KFKA 3Q8QB 1F60B 2HK2A 1SKWA 1U8SA 5GMDA 3OJSA 1YWXA 2GJIA 4F3MA 3H8YA 2WSEC 5D4PA 3I0RA 1ROFA 2QN6B 4O3SA 3IR5B 4AL5A 5IXUA 5KFEA 4TY8A 3DLEA 3C8YA 3Q23A 4GRSA 1HBNB 2GHVC 2XI3A 1IXKA 2HPUA 1TAQA 2CJYB 3LP2A 2AF6A 3V2UC 4P2FA 5A76A 3DN9A 3ELHA 1EKSA 2MQOA 2CRLA 2R2SA 1NK9A 4Z7CA 4B3TJ 2ERRA 3D4JA 1VBYA 4ELTA 1VQ6S 1GMWD 4ZHRB 1JJCB 2IRXA 2DNZA 1WC6A 2VASA 3PZPA 2YKNA 4WKYA 4OZLA 1YITS 1JIHA 1GTEA 4RBUA 2E5HA 3PRDA 1XJWB 3TZYA 2RRBA 4WP3A 4DR2J 4DV1F 4J9SA 5GADU 2O67A 4HYKA 4ED4A 3GIMA 1Y3JA 5L39A 2HFOA 5D3GB 2I38A 1TL3B 4ECWA 2VPWB 1ZTWA 1ZS6A 1S1TB 1IBCB 3BPDA 3SYZA 5DLGA 2LYVA 3GMGA 3M1VA 4LIRA 1RLDA 1FEHA 3QBCA 4NCAA 2B6AA 4CH0S 4D3GA 4V19X 4CCHA 3CCMS 4YDDB 1VCTA 5L9XA 4RU2A 4PXEA 1RCXB 3VAMA 4HACA 2OTLS 2XMKA 3HHKA 4GVBB 2RB7A 1YIJS 4LF8F 3P8BB 2RS8A 3M8PB 3P4UB 2XI2A 3CC2S 2I6WA 3R5CA 1NKEA 2ZH2A 5L1KA 3BH6B 1JLBB 4GO5X 1LV5A 2AWZA 2WOMA 2G4BA 3B4DA 4DXLA 1VQSA 3B54A 1IR0A 4KTQA 2HIQA 3DLKA 4I7FB 4WU3A 2Y1LB 4LR9A 2E5JA 2JJ4D 3ILJA 4DR4J 4OFZA 4W4MA 3NRBA 2KVQE 2MEWA 2HHWA 4CLWA 3TARA 4N7TA 5AXLA 4LSNA 3B82A 2P9EA 2NZ4A 4ZPDA 1HD1A 3GYNA 2ZH6A 4F4WA 3GP9A 1MROB 4BHQA 3TEGA 1F3FA 4ZVSB 3IP0A 2EBGA 3FZBA 3FRYA 4J37A 1Y00A 3W2VA 1FFGB 3MUVP 2LEAA 2HQGA 5DETA 2C3PA 1UZHA 2MDAA 4RW8B 3Q2TC 1VRQC 2YNGB 1D09B 2W7PA 2ZNZA 1FD8A 4FZVA 5IC6B 3G4SS 4RR5A 2MHNA 3CJQA 4OI6A 3TP2A 1VFJA 2EG2A 1R8HA 3DDNA 4D3HA 4OV1A 2FJAB 1SV5B 3BKUA 5A8RA 3PKYA 1M5HA 2XMAA 3JAMU 3W65A 5DDRC 4ECQA 3D28A 2DNQA 2JHEA 3GFXA 1QE1A 1KQKA 1E6VB 3SV4A 1AA1B 1ZM2A 4U7CA 4DV7F 3IRWP 3KLFA 2H5IB 4E0DA 3MPVA 4OX7A 2OPRB 1UJ4A 5D0HA 5G4DA 3UCGA 3RTVA 1FKOB 4G65A 2UUAJ 1T05A 1JLGA 1CJUA 5C2CA 1JQGA 4PUOA 1HQ2A 4LF5F 1VMBA 1UL3A 1WJ9A 4ERDA 3R5JB 4LBPA 2XM3A 3EGZA 2MPUA 4ZCLA 1LXJA 3TVYA 1PGZA 2GMJA 4DZDA 1MWQA 1F2GA 1UP1A 4DSLA 3M6XA 2VKZG 2APOA 2RQCA 3F0NA 1U2RA 1UEKA 5EX3A 4JB8B 1YDLA 3TNVA 2DGUA 1RHJB 2VFSA 2R7UA 2C2RA 5BYRA 2DVIA 2H9ZA 1B3TA 3BBCA 1VGYA 2PMHA 3VGTA 2HQ3A 2Q79A 4OI3A 4UTGA 4M5NA 2OHDA 2WVDA 1LWCB 4I68A 5HVFA 4ELVA 3J7A1 2DGWA 2E5IA 4CO0A 3OHBA 2D74B 2OFHX 4CO4A 2EFPA 4O3QA 3R9LA 3RBDA 4KV8B 1V5VA 4I1TA 2MZ1A 2OEMA 2V5HG 4OX8A 1UVJA 2IJFA 1YZ6A 4OHWA 3KMQA 3W5XA 1B99A 4CT8A 1HBNA 4KH1B 1KQSR 3DXSX 1HQEB 1KD1T 2UUCJ 4DS4A 3FK4A 4X62F 1O8BA 1R8CA 3E3XA 1B0TA 4CNZA 4KJIA 2MKHA 1TKZB 2HFNA 1M1KT 3H2LA 3TVKA 2XC9A 4ZVOB 1NPKA 1RTZA 1H2VZ 4M1KA 2AEFA 4ZHRA 5E5NA 4OZ1A 1TTHB 2SXLA 1EKRA 1PYTA 2LCWA 4MIAA 2KFYA 4IH7A 2I1RA 2K2PA 4ETZA 2QYGA 4C3KA 2KL8A 1RABB 1SKUB 1AFJA 4DPUA 1WKJA 5D3GA 1TL3A 1S59A 1IBLJ 1S1TA 4NZ6A 2QLWA 3QGIA 3MZIA 4PYAA 4J9QA 2M2BA 1OQ6A 5F9LA 1TKTB 3RG6A 4PG7A 2LQ5A 3W5ZA 4IOCQ 1SJ3P 4HEA9 3L4BC 1KOHA 2UU9F 3P3DA 4U7UD 3JXOA 2MGZB 4LUBA 3W64A 4UOHA 2BE9B 4GVBA 4H4MB 1YTYA 3W60A 3M8PA 4R5PA 1AFIA 4DCJB 2R7OA 1FNXH 1JLBA 4XO0A 2MQMA 3OL8A 3I87A 3S6EA 3VGVA 1FFSB 2YPYA 2F4VF 1N34F 4A47A 1N48A 1RU2A 3ENWA 4J7CA 4LFAF 4I7FA 2CZ4A 4OI4A 4QIFA 4DV3F 1HNXF 2OD4A 2J0SD 4IG0B 3H2VE 3K0JA 3EDRB 5D4NA 3NNCA 2L9DA 2Z4PA 2XZWA 2FYXA 5LSRA 1VQPS 1YJTA 1N88A 4PXCA 2ZWOA 4J9KA 2HGLA 3NNHA 1EETB 2L9NA 2HNDB 3HHDA 1B7YB 2Y8YA 1HWJA 4J9OA 1FEEA 3F73A 5AXKA 4DQPA 3T1HJ 1MROA 1S77D 3HFZB 3I31A 4WFBQ 2CZVC 4BCAA 2R2UA 3D6MB 1UVIA 2MY8A 4RZRA 4NLYA 3G87A 3PW0A 2DXEA 4FPRA 4BBYA 1VYAA 1V3SA 4DZ6A 5FJ4A 4RW8A 4PG5A 2EFNA 2YNGA 1FRLA 2FC8A 3R5DA 4DUYJ 4FF4A 1RISA 2AIRB 1S57A 4DV4F 3TZWA 5KFJA 5THWA 4GKJJ 2W1BA 5HJXA 2DCLA 3DKDA 4FDFA 1SV5A 4DDFA 2EG1A 3JTPA 4EBDA 3PW2A 1U02A 1CG2A 3UVJA 3D1QA 3HT3A 3OUYB 4LRCA 2MQ8A 1E6VA 4ZA1A 2XCPA 1AUDA 1JNZB 3DXBA 2AJ4A 3S01A 2OPRA 1XNRJ 4JI0J 3H7HB 2JWNA 1IVZA 2RMLA 1FKOA 1F9HA 3RBZA 4DX7A 2P9CA 3KFWX 2WHOA 2QV6A 3H90A 1HYSB 3W66A 4O0NA 2UXBF 1T11A 4C9DA 1LWEB 1F1BB 1UZDA 4PWDB 3BGLA 5KFWA 1FT8A 3SBMA 2RILA 3AA9A 2CZ9A 2OI2A 4FPIA 1FK9B 3TVZA 2JLEA 2CJAA 4RUBA 1YBUA 2YBVA 1ZAWA 3R7NB 1VQ8S 3LA0A 1G1XA 4C6AA 4H4KC 2O1PA 3UCUP 2A6OA 2J6UA 3BSOA 1RAFB 3C6TB 3KUEA 3M8YA 3QT8A 4P7TA 1D3WA 4M5JA 1NPPA 4KY3A 2F63A 5KFDA 4WP8A 3T1AA 1LWCA 1VLOA 3E01B 3SSSA 1BWEA 1A7GE 5H9EK 2EC2A 5H9FK 2NLWA 3LW5C 1D9DA 2FVRA 3R2DJ 1QD1A 3SQGB 4KV8A 5AE3A 3UN2A 2KRRA 4G1QB 4RW6B 4GMKA 1AUSL 4Y2KA 1FVSA 4X64J 4QR1A 3UI3A 2ZBCA 3U27A 5J2PB 2CPXA 1TP7A 1Y5IB 2DNPA 4NPOA 3M6WA 2FHMA 3PG9A 4NLRA 5CA5A 1HQEA 1RT6B 3I6PA 5CABA 3T1YF 4MK8A 5KFNA 2UXCJ 4MMOA 5F8LA 