7FDRA

7-fe ferredoxin from azotobacter vinelandii, na dithionite reduced, ph 8.5, 1.4a resolution, 100 k
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
b'AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (7-FE FERREDOXIN I)
publication title Oxidized and reduced Azotobacter vinelandii ferredoxin I at 1.4 A resolution: conformational change of surface residues without significant change in the [3Fe-4S]+/0 cluster.
pubmed doi rcsb
molecule tags Electron transport
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1998-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 7fdrA00
3GYXB 1FERA 2GMHA 3MMCA 1H7XA 2GMJA 2PA8D 1C4AA 3MM5B 5BYSA 6FDRA 4KT0C 1WTFA 2FJDB 1FDBA 2C3UA 1GTEA 5L8RC 1H0HB 2V4JB 4OV1A 3MMBA 4XDDA 1FEHA 1FRLA 3OR2A 1FD2A 1KQFB 3MMAB 1IQZA 1DURA 2VPWB 5BYRA 1F2GA 2FDNA 4YDDB 3LW5C 1H7WA 5E7OB 3MM9A 1GAOA 1H98A 1Q16B 3IR7B 1FCAA 1BLUA 2VKRA 1FDDA 1F5BA 2FJEB 2XSJA 1B0VA 4RKUC 2UZAA 2FGOA 4DHVA 1Y5LB 4Y28C 1F5CA 4CI0B 2VPZB 1FF2A 2O01C 1FRKA 1FXDA 1FDAA 1JB0C 1FXRA 4OMFG 1KEKA 3MM6B 2VPYB 1FRMA 1PC5A 1VJWA 2C3YA 3MM5A 2WSEC 1XERA 2FJBB 1C4CA 1JNRB 2C42A 1B0TA 2WSFC 1K0TA 3MM6A 2V4JA 3EGWB 1HFEL 1SIWB 1AXQA 3MM8B 1PC4A 2C3MA 2WAQD 3MM7B 3MMAA 2VPXB 1FRJA 1DFDA 4ID8A 1R27B 1BC6A 1KQGB 2V2KA 2ZVSA 1BQXA 1G6BA 1A6LA 7FD1A 3MM8A 1DAXA 1GTHA 1SJ1A 1FRIA 2Y0SD 3HKZD 3OR1B 3MMCB 3PNIA 3EXYA 5CHCB 1G3OA 1Y5IB 2WB1D 6FD1A 1ROFA 3IR6B 1Y4ZB 3C8YA 3OR1A 1FTCA 3MMBB 2PMZD 4XK8C 1D3WA 1RGVA 4L6V3 3OR2B 1GT8A 2WSCC 2IVFB 3EUNA 3MM9B 2FD2A 1BD6A 4AYBD 1FRXA 2FJAB 5CH7B 1CLFA 1Y5NB 1SIZA 2XSJB 7FDRA 3MM7A 2PDAA 2Z8QA 5BYQA 3IR5B 1B0PA 2C3PA 1BWEA 2C3OA 1FRHA 1IR0A 4XDCA 5FD1A 1JNZB 1FDNA
chains in the Genus database with same CATH superfamily