1TKZA 1SC3B 4ZPWR 4JI7F 2DH7A 3ETMA 3HXMA 2G2YA 1S7IA 2UV8G 4Y2IA 2Y1IA 3DCAA 1NJZA 3HMJG 3EVWA 4Y65A 3GG0A 3MAQA 3DI6B 4X4VA 2Q43A 4YQWA 3TQ1A 1GMUA 2AU0A 2E7XA 4ZCKA 2VQEF 1RHKB 2ZOGA 1Y4ZB 4J91A 5F8JA 2JL9A 4WU2A 4IOBA 3QJJA 4PEOA 3PR5B 1IBKJ 3JSYA 3FCVA 4EU0A 4XIUA 1XWLA 2ZJPQ 1BQMB 1TKTA 3CXCR 1FRXA 4AQYF 2DB1A 3SFUA 1RP5A 4A46A 2MLZA 4KGVB 3PKMA 4C48A 5KT2A 9RUBA 2HS4A 4XK8C 5K20B 2MGZA 3CJKB 2BZ2A 2QFIA 5LMNJ 1Y3KA 2RQKA 4H4MA 4CTAB 2ASLA 3IG1B 5IC4B 3W8GA 4Y2CA 1GXTA 3TQEA 1D8YA 2B43A 3OXLA 1FJGJ 2GHPA 1XIQA 2M70A 3HJFA 5KFHA 4F36A 1R6YA 1HMVB 2KVIA 3FC9A 3HSDA 1FRHA 3CCTA 4FBUA 3H98A 5RUBA 3FBBA 4KRWA 4ED8A 1JWWA 1WACA 2IRYA 5F41A 3NMAA 1RJJA 2MLXA 3FVYA 4IG0A 5KFOA 4ZP6A 2XMJA 2V4RA 1DFDA 2KHCA 3WHIA 2DR7A 4DV0F 1WG5A 5BXIA 3TJ8A 2ZH9A 1DY3A 1EETA 4CLYA 3PW7A 1NH7A 2HNDA 2WW4A 2R8GA 1RT2B 4W90B 2XY7A 3KYLA 4EBCA 3QT7A 4LJMA 3C15B 1LFWA 1RT1B 1QUPA 2IMWP 2D3UA 3MR2A 4CLKA 2M0GB 1GQEA 1U26A 5GADI 1U4BA 4LF6F 4XPEA 3KXDA 2ZZTA 2IFXA 4JI1J 2HAFA 3KHHA 1NH8A 4X4QA 3MMAB 2CWKA 3AB2B 3ZTPA 2XTJP 5L1LA 2VQFJ 2W9AA 2BW7A 2IPOB 2AJ2A 3VQTA 4IO1A 4C11B 1M5KC 4OLPA 3FFIB 1JLAB 1S48A 3E8OA 4PQUB 2YNFB 4C8ZA 4RNOA 3CD0A 2NCKL 3D7SB 2J9DA 3BJYA 2R7WA 3CJTA 3DMJB 3OUYA 3FZ2A 2NQPA 4JI6F 3FMWA 1IM6A 1XNQJ 2J76E 3HO1A 3QRRA 2MZSA 2NPIA 4ZLPA 4OZJA 4PABA 2I0XA 1R7IA 5EUHA 2HEKA 4FYYB 1DLOB 4YY3F 4TU7A 4Z37A 3K8VA 2BANB 2QRRA 3TWZA 4ZVHA 1IQZA 4DUZF 1HYSA 5KOXA 4B9NA 2VIHA 1RU1A 1NHKL 1LXNA 4PWDA 2R2TA 2XMMA 1DRZA 3OFEA 3GIJA 1QY7A 1OYEA 5ITHA 3RU0A 5J1PA 1FK9A 4LF2A 4X4SA 3Q2SC 1UVNA 2KU7A 2Z57B 2JEGA 1CQNA 1KLMB 4I6AA 3SSQA 1RAHB 3AT1B 1XR6A 3C6TA 2F3JA 1S0OA 2QFJA 4JBCA 1TK5A 2HHVA 5F8NA 2CJ9A 3QGGA 3BYRA 2YKQA 3LWLA 3M6VA 3HSGA 5KFVA 2EXUA 3FNNA 2N82B 3E01A 3U1MA 4OZNA 5A2QY 2NXCA 4ER8A 3K57A 3MMCB 4NLWA 1DZ5A 1PBUA 1U49A 3VAKA 4B3TF 4FP9A 4M5IA 2CQ3A 4OI1A 1JKHB 2QT7A 1BQXA 4ZP7A 5T41A 3SQGA 2CPIA 4DL0C 4G1QA 3K89A 4RW6A 4YUDA 4CT9A 2L48A 4DR2F 3G82B 2XCAA 5J2PA 5E41A 4NLXA 4UZCA 4WF9Q 2BMBA 1HL6A 2DK2A 1RT6A 4USWA 4B02A 5J2QB 3R5AA 2KM8C 4QW8A 3DU6A 5KFCA 4PPZA 3HD2A 2LEPA 2FVSA 1TUVA 3VZHA 5LMUJ 4IRCA 2GJ2A 1EP4B 2MZRA 1DHMA 3MAHA 3BN4A 3TZZA 1WC4A 1HD0A 4KGMA 3VAHA 5J1EB 1T03A 3DI6A 1DQAA 2YH1A 2DGTA 4NLSA 1L3SA 1TZ0A 4G3IA 4OQJA 4O3NA 2E1MC 1W25A 2PN6A 3D5MA 2J5AA 3EXCX 2EKNA 2DTJA 1BUXA 2NPFA 2NR0A 2AGPA 3NL0A 3NXZA 4R8UB 2MMYA 4NLUA 1VLYA 2NUHA 3K17A 1BQMA 4WFXA 1IR1A 1HFEL 2HHXA 3A3PB 3BSAA 2BJ7A 4DR4F 1PJ5A 2HSEB 2KXFA 4CLLA 4LSZB 4MAKA 3V6KA 3QWUA 3CJKA 2XWYA 1WI6A 3KLVA 4ZIWA 3GWCA 5KG7A 4CTAA 5JVHQ 3IG1A 2HMIB 1QAXA 3OR2B 2WVBA 2GS8A 3FSYA 3AXMA 2VD3A 1T9TA 3MGJA 3QGPA 1U1PA 2FHJA 1HMVA 1YX2A 2CADA 2XGPA 3NGSA 5KFBA 4ES2A 1WHXA 2B8PA 3K5MA 1N36J 4X66J 1H38A 2VH7A 3NGKA 5E2QA 2G0IA 1ZAXA 1VQYA 1YJRA 2M8DB 5JUMA 3I5CA 1SQEA 3CMAS 3VAGA 4EUVA 3RBXA 1X0FA 1HI0P 1HNZJ 2UUBJ 3LQVA 3RW7A 3CDUA 3AD7C 5EWGA 1EQMA 2ZHOA 4NOHA 1KP6A 4LIWA 2B0GA 3R5GA 1FE0A 3C15A 2IIHA 1TKXB 3GJTB 1D1UA 2XHCA 1FA0A 3VCDA 3C2PA 1WD6A 2O3DA 4NYOA 1U8WA 1DTQB 3N01A 3MMAA 3BBBA 4IG3B 3ULHA 2UUAF 3GSIA 2L9WA 2KKHA 4KKOB 1ZM3A 4FS2A 4P7VA 2HQFA 4C11A 3TA0A 4A48A 2AJ0A 2OP5A 1RBAA 2CWXA 1JLAA 5KFFA 4PQUA 4NRTA 4O23A 4Y2AA 2YNFA 4TY9A 2AZ3A 1YKWA 3V4IB 2JVRA 5KTQA 3RB4A 4I0WA 2V4JB 1TQLA 1HBUB 1QSYA 5H1SV 2KG1A 2ZNYA 3IGVA 3DMJA 1C4CA 3QFWA 1NSQA 1WUUA 4HDHA 4WIQA 3LALA 1KQFB 3CCQS 1TL7B 3HZGA 5B0CA 1DLOA 1WKLA 3ZTSA 2KHDA 4LR7A 3EZ5A 4GC7A 2BANA 1QTMA 1N5YB 4MTPA 2ZVIA 3WZ0A 4CO1A 1SL2A 1NJXA 2DR6A 3N5FA 1HHSA 1NDKA 3W2WB 1RACB 4IR9A 2DGQA 1UW9A 4C98A 2BJ9A 4C7QA 5ETVA 2EK6A 2BJ3A 2IJRA 3A3OB 2ZZMA 5CCMA 4KC5A 2KT3A 1FWLA 2ZHAA 1X4BA 4EYIB 1KLMA 3GZ7A 4QZVB 5T14A 3OBIA 4IR1A 1Q53A 5KFRA 2QLXA 2QL5B 2XBPA 3CW2C 1T9XA 1J2VA 1F5AA 1NEEA 2F5GA 2VKRA 2B9YA 4RUAA 1I1GA 2UUCF 2CNNB 1RQ0A 2ZC4A 4MIBA 3JQKA 2C3YA 4DSFA 3T19A 4BLGA 5DG7A 2YKMB 5B0EA 4J9PA 4WP9A 3L7OA 3L9ZA 3J81Y 2WB4A 2AYMA 2XSFA 3MMCA 1ZBTA 3WIVA 1SB6A 4DR5J 1JKHA 3GJQB 1FTRA 3KDOA 3QRPA 1TK0A 4EZ9A 1IBMJ 1NBEB 2GQQA 1B64A 4XPCA 4UF4A 1C1CB 3G82A 5HQMA 3LP1B 2VBXA 3I5BA 2Q66A 3MAAB 1WF2A 2H48B 4FF1A 5DLFA 3HF5A 1ZOTA 2VFRA 3A1YG 1RA7A 5LXRA 1IBLF 1LWFB 3R3TA 1HLWA 5J2QA 2XWXA 1TKDA 2F65A 3IWXA 1RSCA 4Y28C 2W8LA 3OQ2A 2VHGA 1EP4A 2VOPA 3MM8B 2FC9A 2HQCA 2JEJA 1RWVB 5J1EA 2C28A 5ETQA 2OELA 4ECZA 4K4XA 2V8VA 8ATCB 2ILZA 2B5JB 1SQGA 2GAGC 1WTBA 3AOBA 2DXFA 4ZP9A 3VR1A 3OTEA 2J0QD 2E5GA 4R8UA 1ZZNA 1LOUA 2EBEA 5I3PA 5KFGA 3H25A 2NXUA 5CQGA 3THTA 2JFDA 2C2OB 3UD5A 1D0EA 4PRFA 4DQRA 1YZ7A 1I94J 3OTOJ 1WOSA 3DLLQ 4MK7A 3D6TB 3DRPB 4UZBA 2PFDA 2R4FA 1SJ4P 1RCOB 4K4UA 2VFTA 1PC5A 2HMIA 3HCXA 4DWIA 2M9KA 3OR2A 1XMBA 3T1HF 5A8WB 3VVTA 3KUGA 4ZPTR 3D0HE 2YQ3A 3DOMB 2GNKA 1HWIA 5J2MB 5AXNA 4WYWA 4ATNA 4NL5A 4DUYF 3ENVA 4IYQA 4NA3A 4ITSA 1NSKL 2LXFA 3BEGB 3MTKA 4F2RA 4GKJF 2J0XA 1FDAA 2YNIB 2YWKA 4JV2A 2ZBPA 2M88A 5F8IA 3RAQA 1S6OA 1K9MT 3F41A 3PO5A 5B0GA 1TKXA 2BKNA 3UPFA 1T9YA 4ZVPB 2GAHC 4AT1B 4BDPA 4ZPCA 2WVFA 1VJWA 3DOKB 1XNRF 1S0NA 5HN0A 4JI0F 1DTQA 2PMZD 2VG6A 2CJXB 1JNRB 4C0HA 2Z0GA 4IG3A 5KFSA 3GONA 1U1QA 3TEHB 2FVCA 4ZJOA 4KKOA 2HURA 4IH5A 3QFHA 3AA8A 3M05A 2UUTA 2OGUA 1Q7YT 4QQBA 1NK6A 3AQPA 2ZH5A 3CD7A 3EVOA 3ZO7A 2EFVA 4PQAA 2OPQB 3SSRA 4KSEB 5D0GA 3V4IA 3UDLA 3ZTQA 1HBUA 2Y0SD 2YQ1A 3HHEA 2KYZA 3IRXB 2ZM6J 1W2IA 4HL9A 4RWWA 2LLZA 3BREA 3QAUA 4Y34A 2OSRA 3OFHA 1VQLS 2XY6A 3PJXA 3ZXWA 1TL7A 1ZYQA 3HKWA 3T41A 1SC6A 4K4VA 6FDRA 1M90T 4UUXA 2JLFA 2R42A 4OYIA 3TUIC 4KPYA 3DHWC 1N5YA 1U6ZA 2QJ3A 2QSFA 3TI0A 3RGIA 2N4DA 2FVPA 2F7VA 5HATA 3UDEA 4RJVA 1YLXA 5B7WA 2ATLA 1OPIA 3W2WA 2CPDA 1YJVA 3CO9A 2WZ1A 4P71A 3S8SA 2R3VA 2QA4G 1V3RA 1WEZA 2VDIA 3LGHA 2LA6A 1PJ6A 4XAKA 2RHSB 3SDEB 3HD1A 1MU2B 1FF2A 1XN9A 2EK1A 4USKA 4X64F 3MDFA 2VC1A 2FLLA 3WQPA 5U47A 1FTCA 1ITPA 2H65B 4ES3A 4F4KA 3N0VA 2RDDA 3M32B 1ZA2B 1RKJA 2RNEA 2IM2A 2M4MA 3DFEA 5B0AA 2UXCF 4R0EA 3EDQB 5KOWA 4RW4B 2YKMA 4OYAA 8RUCA 2I8EA 3OXGA 3THPA 4O4GB 4DN0A 4LFBJ 5FD1A 4TU9A 2PIIA 4F4AA 4IUFA 1NUEA 3AB4B 1BHNA 2W2NP 2W25A 3LGMA 4N77A 1RWUA 2BDPA 4EO8A 4DLGA 2FVQA 1VQ9S 1U25A 1H73A 3PV8A 4KHPJ 2ZH1A 3MI7X 2DPIA 3M2VB 1C1CA 2ACYA 2MZJA 3LP1A 2VFVA 3N79A 3MAAA 3JS9A 4I2PB 1APSA 3QAEA 4RX6A 4NLOA 2CJQA 1IBKF 3MFHA 1LWFA 2ROEA 5DZ6A 4UQTA 2J7UA 3O6QA 3US5A 3IBWA 4AXJA 3C46A 4ES1A 4K50A 2I9SA 1N32J 2BJ1A 3DRRB 1T7PA 1P1TA 3EX7B 4IH6A 3NS7B 4PXDA 1HBOB 3PFEA 3PCOB 4USTA 2OD6A 3NCRA 5AXMA 1HHQA 2VV5A 3MM8A 1P1LA 3M30B 2RE1A 5LMNF 3D3CJ 1PAEX 1LEOA 2HWIA 2D41A 2DNNA 1NLKL 2QG9B 2AJQA 1FJGF 2HGMA 2GIRA 1Z4UA 4MYTA 4V19J 4KFBB 1H2TZ 2B5JA 1X4FA 4DFMA 1H98A 2VG5B 2HVZA 2XS2A 1P27B 1SH0A 5AE1A 3PX6A 2ZC3A 4UUWA 2B3TB 2LQBA 1K0VA 1JLEB 4X4NA 4MKBA 1I3OB 3DRPA 2VONA 1YK9A 4OJ3A 1IJFB 2AX0A 1G3OA 2D3OR 1D8ZA 1S9GB 4WXWA 4H4OB 5K8PA 1HWUA 3PHEA 4C8YA 4JI8J 3CJSA 3HDSA 2DCUB 2HIYA 3QZ7A 5A8WA 4DS5A 1OYDA 4USVA 2XYPB 4AFFA 4JI1F 3OVSA 2YXLA 1SI9A 5J2MA 2JNJA 3HSJA 1Q95G 3MECB 2OEKA 2HLUA 2A0FB 3ICLA 1JXEA 1X5PA 2VQFF 5AJ3J 5JJBA 2GX8A 1NHUA 2YNIA 2HVDA 4PPDA 1VQKS 2VDHA 2VL1A 1L3TA 5K8OA 4WZMA 3G96A 3E51A 4M5LA 2IYIA 1WHYA 5DGAA 1C2PA 2QYCA 4Q5VA 2WTFA 4HR2A 3W62A 1U1KA 1UCNA 1R89A 3EGWB 2IA6A 3AOCA 2R2RA 1H72C 4CLPA 1IKWB 4Q8EA 5KT4A 1XNQF 4NLTA 4Q2LA 3B4MA 1XMQJ 2RQMA 3DOKA 2G0JA 4FXWA 5LOQA 5IWAJ 1YGYA 4DL5A 5E3PA 3FCWA 4EZ6A 4P2MA 3OT9A 3Q0AA 3LP2B 2V9KA 3I0SB 2XZDB 4F0MA 1S72S 2QA1A 2B4UA 3BR8A 3EZOA 1FRJA 5KFLA 6FD1A 3C14B 4AUKA 5I4MA 4E98A 2MKCA 2BR0A 4DX5A 3D0IE 4BC9A 2XG8A 2OPQA 2PEBA 3CCES 2DH9A 2ZEJA 2Y1RI 3M8SA 3IRXA 3GB0A 3MURP 3RRHA 3GFZA 3PTWA 3KNGA 3W7BA 1DQ9A 3W8PA 2ZH4A 1UAWA 1LFPA 1CPZA 2DNHA 3VGUA 2MKIA 4KB7A 1VS3A 3QRQA 4BWJA 2OO4A 3AJ2A 4WXOA 2CDRB 1R6VA 3MEDB 5KT6A 3SCJE 4AD6A 3CCSS 3I55S 2F8EX 4ECTA 2RD5C 2GHWA 4WIIA 3Q89A 5KFZA 5HSPA 1YHQS 3PYGA 3EPGA 1S12A 1EZZB 2UV8A 1YJ9S 5C25B 3P45B 3SDEA 4WZQA 5L8RC 3BO4A 1DBDA 4MH8A 3AJDA 5K14B 5ETTA 2OH2A 1SH3A 4NRUA 4DL7A 4EGLA 1CJKB 1TL5A 3M32A 1AB8A 2R9LA 2BUNA 1QTNB 3M8QB 3MEGB 2VB6A 2XS5A 1V6HA 4RW4A 2DH8A 2HW3A 4O4GA 2GFFA 5LMUF 2AP6A 3MPWA 4WK3A 1UPMB 1KKHA 3UDVA 4MT1A 3K5NA 4QPXA 4NXMJ 2DITA 4YR2A 3M2VA 4CO2A 1F9FA 1PBAA 3CSKA 5B0BA 2HS3A 1O0PA 4I2PA 1F5CA 4I6YA 1LWXA 3R2CJ 1H7XA 2DR9A 3EGNA 4U8VA 4TKTA 3DRRA 3O3LA 3T5HA 1IKXB 3MR6A 4Y3CA 1HBOA 2K7JA 3OHAA 2MSTA 1X4HA 4EK2A 3EZUA 1YBAA 3N4WA 3M30A 1VHIA 1QE1B 2HQIA 5A6WA 3CTRA 1FXRA 3R6GB 4ED6A 2EFGA 3PIOQ 4A8MP 4KFBA 1R0BG 2PE8A 2K3IA 1K1QA 1YJNS 2VG7B 2E1CA 1N36F 4X66F 1CJUB 1TUWA 2QC3A 3T9ZA 2XLJA 4DF4A 3NNAA 1ICEB 1AW0A 4F4XA 1VI7A 4F4YA 4DPXA 1VJQA 3NGRA 4DX6A 5KFPA 2JSXA 2GVDB 1GX5A 4O4RA 3DLJA 1HNZF 2UUBF 2J9EA 5CCLA 2XS7A 2XMTA 1Q8LA 2CJBA 4C8LA 4ZCIA 1S9GA 4H4OA 3DOLA 1TFYA 2Q6CA 