3B78A 3D4JA 1MLAA 4QWAA 2H48B 4BC9A 1CJUB 4P71A 2YNIB 4W4MA 4DQIA 4OQJA 4KHPF 1O0PA 3SSQA 3FRZA 4DG1A 1TQLA 4OI2A 4OYZA 2IA0A 2MJUA 4OI3A 3IS9B 1WI8A 4Y34A 1SPBP 3VQTA 3M8WA 1KEKA 3W2WB 2HNZA 2A0FB 3ITHB 2DNKA 2RT3A 4JV0A 5GAHI 3IAS9 3GSIA 3O6QA 3EXCX 1HW8A 5IFMA 1YBAA 3FRYA 4EWTA 1RTDA 4MIAA 1QUVA 3EZ5A 2HEKA 2M2BA 1BC6A 1X4EA 2D1CA 3OTOJ 2KVQE 5EWFA 4M5GA 4DUZF 1NK8A 5KFLA 5AJ3F 3V2UC 3MFHA 3KHLA 4DSIA 3PW5A 4JI4F 4A8OA 2CQ3A 3F0NA 4GO5X 2B9XA 4DDFA 3RAMA 2OEKA 1LWCA 2X3GA 2UXDJ 3D0IE 4B9UA 2DNQA 1UZHA 4LQ3A 2GIFA 4B3SF 1UVIA 2E1PA 5DETA 1X4GA 4U67Q 4O44A 2C2OB 1KQKA 3G9CA 1L3VA 1REGX 4OX9F 4CLUA 1WF0A 4KYZA 2CWKA 2HWHA 5J2QB 2YKMB 4B3TJ 5EHHA 2YH0A 4Z7CA 3IG1B 3Q83A 2E5LJ 1U26A 5J2PA 1R0AB 4HTJA 4DCOB 2AF6A 5JVHQ 2JEIA 4LRDA 3LOUA 3AA8A 1VRQC 4DV0J 3OR1B 1SH3A 1H38A 5LXRA 1KONA 4URGA 2GIQA 4OLPA 3K0JA 5KFKA 4TNOA 4RW6B 4X84A 3DC2A 1X5PA 3OLAA 1R7IA 4BWJA 1WG5A 3CCJS 4ILLA 1VIOA 3OL6A 5KFSA 4JV1A 3FZBA 2XMWA 3QLHA 4B9MA 3MOZA 2BRKA 3CCQS 2K06A 1HNXF 3CD0A 4N8OA 3ENVA 1FT8A 3P45B 4KTQA 3DGVA 2V8HA 4TU9A 2ZDPA 2IPOB 5T7LA 1G1XA 3VAHA 2L41A 2IM0A 5GAEI 3PEJA 2NPIA 3DRPB 3SXLA 1HD1A 1RWUA 1YHQS 3MAAA 2IHR1 4WCEQ 3EYZA 3NGRA 1NM2A 1LWEB 3VQSA 4EO8A 4RNNA 4E2FB 5C24B 3I6PA 3TUZC 1Q5VA 1FNOA 1REVB 2VC0A 1SKUB 2FB0A 2W7AA 3D1OA 2CZ9A 4DUYF 2HZCA 5B0EA 1ZM2A 3CD7A 3CCTA 1F9HA 2Y8WA 2OELA 1NKEA 4NLWA 1T05A 3C46A 3GLJA 1VQSA 2YWFA 3FSXA 3KJQB 2C28A 2V50A 1NHUA 4LIWA 3DLEA 5D4PA 1FDNA 2OPRB 4GC7A 2GMJA 3QNWB 4PWWA 3TX0A 2Y1LB 1JLQB 2D41A 2GAHC 3RRGA 1WELA 3D28A 4ZJLA 1FEEA 1JLEA 4ZVPB 5HQMA 3DLKB 4B3RF 4DQQA 4IH6A 2DGSA 3OFHA 2CUYA 4R5PB 2V6AA 1UCNA 5DM7Q 2QLFB 2RS8A 3I5BA 1VQNS 2V68A 2YKQA 4X4TA 2XI3A 3DOKA 3RJMB 5HN0A 2ASDA 1S1VB 1ZZNA 1CULB 4X65J 4DCPB 3CCES 1S1UA 1FKAF 1KOHA 3MDFA 2XLKA 3PXGa 2RUSA 3IGNA 2NSCA 2M9KA 2DR7A 4GO7X 4P7TA 1XR6A 1FA0A 5CH7B 3AOCA 1Y5NB 2KVIA 3M6UA 4NLUA 4DSLA 2KFZA 4TYAA 