5F0WA 5ETNA 2RIJA 3FEZA 4DV6J 2BJ8A 4Z2XA 3OVBA 2QIFA 1FDBA 2OPPB 4WFYA 5GVQA 3NGTA 3BM7A 4MIWA 3VGSA 4HLBA 2YPZA 1JB0C 1XR5A 3Q8UA 1KNZA 3MECA 2HHPA 4PWUA 3BYPA 2KFNA 3SZ2A 2N3LA 4DPTA 4KYZA 2G2OA 5CHCB 2R7XA 4FXDA 4K8RA 3TAMA 1SKRA 4DPYA 2NXEA 1RTIB 1KQGB 5LSLA 3ZZZA 1KRPA 2MQPA 2V68A 4FF2A 1IKWA 4WPAA 4DU8A 2QLJB 1JLFB 5C2GA 4DJBA 3N6LA 4ZVFA 2EW9A 2B9WA 1OPZA 2L3MA 2YY3A 4AL6A 1RT5B 3LPEA 1NZAA 3MCMA 3TUJC 2O66A 1HR0J 2DISA 3IBFB 3UFCX 3VF0B 5IT9Y 4FNIA 3I0SA 1X8DA 4LMZA 1FKPB 2VODA 3ZC4A 1SIWB 3C14A 2FJWA 1MLAA 3FQKA 1G7CB 1RHRB 4NCBA 2YVSA 4B3OB 3G6ES 3PX4A 4DOZA 4Q44A 1RADB 2Z2YB 2HVEA 4OYOA 3NWGA 2DYAA 1LNQA 3T9NA 2DGSA 3OV7A 4QWEA 3CPWR 3ET6B 5C7PA 4TVAB 3U02A 2DNGA 1BMQB 2AGOA 2CVIA 2DRAA 4A8YA 5DDQC 4ZPAA 1OS5A 4OHXA 4OZ3A 2GMHA 1U2FA 1OY9A 1UFWA 4FN5A 4ELUA 4JI4F 4IFYB 5BYQA 4ZVQB 3G6XA 5KT5A 3MEDA 4LF1A 2B7BB 3MCOA 1Q5VA 4WWSA 2B9EA 5E3QA 3OXFA 1SBRA 4R5PB 4KIAA 4ZVUB 4DR5F 1QM9A 4PKDB 2Q3PA 2UVWA 4X84A 3M8ZA 1IBMF 2QTWA 3OFGA 2A18A 1TL4A 5C25A 2CNLB 2FJEB 3TR5A 1M5SA 4J9UE 4DEZA 2AMCB 3KDNA 3FKBA 1GK8A 2WW8A 1HHTP 5K14A 2BYCA 4DV7J 1L3KA 3I96A 2CXEA 1TMMA 1P9QC 2CQPA 1TU0B 1CJKA 4HTIA 3DLBA 1UTAA 1ZPWX 4YS2A 3CDAA 2ZE2B 4JI3F 2UXDJ 4LQ3A 2KDOA 3M8QA 3MEGA 4CI0B 3QZ8A 3QSYB 3AXKA 3RAXA 3H0PA 4A8SA 1YJWS 1S1UB 2DIUA 3Q8YA 3TX8A 2N3OA 2HRTA 1MG7A 5J2NB 2MXYA 4EYHB 2VJUA 3P5BP 4OZ5A 3H5YA 2V69A 4E2FB 4NWBA 1REGX 1U1RA 4TLRA 4FKYA 2HBZB 3KJQB 3DRXA 2NSBA 2A10A 4W92B 2W4DA 4NEZA 4ZITA 1WEXA 4DN9A 1F0XA 5E3RA 1MMLA 5KG5A 3H5SA 3MPUB 1IKXA 3ENAA 5HP1A 2CPHA 4QOTA 1I94F 3OTOF 3BO3A 3UVJB 1FHTA 2QLFB 4P2SA 2XULA 1I5OB 4ZIVA 2CPZA 4DQQA 3DRYA 4OIXA 2HWTA 5LSOA 2OUGA 4X65J 1NDLA 1R43A 4QPTA 4N41A 4YHHJ 2DNLA 5FIIA 5JVGQ 3IFEA 3FMBA 2M5YA 2MSSA 4NLGA 2ZH8A 1T9VA 2VG7A 5ETLA 4UY85 3D6HB 1R31A 2YWHA 1O5JA 1RLCL 1HWKA 2AKWB 4NEYA 3BO2A 3FSIA 4M5DB 4U9RA 2GVDA 3B78A 3PM9A 2KXHA 1X5TA 2K1RB 4A8KA 3CDBA 5CYMB 3IBCB 5D15A 1IUJA 2CFXA 1ZM4A 3C6UB 4A8XA 2VBYA 2ASDA 4CP5A 4JP8A 4I67A 1EARA 1URRA 2RDJA 4PG4A 3TAQA 1CS4B 2R8KA 2OPPA 4IFVB 3IS9B 1PCAA 3ILOA 1OIAA 1RT3B 5SUHA 2ZH3A 2G0CA 2QO3A 4R25A 1LQ9A 1L3VA 3HVAA 3G2XA 5D77A 3NAIA 1N0VC 2HNZB 1EB0A 3CJ0A 2E9RX 1B0PA 5ETMA 1HNWJ 3T5KA 4K2XA 3HFKA 1HKAA 4FXVA 3GCWP 3LGNA 1RTIA 5AE2A 1Q16B 3O2IA 4AL7A 3NCQA 2ZM6F 2U1AA 1JLFA 1UVLA 3DLGB 1KFDA 2DHAA 4IRDA 1PIEA 1RAIB 2YWGA 4IOAQ 1RT5A 4OJHA 4ZVRB 1QAIA 1RI7A 2CDQA 1KVIA 5HROB 2ZDPA 1BLUA 3KK2B 2GA7A 2IYGA 2P6SA 4YEAA 3R7BB 1GX6A 4LVNP 3T5LA 1FKPA 2KTQA 1UW4A 2WONA 3IWNC 2G1HA 4U7UK 2L08A 3CCRS 3SEOA 4UOFA 3QLHB 3QMQA 4L74A 4U8YA 3PO4A 4B3OA 1S4FA 2FLOA 1Y10A 1AYEA 1VC6A 2L41A 3J80Y 3KLGB 1U45A 2QA4S 2PGCA 3FUYA 3DDIA 3HHLB 4MK9A 3ET6A 2OAUA 1SJFA 2J9CA 1QUVA 3MPDA 1HI1A 3CJ4A 2CQ1A 3KUHA 4IO9Q 4B08A 1RHQB 1XEZA 4N47A 1IN0A 1CULB 2F9DA 2LXUA 7AT1B 4IFYA 2FHOB 5A2QU 4ZDNA 3CCJS 3A3NB 3MMJA 1WELA 4LFBF 3PRBA 4L76A 5KG4A 4K5SA 3OTDA 4E8UA 3UN5A 1SC4B 2W2MP 3RAMA 2EKYA 2WSFC 2HGNA 2E7VA 4HTJA 3HT0A 4KHPF 2E7WA 1GXLA 5C42B 1CJTA 3H42A 1BXNA 3CC4S 2OMLA 2AW0A 5DRKA 1D9AA 3Q8VA 2ZE2A 4KR0B 1YI2S 2MHEA 2BOPA 1KOOA 2RUSA 1N32F 2V0NA 5EHHA 1CQMA 2Z2MA 4RUCA 2HHQA 4WBFA 1S1XB 1S1UA 3LWMA 1TAUA 3N5BA 3IXQA 3CCZA 4HI1A 5J2NA 5JXSA 4RNNA 1SPBP 2RSQA 1RYRA 3PX0A 2CAJA 4NI2B 1E6YB 4FNHA 1PYSB 2E66A 1KR4A 3K7RA 1RT7B 3QJLA 3ZZPA 1X4GA 2VA2A 5EWFA 1ZH5A 2UVVA 1X9SA 2XNQA 1TV6B 5BR8J 2F9JA 3L3CA 3BF4A 3DC2A 2C22A 2J0WA 1RYSA 3JSRA 4DFPA 1PSDA 5M2UA 2CQBA 4DSEA 1URNA 3ZZUA 3BDPA 3F56A 4USHA 3EMTA 3EPIA 1BWVA 5E3CA 1Y0HA 2GMLA 2W7AA 4JI8F 1S76D 2BVZA 5IQ6A 1NZ8A 5D0RA 4NE9C 1S9FA 2P5VA 1IJEB 3CEDA 2V4QA 3QNWB 2AEJA 3PYFA 2XHWA 1VQOS 3BGOP 5L1JA 3DGVA 1FFWB 1H0HB 1VQ5S 2IRUA 2COLA 3EICA 4JOUA 5AJ3F 4F0KA 2KXNB 3GV7B 2O5DA 4M5DA 1Q4RA 2IC3B 2NSCA 3AQOA 4K7QA 2XNRA 1FVQA 2K1RA 4ZOSA 4F25A 1GAOA 1YJUA 4CLUA 2V63A 5CYMA 4K2JA 3BSCA 1ZA1B 4EFAC 3Q8PB 3C6UA 2E5LJ 5CXTA 5DQHA 1VQNS 2KFZA 2BACA 5F8GA 3HPOA 2PEHA 1RKIA 1MWZA 2LXIA 1WC1A 1CS4A 4IFVA 3IS9A 1XMQF 3QWPA 4F2SA 3K5LA 4NA1A 4U95A 3EGVA 2HRYA 4OJ1A 5IWAF 3V6DB 1RT3A 2CPFA 4C4WA 4DQSA 3UO0A 3FJ2A 1GTHA 3LTOA 4CWBA 1RWPB 2HNZA 1DURA 4DR1J 3CJ2A 1S6QB 3MMBB 3CULA 4MKVA 1JX4A 1F3VA 2AJFE 4WFNQ 3JYTB 3W9IA 4LRFA 1X7VA 5D4LA 4WKRA 3KTQA 1KSPA 4QJVA 3DLGA 1XMOJ 4P74A 1PC4A 5KFIA 3ZZ0A 3OL7A 1MWYA 5D6GA 4F4ZA 5G0RB 3LAMA 5HROA 3W5YA 1K0TA 2H1YA 3C19A 3KNAA 3KK2A 2R7VA 1PKUA 3H4DA 2HFVA 3FSXA 4PXBA 1L3UA 1Q78A 2JVOA 4DV5J 1Q8KA 2NXNA 4HHHA 5L1IA 4DV0J 3VAIA 2P6TA 3QLHA 4A8QA 1T03B 1HARA 1H74A 5LXYA 2ADCA 1H7WA 3CNQP 4FVMA 1VISA 3PFOA 4U67Q 3KLGA 7FD1A 4EMDA 3B8HA 1XK8A 1H3DA 1FDDA 2CQ2A 4ZCMA 3BBFA 3X1LB 4GKKJ 3HHLA 1UETA 1RWXB 2B4OA 2J8AA 3M2RB 2IVMA 4RO0A 3AFGA 5CYJA 1CULA 2C3MA 4HT7A 2V34A 1KONA 3J81U 5L46A 4OHYA 4J90A 4DR3J 3MR3A 3BKTA 1ZETA 2XYGB 3NCPA 4Y00A 5FLXY 3FEXB 3CJ8A 4KAIA 3OVAA 4NXMF 2FJVA 4ALZA 1J27A 1WNEA 2W9BB 4A8OA 4R0JA 2ROGA 5HVHA 1S0VA 2V8DA 5C42A 2RT3A 1KN6A 3I56S 4ID5B 2JH3A 5IM0B 2G2ZA 2J6TA 3TW0A 1ZTTA 4FYDA 3K8WA 3BGRB 4S0MA 1YRUA 2LU2A 2C42A 4WK1A 1FJCA 2DNOA 2OJ3A 4F02A 4F26A 1YRTA 1A9NB 2ABYA 2B51A 1UVKA 1S1XA 3CCLS 1WC5A 1VDHA 1SQFA 2D9PA 2Z8QA 4NI2A 1E6YA 4Y0FA 2IBKA 2RUGA 1X9MA 4DSJA 4B9SA 4OI0A 1HW9A 1RT7A 2VPYB 2BQ3A 5DDPC 3CD5A 4QWBA 1REVA 1AZSB 1C4AA 4WJBA 1WOPA 4CLFA 4DL4A 2YQ0A 1TV6A 4RW7B 4FYVB 3DLHA 2QMXA 3D3BJ 1G4CA 3A8JA 4NYZA 1T8EA 1Q1KA 2PMWA 2JZ5A 3CE8A 1NAQA 4F3OA 4KO0B 1UFLA 3UD4P 4M8LA 1VRUB 4BWMA 1U2CA 2CIMA 2BKOA 1S5ZA 2EWHA 1RE1B 1PILA 3A4TA 4M63A 2EI5A 3H4BA 5J1NA 3GFYA 2K8GA 4QWCA 2GO8A 3O44A 3R27A 4ZLNA 4DV6F 3AODA 3M6UA 3NAHA 2G9OA 3DNCA 4KT0C 1RWOB 3H20A 1TVRB 1FNOA 1ZM9A 5B0FA 1OMSA 3O1LA 3T6JA 2DY9A 2RH3A 2R7QA 5B09A 4DLEA 5A0YB 3GJSB 2W2OP 4DPWA 4KE5A 1S99A 4F3QA 1RTHB 2H3EB 3LP0B 4O3OA 2IC3A 4ED3A 1TK8A 3W61A 3IC1A 2R7SA 3L09A 5FDLB 5C24A 4DCPB 4URGA 4ZP8A 2YX4A 1VK3A 4LVOP 2A1BA 3NG8A 3TUZC 4JI5J 1XTZA 4CDIA 1V3ZA 1HR0F 3V6DA 1UA0A 1GFWB 3M9OB 4QYZK 5M2PA 1QLNA 1RGVA 1RWKB 4ZJQA 3WC2A 1YQHA 4X4TA 1O51A 2CPYA 2LECA 1HNIB 5DJBA 1S6QA 3MMBA 2GCFA 4ZN3A 2C1EB 1S10A 2B7CB 2XGQA 4M5HA 2FZKB 2NZCA 2JX2A 3JYTA 2QLBB 1WDTA 4QIEA 5CH7B 3CMQA 3HP6A 4WE1B 3RRGA 3OSNA 1BE4A 1S7HA 2ADBA 4TYBA 1X4DA 2P2CB 3MEEB 4TNOA 2QL7B 6AT1B 5G0RA 3T5JA 2DNYA 3POTB 2R8JA 3GFHA 3X3UA 3J81j 1JK9B 3OR1A 2DRBA 5ETRA 2HWHA 3PVXA 4DV2J 5E7OB 4USJC 2E1AA 1N52B 2RU3A 3BPSP 1SIZA 1K1SA 4DL2A 4TXSA 4LF7J 4AE5A 1S0MA 5HVGA 5HMWA 3KJFB 4NXNJ 1B0VA 3NWRA 3OPKA 2QMUB 1JJHA 3KKFA 3M9MB 3QPIA 1Q81T 1MN9A 2FPHX 3D68A 3NEKA 2VOOA 1Y9OA 4KGXB 3CJRA 3M2RA 2UUWA 3NGDA 4HKQA 2PI5A 3MUMP 1B4SA 2UXDF 2UZAA 4ECSA 1KHVA 2KZMA 1RWMB 2C2NA 4QBUA 5EDWA 3W3SA 2HBYB 2ZBRA 3CC7S 2K7KA 2NXJA 1NKCA 1FWPA 4J9MA 2ZJRQ 3D54A 1CC8A 5ADZA 3G6VA 4P72A 1WORA 3NS6A 3A8EA 2W9BA 1FO1A 4NCGB 4B9VA 1N33J 3K2YA 2GIFA 3MM6A 3DM2B 4B3SJ 3FGVA 2AEMA 3S1TA 3KWMA 2JLGA 4ID5A 5IM0A 1J5EJ 2C2MB 4OYPA 2FHKA 2HG4A 2N7CA 2DT9A 3BGRA 4OYBA 3BDEA 4NX9A 4B9LA 2HHHJ 1Y5NB 1YVFA 3G8TA 3VAJA 2PC6A 3RB0A 3D1OA 3HI9A 3CIMA 4MFBB 3MM5B 5F9NA 5E0OA 2YKPA 2FLPA 2AT1B 2ZJQQ 1HWLA 5M2RA 3BR9A 1T02A 2IHR1 4X65F 4YHHF 1OY8A 1LW2B 1RUSA 2VG6B 1FX4A 5CZVA 3VVUA 3UWTA 1AZSA 4C0BA 4DSKA 2W01A 3CO0P 1X4EA 4RW7A 1FE4A 2D7SA 5CAAA 4PAAA 1GXUA 2HBRB 2FGCA 4A8WA 1XR7A 2P9GA 4KO0A 2KJWA 2AX1A 3M7VA 4LT6A 1WC0A 1Y11A 1VRUA 4K4WA 3H5UA 4X4PA 2BM1A 4RBTA 4B9MA 4B3MJ 2ZBQA 4ANEA 4QIGA 1M5OC 3GLJA 2K3KA 3IR6B 5SZTA 1X0PA 2ZUAA 2QSWA 2CQHA 1SXLA 3MPYA 1Z1ZA 3Q83A 1S9EB 3A12A 2JC1A 4DUTA 1TVRA 4YDXA 1JJ2R 2ROPA 5HMZA 5CYQB 4P10A 3AD9C 3KLIB 4ZK7M 5A0YA 2PO4A 4B3RJ 1S49A 4RUHA 2EFQA 1P8GA 1RTHA 2IAJB 2YX7A 3CB4A 3LP0A 2U2FA 3KMSA 3N6MA 1HNWF 4M5KA 3V6JA 3PEJA 4HDGA 1AXQA 5FDLA 3ILIA 4GVLA 5D0EA 4C8NA 3DRSB 2RS2A 2HFUA 2JFKA 3VHQA 3ISNC 1JJ4A 1WTFA 1NDCA 4NLQA 4G1PA 2YWWA 4CIOA 2JEFA 1KWMA 2A6MA 1JXLA 1UJ5A 1OO0B 5GAHI 3F44A 2HZAA 2J7WA 3SFGA 1HNIA 1X31C 2XB2D 4M94A 2B56A 4RKUC 2IM0A 3HSZA 4C8KA 1U0SA 2OTJS 2BA9A 3ENQA 5HBMB 4OX6A 2HK3A 3OL9A 2H51B 4Q45A 1NHVA 3GU0A 3K59A 3CMES 2J6SA 5HANA 1T9UA 5KFAA 4WE1A 4JI2J 3TA2A 1N6QB 4A4JA 3NLCA 2YNHB 4HI2A 4ANCA 2GQ2A 2HNYB 2Y1JA 3GR0A 2BJDA 2RRNA 2FUG9 4JV5J 3D6FB 1KVJA 3MCSA 3MEEA 4DU7A 1N56A 3DDKA 3PEHA 4LFCJ 3MHYA 3POTA 3K58A 1T0TV 4CO3A 1WHWA 5AT1B 4UT4A 1B70B 1T9WA 1L5UA 4KH0B 2JRSA 4PCQA 3GPAA 5D8HB 2XMVA 5CD4H 3QGHA 5GAGU 5IZHA 3RZAA 2CPEA 3AJ1A 1PYOB 2PDAA 3P49B 1UMJA 2DY1A 3ILLA 5JMNA 1KBRA 3PNIA 1J5OB 3M8RA 4DCOB 3W9JA 1JLQB 1MMDA 2OPSB 3PHTA 4OHVA 4RNMA 2W4PA 5EGYA 3CJ3A 2WSCC 4P6QA 1UJ6A 1U24A 3RBEA 3H59A 3BGUA 4NZ0A 1DJ0A 3AOAA 4UY8T 4Q2MA 3RW6A 3SI8A 2RVJA 3I9ZA 3GQCA 1VR6A 2GV1A 4QIWD 2ZVSA 1WF1A 4NCGA 4FKXA 1PO6A 2CNKB 3D1HA 3DM2A 2CQ4A 4LRBA 2XY5A 1ELOA 2GGPB 