3MEDB 4MK9A 2KT3A 2ZH5A 4RU9A 5CCMA 3WHIA 3W5ZA 1H0HB 4LSNA 2D3OR 2AYBA 1NPPA 1FJCA 4LREA 1KLMA 3MI7X 4YEAA 3Q2SC 3DDNA 3TA0A 2PI4A 4NLQA 2G2YA 4ED0A 1EARA 5AXMA 2XY7A 5DG7A 5G0RB 2VBYA 2VIHA 2BE2B 1HI0P 4OYBA 1JNRB 5THWA 1QAIA 2UVRA 3G96A 2EG1A 4KE5A 2YH1A 4CO5A 4HLBA 5M2PA 4WXOA 4ZK7M 4H4MA 4IQMA 4KBIA 3BSAA 5H1SV 4P2FA 4DFJA 1HARA 3QO9B 4TY9A 5GMKa 2MKKA 3GG1A 4KV8B 4ZVGA 3THPA 4YMEA 3HK2A 3VHQA 2BA9A 4DL6A 1VMBA 1HL6A 7AT1B 4NI2A 1BXNA 3TEHB 5EGYA 2CDRB 2HMIA 1Y9OA 4X66F 3K2YA 2V4QA 1Z2ZA 5KAKA 3MGJA 1S79A 1SBRA 4CYUA 1DURA 3CGIA 3J81Y 4YDDB 5E7OB 5JXSA 2MMYA 2UVVA 4FS2A 2BJ8A 3KYLA 4Q5VA 1Y3KA 2FJEB 2GHVC 3GYGA 2LQBA 2ALYB 4HH0A 4F26A 3PYGA 3H8YA 5HMZA 3CPWR 5KFMA 1NHKL 4KGXB 4X62J 1OJ4A 2BJEA 2P8IA 4WK3A 1ULRA 4OYXA 4ZPVR 3BDPA 1SC3B 1N6QB 3CB4A 4FPIA 3NGUA 2V5HG 4DU7A 5IM0A 3EXYA 1QVFR 3KLFA 2H9ZA 3OXGA 1IBMF 3I0SB 2GS8A 3V81A 4DR5J 2C2ZB 1XQIA 3W5XA 1RT3B 2V34A 3O44A 1FVQA 2H4WB 3T5JA 4LFCJ 1TR0A 4M5JA 3IR5B 4ZVQB 1RAAB 2C1EB 4YS2A 2R8HA 2VOOA 4I67A 2CJXB 5KFBA 2ROPA 1ZZFA 2ZITA 5KT3A 1C1CA 1PJ6A 2BE9B 2EXUA 4X2BA 3N0VA 2RJZA 2R7VA 3IMQJ 4QIVA 1AUSL 1HYSB 4OX6A 4TYBA 3JQJA 5SUHA 4FF3A 3KNGA 4PCQA 3ZZTA 1WC0A 2RRNA 2I9SA 4HVZA 3SCLE 3G82A 2YPZA 1JJHA 1NO8A 4DFKA 2HFVA 2MKJA 2QA4S 5C2GA 2GVZB 3TVKA 3UO0A 4F3OA 4WKRA 4LF5J 1AFJA 3E01A 1E6YA 4D3HA 2ZH6A 1YJRA 4ZITA 1WWHA 3CT9A 3G87A 2W2PP 1D3WA 1NB2A 2ZH1A 2ZJQQ 2N3OA 4YFUA 2DBBA 1BD6A 3TQEA 2DR6A 3RBEA 2XSJB 1HPZA 3CO9A 4Q8EA 2J5AA 4ZLPA 1R6YA 5C42A 4RW7B 2CQ1A 1IVZA 2HNDA 3CW2C 2WOMA 5E2QA 8AT1B 4LRFA 3PY8A 1LK5A 2HRTA 4M5HA 4QWBA 2B5JA 3FNNA 5A2QY 4DL7A 3DLHA 1RWVB 3HHNB 3CD5A 3JSMA 3RBDA 4A48A 1UWBA 4PG7A 2H51B 2W01A 1M1HA 4W98A 1WSRA 1RE1B 3BQ2A 3HVAA 2VICA 2M7SA 2KYZA 2XO6A 2B51A 1S6QB 4BCAA 4IOAQ 3JSRA 1E6VB 2MKYA 3PFOA 2DGOA 2HKEA 1QLNA 2XS2A 4RJVA 2QG9B 1N52B 