3P96A 2RRAA 2W24A 2AZ1A 2FJXA 3HX9A 2KZZA 1UEUA 1UEVA 3PY8A 2R7RA 4LSLB 1NM2A 3KG0A 4MJKA 5BR8F 2HZVA 2MKSA 4NMXA 2M8HA 5CD4A 5HO4A 1ACMB 3P5TL 4NLPA 4JYAJ 2CNOB 1BQNB 3OLBA 1NSAA 4YR0A 1MSWD 3LAKA 5KFTA 4MFBA 1UPPA 3MM5A 1Q7LB 3M4XA 4C3MA 1IWAA 1C0TB 3DHXA 4WTOB 5K8MA 5DS7A 3TJAA 3TOQA 2D9OA 2F40A 3UR0A 1M1HA 4DR6J 4PYDA 4YR3A 3MTJA 1LW2A 2V8HA 2V8GA 3QATA 2MKYA 2WVCA 2BE2B 1ZAVA 4ED1A 3QSIA 1W26A 4DL6A 2HQDA 2AQ4A 4K59A 1U1MA 1NU4A 3CCVS 2P8IA 3WIUA 3JSMB 4F8RA 3IN5A 3I32A 3MOJB 3UR3C 1W7WA 4YB5A 5LJ5Y 3N28A 2XZTB 5KFUA 1S6PB 4H4KA 1R8AA 1H6KX 2MJUA 1KC8T 2FJBB 3EUNA 2D69A 4V1Ak 2E5LF 3MM9B 2PI4A 4URQU 2UVUA 4L73A 1RHMB 2OSQA 3EXYA 1X60A 1S9EA 1SL0A 2DGVA 5HQ8A 1QSSA 1EX8A 3GG1A 1FXDA 4RU9A 1JMTA 1IQTA 5CYQA 5D78A 1UWAA 4IDKB 3KLIA 2PA3A 2HBQB 2MZQA 2LFVA 1OY6A 2W2QP 3EYZA 4PG6A 3SV3A 4YB1P 2O01C 5DO2A 5HL7Q 2IAJA 4DR1F 2E9ZA 5GMEA 5L38A 4OMFG 4P9SA 1F2HA 2ATCB 3NMRA 1BC6A 1YBTA 3AHPA 3JAMY 4YP3A 2BE7D 2NUUG 3MXHP 1FWKA 3DRSA 3PJ9A 4KHRA 1YG0A 3M9NB 1D9FA 4DPOA 1XMOF 3J7ZT 4DBQA 4TLQA 1SJ1A 3PXGa 2KM8B 3SCKE 3TJ9A 2FB0A 4RWXA 3U1LA 5I3QA 5IT9U 2UP1A 4U96A 3W63A 2RAQA 4NZ7A 5GAEU 2VICA 5B0DA 1RK8A 4ZVGA 2LQ8A 1DTTB 3ISZA 5LL6d 4YFUA 3PRVA 4N8OA 4OJGA 1NB2A 3UDCA 4CNYA 4DV5F 1RDRA 1QVFR 1Q8BA 4X4UA 1UWBB 4CYUB 1NJWA 3IM9A 2DJWA 5HBMA 4OI2A 4ZS6A 3PW5A 3VTIA 1GEHA 4OV6A 2W7OA 3Q8SB 3BS9A 2N4CA 1N6QA 1RWWB 2YNHA 2HNYA 4GKKF 3KHLA 2YWEA 2ZDOA 1CC7A 3ZZOA 5DQGA 4LF9J 3V6HA 1XC9A 4QYZJ 2NREA 3OFFA 2PT0A 1NPRA 4RW9B 4TQSA 5DGBA 1VHFA 4FS1A 2J8SA 2Z2LA 3THVA 3GV8B 2PA8D 2VPZB 4NLVA 4N8NA 4DR3F 1Q0NA 3C16B 2MKKA 2KO1A 3NS5A 5A6PA 1VOMA 2F1FA 4EWTA 3KJVB 1VBXA 4DSIA 2IDLA 3V81B 2DR8A 1HIYA 1TFWA 4L72B 1T3OA 1V5IB 4ZVEA 2Q1LA 4O3RA 2M7SA 4K0KJ 2EEYA 3TYTA 1GMWA 1RAAB 2EC0A 4F7VA 4CLZA 5F3TA 1J5OA 1NK8A 3GJRB 4IKAA 1JLQA 2VBZA 2GIQA 4OX9J 2DHHA 2OPSA 2FY8A 4KHMA 4WYLA 2R8HA 1KEKA 4ZPBA 4P75A 4W98A 1U6BA 3ZTOA 4I64A 4L3NA 1RHUB 3DOLB 4Q7AA 4Y2MA 1LWEA 2Z30B 1R0CB 2ZD1B 3HVWA 3WC0A 3WX8A 4ECUA 1RAEB 5LM7E 3VQSA 1M0SA 3KHGA 2BRLA 4MYUA 4OYWA 3NBPB 3TA1A 2GGPA 4X4RA 3OW2R 1SUQB 2MKJA 2DGOA 4OZ2A 4K5RA 2LQ9A 4J9NA 3JSBA 4RBVA 4LSLA 2ACMA 2QZ8A 4I4BA 1VK8A 4ZJLA 3QQCD 2HHTA 2XMWA 4UQGA 3TAMB 1BQNA 3KLHB 2IVYA 4EI2A 4PR6A 4C2MA 4NA2A 2FJDB 5KT3A 5HK4A 4CZCA 1SL1A 1HPZB 1Q82T 1LK7A 4B9UA 3NP5A 2WK4A 2Y3YA 1C0TA 1N54B 1WHVA 3U1NA 2WCXA 2V2ZA 2A3JA 4OHZA 2ILYA 2PSZA 4OLOA 2W8KA 3JQMA 1KVKA 4ILRA 1QDUB 1DAXA 3FBFA 2BM0A 2WB1D 4FYXB 1Y5LB 2BV3A 2CYYA 3R97A 4QWAA 2HVIA 1C0UB 4DR7J 3U7JA 2BEFA 3K5OA 4I6WA 3VV2B 3GYXB 3SCIE 2BE2A 4XDCA 3R1LA 3IMQJ 3TX0A 1S1VB 2C3UA 4ZLJA 3JSMA 4YB7A 4QWDA 3HM9A 1VQMS 4Q0BB 4CM2A 2DD8S 2KH9A 2HS0A 3R8YA 1NKBA 1S6PA 2H5EA 4MKYA 4RNHA 4P73A 4LF4J 3C66A 3CJ5A 3BQ0A 2VJVA 1BY9A 9ATCB 3MM9A 3CCWA 2BW2A 2CQIA 1QVGR 1FJEB 3E2EA 3CD6S 2Z58B 3JB9k 4JI5F 1CSJA 4BC7A 1G6BA 3G6YA 4QU6A 2VC0A 4IDKA 5K9FA 2QEXS 4USIA 2BOAA 3MF5A 4IQXA 3JTOA 1W2BR 1K8AT 1WG4A 2AJ1A 4NYPA 4ICLB 1WC3A 2OFGX 1Q8IA 2AD9A 2FIUA 2LA4A 1RTDB 1R8PA 4RLEA 1O6XA 3D2WA 4L6V3 5IFMA 4K4ZA 4LBHA 1GH8A 1VBZA 1GMVA 4ZLLA 2LVWA 4DX8H 2DPJA 3I9V9 2HVHA 1TL1B 2XEXA 1KHWA 3LOUA 3J7YU 1Q5YA 3FBCA 2HFSA 1WSVA 1N8RT 2NS1B 3Q22A 3DGPB 1S97A 4ANDA 4N56A 4J9RA 4YMEA 3B6BA 1M5VC 4OL8A 3CWJA 4QIVA 4BS2A 1RTJB 2BJEA 1PAUB 2AYEA 2ZHBA 3EJMA 4XDDA 2MZTA 3HZEA 2D1CA 4DF8A 2RJZA 3BH7B 1DTTA 4ID8A 5L9NA 2A2CA 4DV2F 4K4TA 2NYIA 2RKIB 2WBMA 3RUBL 1WG1A 1SC1B 1UWBA 4CYUA 2XYHB 4LF7F 4YN3B 3J80U 2GC8A 2H4YB 4NXNF 1RA6A 3GIIA 1EIYB 1RT2A 5F0UA 3BZQA 1T3NA 3G86A 2KRBA 2UVRA 1RT1A 3RR8A 1FDNA 3A8IA 2CVEA 2RQ4A 1VC0A 4WCEQ 5KG1A 3GYGA 3QT6A 4RW9A 3NOGA 4RL1A 4CO5A 4O44B 5K8NA 5HP1B 3D9BA 2GQCA 3C3LA 1N0UA 1VIOA 3I5AA 3VWSA 5F8MA 3C16A 3HHLD 3PYDA 1N5TA 1FERA 3FFIA 3KJVA 2H4WB 2Z2ZA 3V81A 2BBEA 3UNGC 3A8KA 1NNDA 2A2DA 2IM1A 1GNKA 1BD6A 2V2QA 4EBEA 2YH0A 2HFZA 1N33F 1IKVB 4O3PA 3IA0A 2AYBA 4B3SF 3MEKA 5IV3A 3V5RA 1X4AA 2W4CA 4RNFA 1MW7A 2XLIA 1J5EF 3BN7A 3G8SA 1NSPA 3CT9A 4M5GA 5KFYA 3ZZTA 1FKAF 2HHHF 1S1WB 1RAOA 3HLUA 2POKA 2VU5A 2J7KA 4USMA 4QU7A 1WWHA 2IBOA 2OIHA 4N5SA 3KOAA 1DARA 3PJWA 2ZD1A 2AV5A 3LANA 3MUTP 3QIDA 5LJ3Y 2FDNA 3D67A 5MLCV 2DHGA 4CM0A 2FD2A 3TAPA 2HAIA 4DV1J 1DQ8A 3NBPA 5ETPA 3LPYA 3TO8A 2N7YA 3HKZD 3W9HA 1SUQA 2NYHA 1FRKA 2CJKA 3QJPA 4LR8A 4Z7YA 2KG0A 3ETOA 2YKOA 4CH1A 4DHVA 1U1NA 1FRIA 4ED5A 4TN2A 4JI4J 3PIPQ 5KAKA 3KLHA 3SQOP 5KG0A 2FY1A 4Q43A 3OLAA 5BYSA 2PD1A 3RB6A 1HPZA 4K4YA 3ADAC 5KG3A 4RPFA 2F8MA 2E9TA 3LF0A 4EO6A 1G2EA 5GAGI 2ZWPA 2I5JB 4B3MF 4LF8J 3O5TB 2Y0BB 2OLWA 2M3DA 2DKOB 3VZIA 4USUA 2JOQA 1U09A 1KLNA 2QL9B 1ULRA 3CUNA 4TU8A 4OYZA 4GO7X 3ZNJ1 1SVDA 2IY5B 1KTQA 3M2UB 2CKWA 2E1RA 1WF0A 2D3ZA 2YTCA 3MM7B 4UOGA 1C0UA 2GZOA 2X1FA 2E44A 4UOCA 1NK0A 2JDJA 3IGNA 2WONB 1TMJA 2X1BA 4HH1A 1Z2ZA 4CLSA 1S1VA 4B3RF 4JI3J 2IDEA 3ITHB 2X1GA 4DQIA 1RAJA 2C2KB 3KK1B 3D66A 5F3ZA 1F6TA 4Q0BA 2V8PA 5H9EJ 5H9FJ 3GSDA 4ZVTB 3RYLA 5IT0A 3AAWB 4FVCA 4L75A 5IT4A 3QT5A 3RR7A 3N6NA 1NRKA 3O8WA 3CCUS 2PFFB 1X4CA 1WKKA 2CQ0A 1RBOB 2KT5A 5HMYA 1NK7A 1LK5A 2DIVA 3BV8A 3N9UC 2CPJA 2EFOA 3JQJA 4ILLA 5DG8A 3IAM9 4ICLA 2AGQA 4DG1B 3FRZA 1RTDA 4HT5A 4WFAQ 2HRUA 3OD2A 1EJ7L 2FZCB 2BXJA 3SMZA 4M5MA 3SIPB 5HMXA 2GW8A 1RWNB 1TL1A 1HBMB 3OSPA 3MWBA 2XO7A 2ALZA 1CJTB 2D3O1 3BGFA 4OYMA 3QO9B 4JI2F 2MLYA 2ZOFA 4JV5F 3DGPA 3IR7B 2B8QA 4B9TA
chains in the Genus database with same CATH topology
4BC9A 5EX0A 2WHOA 1Q79A 5CH7B 2QV6A 2XG8A 5CZXA 3HP6A 4J9LA 1Z2LA 2OPQA 1HYSB 1VQ7S 4WE1B 1RTJA 3RRGA 3OSNA 2UXBF 4LFCF 3CCES 1S7HA 2DH9A 5BJRA 4FBTA 2ADBA 2Y1RI 3M8SA 4C9DA 1LWEB 5F8HA 3CGIA 4TYBA 3PW4A 1X4DA 3IAS9 3IRXA 2DNKA 3GB0A 4PWDB 3MURP 3BGLA 3MEEB 5KFWA 1LW0B 1FT8A 4TNOA 3RRHA 3GFZA 4IRKA 3TRGA 5HLFB 5G0RA 3T5JA 2YKAA 2DNYA 3KNGA 3W7BA 1NK5A 1DQ9A 2RILA 2LQJA 3AA9A 3POTB 2ZH4A 1UAWA 1FK9B 1LFPA 2YX1A 3TVZA 2RKIA 2R8JA 2JLEA 2CJAA 1X5SA 3GFHA 3X3UA 1CPZA 2DNHA 1JK9B 1ZAWA 3OR1A 2MKIA 1VQ8S 2DRBA 2W9CB 1G1XA 4KB7A 2HWHA 3Q8RB 3PVXA 2VZ9A 1OWXA 1VS3A 4H4KC 1U48A 5E7OB 1A6LA 4USJC 2E1AA 1N52B 2O1PA 4BWJA 4CH7A 2RU3A 2OO4A 1SIZA 3AJ2A 4WXOA 3OJUA 3UCUP 1K1SA 4DL2A 2JC0A 3MFIA 1M5PC 2DR5A 2J6UA 3BSOA 3C6TB 3IWLA 4TXSA 3MEDB 5KT6A 1QAYA 3SCJE 2C2EA 4CQ1A 3GE9A 4AE5A 2HYIB 1S0MA 5HMWA 5I3UB 3CCSS 4P7TA 1D3WA 3HVRA 1B0VA 2ZZNA 1TR0A 5A8KB 1BGXT 3I55S 4K4SA 1Q86T 4F50A 1HW8A 3OPKA 2F8EX 4ECTA 1IM4A 4NLDA 1JJHA 2MY7A 5KFDA 3KKFA 3M9MB 3QPIA 4B17A 2RD5C 2GHWA 3T1AA 1Q81T 1LWCA 2KI2A 4WIIA 4QR2A 5KFZA 3E01B 3SSSA 4O44A 1BWEA 1YHQS 1A7GE 2FPHX 3H2UB 1N5QA 3IO1A 3EPGA 2NLWA 3LW5C 2UV8A 1D9DA 1YJ9S 2FVRA 1Y9OA 5C25B 4I69A 3SDEA 2VOOA 4WZQA 5L8RC 3KK3B 3M2RA 3BO4A 2UUWA 1DBDA 3NGDA 4YB6A 3SQGB 2PI5A 4HKQA 4MH8A 4KV8A 3MUMP 4J5OA 5K14B 2OH2A 2UXDF 5AE3A 2KRRA 4G1QB 1SH3A 2UZAA 4NRUA 1HNVB 4DL7A 4ECSA 1KHVA 4RW6B 4GMKA 4EGLA 3PR4A 2KZMA 1TL5A 4Y2KA 2MYFA 3M32A 1FXLA 1FVSA 4QBUA 2R9LA 2BUNA 4IQMA 5EDWA 4QR1A 3UI3A 3WX4A 3W3SA 2ZBCA 3U27A 1JLCB 5J2PB 2CPXA 3GR1A 1TP7A 1Y5IB 2DNPA 4NPOA 3M8QB 1VQ4S 3CC7S 3M6WA 2FHMA 2V4JA 3MEGB 2DO4A 2VB6A 2XS5A 1IKVA 1V6HA 4NLRA 4RW4A 2K7KA 5CA5A 4NMLA 1NKCA 2DH8A 4C8OA 4J9MA 2DGXA 2ZJRQ 1HQEA 3D54A 2HW3A 4O4GA 1CC8A 2GFFA 1RT6B 3I6PA 5ADZA 3G6VA 2R8IA 3T1YF 1NJIT 5LMUF 2KN4A 4MK8A 3NS6A 2AP6A 2EPIA 3A8EA 3MPWA 5KFNA 2W9BA 1FO1A 4WK3A 4NCGB 4B9VA 3K2YA 3MM6A 3DM2B 1N4LA 3K5NA 4MMOA 3FGVA 5F8LA 2VUGA 3S1TA 1TKZA 3KWMA 2JLGA 5K5MA 4QPXA 4ZPWR 4JI7F 4ID5A 2DH7A 5IM0A 2DITA 3HXMA 4ECRA 2UV8G 4Y2IA 2Y1IA 2FHKA 3DCAA 4AXIA 1NJZA 2R7TA 2HG4A 5GAEI 2N7CA 1S1WA 4YR2A 2FHJD 2DT9A 3M2VA 3BGRA 3HMJG 4CO2A 1F9FA 2DBBA 4WFZA 4Y65A 4JYAF 3CSKA 3GG0A 2MQNA 5B0BA 3BDEA 3MAQA 2HS3A 2ZUGA 1O0PA 4NX9A 2C3OA 3DI6B 4I2PA 4X4VA 4B9LA 1Y5NB 1OSCA 1YVFA 3G8TA 1F5CA 2Q43A 4I6YA 3VAJA 1H7XA 4YQWA 3TANA 2VBWA 2PC6A 3TQ1A 2AU0A 2DR9A 3EGNA 2E7XA 3RB0A 1VRTB 4ZCKA 4TYAA 3QIPB 3D1OA 2VQEF 1X5OA 2ZOGA 1FRMA 1Y4ZB 3HI9A 5F8JA 3CIMA 4MFBB 4TKTA 2JL9A 4WU2A 3MM5B 2DHSA 3DRRA 2RF2B 4ZKAA 5F9NA 4IOBA 3HVTB 3O3LA 3QJJA 3T5HA 5KG6A 4DR6F 3PR5B 2RDIA 1IKXB 5E0OA 3MR6A 4Y3CA 2YKPA 3JSYA 1HBOA 2K7JA 3OHAA 2MSTA 4EU0A 2FLPA 1X4HA 4XIUA 1XWLA 2ZJQQ 3EZUA 1HWLA 1YBAA 3N4WA 1BQMB 5T7LB 2ZJPQ 5M2RA 1TKTA 3CXCR 2LU1A 1T02A 3BR9A 1FRXA 1T95A 2IHR1 4AQYF 2B4VA 2DB1A 1R0AB 3M30A 4X65F 3SFUA 1RP5A 3UQSA 3KLEB 4A46A 3MD3A 1U7LA 3PKMA 4YHHF 1QE1B 2HQIA 5E3AA 5A6WA 1LW2B 5KT2A 2XLKA 2VG6B 3CTRA 1ZPVA 5CZVA 1FXRA 3UWTA 1P6TA 4I56A 4C0BA 2HS4A 4DSKA 4ED6A 2QMWA 2EFGA 4XK8C 3PIOQ 2BQUA 2MGZA 4A8MP 3CJKB 2BZ2A 1X4EA 2ZBIA 4KFBA 4RW7A 1I6JA 1Y3KA 3VAFA 1LKZA 2V94A 1FE4A 2D7SA 2RQKA 2PE8A 5I42B 4H4MA 2K3IA 4CTAB 2ASLA 3IG1B 2OKQA 1HQUB 1K1QA 4Y2CA 1YJNS 5IS2A 3JTNA 1GXUA 2FGCA 2VG7B 2E1CA 1GXTA 1D8YA 2B43A 3OXLA 4A8WA 1N36F 4X66F 1XR7A 2P9GA 2GHPA 4KO0A 2M70A 3HJFA 2KJWA 2I5JA 5KFHA 2AX1A 2BABA 1R6YA 1HMVB 4LT6A 2KVIA 2DHXA 4URSA 1VRUA 2WAQD 3T9ZA 4DL3A 2XLJA 1FRHA 4K4WA 3H5UA 4DF4A 3CCTA 4FBUA 3H98A 3NNAA 4X4PA 3DYAB 1AW0A 4F4XA 1VI7A 4F4YA 4KRWA 4ED8A 1JWWA 2BM1A 1WACA 4RBTA 4B9MA 2IRYA 5F41A 1NB7A 3NMAA 2IM3A 1RJJA 5KFPA 1KTVA 2JSXA 4QIGA 3FVYA 2M52A 1GX5A 4O4RA 1M5OC 3DLJA 3M2UA 1HNZF 2UUBF 2J9EA 2K3KA 4IG0A 3IR6B 5CCLA 2XS7A 5KFOA 3MM7A 4ZP6A 2XMJA 2V4RA 2XMTA 2KHCA 5SZTA 1DFDA 1X0PA 1Q8LA 2QSWA 2CQHA 2CJBA 2DR7A 4DV0F 7FDRA 4C8LA 1SXLA 3MPYA 1WG5A 1Z1ZA 4ZCIA 1S9GA 4H4OA 3CF5Q 3DOLA 1TFYA 2Q6CA 1S9EB 1AROP 1SH2A 3V4MA 2ZH9A 5F0WA 1ZZFA 1EETA 2JC1A 1U47A 3PW7A 1NH7A 3ITHA 1TVRA 2HNDA 2RIJA 3FEZA 4YDXA 2ROPA 1JJ2R 5HMZA 2R8GA 4Z2XA 1RT2B 3OVBA 2XY7A 2QIFA 4W90B 3RRKA 5CYQB 3KK1A 3KYLA 3KLIB 4EBCA 4LJMA 1FDBA 2OPPB 4WFYA 3S7RA 5GVQA 1LFWA 1RT1B 3BM7A 2DO0A 4ZK7M 4MIWA 4Q8FA 1QUPA 5A0YA 2PO4A 2IMWP 2D3UA 3MR2A 4HLBA 1S49A 5DG9A 4RUHA 3FDSA 1JB0C 2M0GB 1XR5A 4I2QB 2EFQA 1P8GA 4MKAA 1KNZA 1GQEA 1RTHA 1U26A 3MECA 2IAJB 5GADI 1U4BA 2YX7A 3CB4A 2HHPA 3LP0A 2AYGA 4XPEA 4LF6F 4PWUA 2F8HA 2IFXA 2KFNA 2U2FA 3KMSA 1RT4B 3N6MA 3NKYA 1HNWF 1IKYB 3V6JA 3KHHA 1NH8A 4X4QA 3MMAB 3PEJA 2N3LA 3SZ2A 4HDGA 1AXQA 5FDLA 5CHCB 3AB2B 2R7XA 4FXDA 4C8NA 4ECXA 5L1LA 2W9AA 3DRSB 3TAMA 1SKRA 2RS2A 3VQTA 4IO1A 4C11B 3SXLA 2JFKA 1M5KC 1RTIB 1KQGB 5LSLA 3ZZZA 4OLPA 3ISNC 3FFIB 1JLAB 1S48A 2ASJA 3E8OA 1KRPA 4PQUB 5DQIA 2MQPA 2FLNA 1JJ4A 3G9CA 2YNFB 4FF2A 1WTFA 1IKWA 3J7Z5 1JLFB 4DJBA 4C8ZA 2MQLA 4RNOA 4NLQA 2ZFHA 3CD0A 4G1PA 4A8FA 2G1DA 3N6LA 4ZVFA 1A9NB 4CIOA 2KT2A 2J9DA 2JEFA 5GMKa 2EW9A 2B9WA 1OPZA 4DG1A 3BJYA 1JXLA 2L3MA 2R7WA 1UJ5A 2YY3A 4AL6A 1RT5B 1OO0B 5GAHI 3DMJB 1VIXA 4QYRA 1NZAA 3F44A 3FZ2A 3TUJC 3FQLA 4U6PA 3OUYA 2NQPA 2O66A 4JI6F 3FMWA 4M95A 2DISA 3BQ2A 2J7WA 2J76E 3HO1A 3SFGA 3UFCX 3VF0B 5IT9Y 1YRXA 4ZPVR 5EWEA 4FNIA 1HNIA 2MZSA 2NPIA 3K5PA 4ZLPA 4ED0A 3SCLE 2KJVA 3I0SA 2XB2D 4M94A 2V2KA 2B56A 1X8DA 4OZJA 4LMZA 1HBMA 4RKUC 2I0XA 2IM0A 1R7IA 2Q6BA 5EUHA 1FKPB 4ETXA 2VODA 1DLOB 4C8KA 1B7FA 2E29A 3ZC4A 2OTJS 2BA9A 3QO9A 1C1BB 1SIWB 3ENQA 5HBMB 4YY3F 4OX6A 4TU7A 4Z37A 3WBZA 3K8VA 1NO8A 2BANB 2FJWA 3OL9A 2QRRA 4Q45A 3G8QA 1NHVA 4ZVHA 1VC5A 3FQKA 1IQZA 3K59A 3CMES 2J6SA 4KGKA 4DUZF 1G7CB 1T94A 3BSNA 1HYSA 5KFAA 2ZOMA 4WE1A 4LF9F 3TA2A 1N6QB 4NCBA 1U1OA 4A4JA 3NLCA 2YNHB 4HI2A 2DNMA 2YVSA 2GQ2A 4B3OB 1CLFA 2HNYB 2Y1JA 3DOMA 3GR0A 5KOXA 2BJDA 2RRNA 4B9NA 2FUG9 2RU9A 3G6ES 2VA3A 3PX4A 2IA0A 3UCZP 1LXNA 1KVJA 4DOZA 4Q44A 4PWDA 3MCSA 3MEEA 1LW0A 2R2TA 2XMMA 1DRZA 1N56A 1F5BA 3NWGA 3WDOA 3DDKA 5HLFA 3T9NA 2DGSA 2X51A 3OV7A 3OFEA 3GIJA 3PEHA 1QY7A 4QWEA 3H40A 5ITHA 3RU0A 5EN1A 3CPWR 3GILA 3MHYA 2ZITA 3POTA 5J1PA 4KBIA 1FK9A 3K58A 3U02A 2DNGA 4X4SA 3Q2SC 4CO3A 1WHWA 2CVIA 2AGOA 3KFWX 2DRAA 2CQDA 2XSJB 1UVNA 2G13A 2KU7A 4ED7A 3T6BA 4A8YA 5DDQC 4DFKA 2JEGA 2W9CA 4ZPAA 1CQNA 1OS5A 1KLMB 4I6AA 3SSQA 4OHXA 1L5UA 1HA1A 2GMHA 2JRSA 1U2FA 4PCQA 5D8HB 1R8BA 1UFWA 2XMVA 5CD4H 4FN5A 4ELUA 4JI4F 3QGHA 4IFYB 5BYQA 1XR6A 3C6TA 3G6XA 5KT5A 5GAGU 3MEDA 3VALA 1REVB 1FJ7A 2I2YA 2F3JA 5IZHA 1S0OA 3RZAA 3I0RB 2CPEA 2B7BB 3AJ1A 2OMOA 2QFJA 4K0KF 4JBCA 1TK5A 5I3UA 1U1LA 2HHVA 5F8NA 2CJ9A 3QGGA 5A8KA 2PDAA 4TY8B 3P49B 2YKQA 3DLEB 3GIKA 1UMJA 3LWLA 5E3QA 5GAHU 3OXFA 1SBRA 3ISND 3M6VA 4R5PB 4KIAA 4PG8A 5KFVA 1UVMA 4DR5F 3FNNA 2N82B 3E01A 3U1MA 4OZNA 5A2QY 1QM9A 4PKDB 1OQ3A 4OX9F 3K57A 2Q3PA 2UVWA 2B9XA 3MMCB 4X84A 4NLWA 1HI8A 1DZ5A 1IBMF 1U49A 3VAKA 1SKSA 3OFGA 4FP9A 3PNIA 4B3TF 2A18A 1J5OB 3M8RA 2CQ3A 4OI1A 4JV0A 1TL4A 5C25A 2MQQA 2FJEB 5KFXA 3TR5A 1M5SA 3KK3A 1JKHB 1JLQB 4DEZA 3Q24A 2QT7A 2YWFA 1BQXA 4ZP7A 5T41A 3SQGA 2WW8A 1HHTP 2CPIA 5K14A 1MMDA 2BYCA 2OPSB 4DL0C 2QE5A 4HHJA 1L3KA 3I96A 4OHVA 3AY0A 4RNMA 4G1QA 4JUZA 1HNVA 1P9QC 2CQPA 2W4PA 4RW6A 3CJ3A 4CT9A 4YUDA 1R27B 2WSCC 5EGYA 4HTIA 3DLBA 2L48A 2X1AA 4P6QA 4DR2F 1ZPWX 1UJ6A 4UW2A 1U24A 3CDAA 4C8MA 4F67A 2ZE2B 2YKNB 4JI3F 2B4PA 2XCAA 3ZZRA 3RBEA 1JLCA 5J2PA 4LQ3A 2KDOA 5DDOC 2GO9A 3H59A 3M8QA 3MOZA 3BGUA 4NZ0A 1DJ0A 3MEGA 3J7YI 5E41A 4CI0B 4UY8T 4NLXA 4WF9Q 3QZ8A 2IMOA 1HL6A 2DK2A 4Q2MA 3RAXA 3RW6A 4A8SA 1RT6A 3LH2S 3SI8A 3KG4A 2RVJA 1YJWS 1S1UB 2DIUA 3I9ZA 4Y6IA 3D0GE 4B02A 3GQCA 2XMUA 2GV1A 4QIWD 2ZVSA 3R5AA 3AH6A 5J2QB 1WF1A