2XZTB 3DYAB 3GIKA 4PKDB 3H5YA 2YNHA 3P8BB 3R1HA 5GADI 3KJFB 1DY3A 4AYBD 1JXLA 1W2IA 4K4XA 4A8FA 2NYHA 2NUUG 4NLXA 2MEWA 4DV3J 2WTFA 1IKWA 1M5PC 2ERRA 5KTQA 2FC9A 4WU3A 2ZFHA 2UUAJ 2IYGA 3MM5B 1MWQA 2GVDB 2DGVA 2EW9A 2HQCA 5HBMA 2H65B 4USKA 1HKAA 3LW5C 3BZQA 3FBEA 1HBUB 4URQU 3HHLD 4CH7A 2Y3YA 1RKIA 3PHEA 2Q66A 4JI5J 2F4VF 3UN2A 4IYQA 3ISZA 1FKOA 2RAQA 3UQSA 2ZH2A 3R5GA 3CJTA 1T3NA 3CJ3A 3U02A 3PHTA 4P6QA 5KT6A 1A7GE 1BQXA 4F50A 3ETMA 1YVFA 3S01A 1T7PA 4K4ZA 1P9QC 4I2QB 1GX6A 1X0PA 1EP4A 1F9EB 5GMEA 3SQGB 3HZGA 4OYPA 1KBRA 1RABB 4Q44A 4JYAJ 4YR2A 3TQ1A 1S4FA 3QATA 1RZMA 3PEHA 3TVZA 2JC1A 4LSLA 4YB7A 2RVJA 4LR7A 3T1YF 2WONB 4RUAA 4YQWA 5KFCA 1LW0A 4R25A 1EX8A 2FVCA 1W7WA 3MMCA 2W9BB 4F02A 5B0BA 3BF4A 3BN7A 4GMKA 3WZ0A 5HMWA 3IAM9 4KFBA 1FNMA 2UXBJ 1AW0A 1Q16B 2B7CB 1DQ8A 1AA1B 3AD9C 3W2VA 3NS5A 2LKZA 5KFPA 2F7VA 4CT9A 2Z2MA 1VYAA 2ASLA 2R2TA 4NLSA 4J9QA 1K0TA 2C3MA 3IM8A 1M5KC 3FCHA 1HW9A 5E3QA 4F2RA 3KK1A 1HWIA 3PNIA 1X8DA 4WFBQ 2BANA 3US5A 1EAYC 1X4BA 1MU2A 1FKPA 2QFIA 1RBLA 5DZ7A 4EFAC 1HMVA 4PWDB 3G86A 1VGYA 2CNLB 2CDQA 1RCXB 3W9HA 2Z58B 1VHIA 1CG2A 2DRAA 1X31C 2EVZA 3NKYA 3B54A 3N5FA 3PW4A 1T9WA 1FK9A 2V0NA 4GKJF 4JOUA 3SDEA 2R7OA 3TZZA 1Q8IA 1KLNA 3L7PA 5J2NB 1OQ3A 2CZVC 3DRXA 1ZA1B 3L9ZA 5I3UA 1QVGR 5J1NA 3MOJB 1VLYA 1H74A 5IQ6A 4AXIA 1MSWD 4X64J 4U96A 1RI7A 3H59A 1L3SA 1HBMB 1UPPA 3AHPA 1LFPA 2EFNA 1O8BA 3M8PB 2HHHJ 3HHEA 1YGYA 3WX8A 3R5DA 4C11A 4B02A 3UNGC 3RB6A 1G6BA 5LJ3Y 5KT4A 4CRJA 1TKTB 3MCMA 2EC2A 1HNVA 2CG4A 3M2RB 2WB1D 3AOBA 2HBRB 3BB5A 1VQ7S 4ED7A 2UP1A 2FLOA 3ENQA 3OPKA 3RB0A 3H98A 2FD2A 4IG3A 5HL7Q 4YN3B 3HJFA 5EWEA 1YRXA 1RISA 3W63A 2QL9B 1J27A 4ALZA 3TEGA 4P73A 3KLIA 1VRUB 4Z7YA 2WVEA 1F6TA 2QV6A 2MHEA 5K8MA 1PILA 2UUWA 1RWNB 3M2UB 4C2MA 2V8GA 4IRDA 2HBQB 5E3AA 4AD6A 5CAAA 3M8ZA 3FEYB 2BMBA 4KKOB 5LMUF 5J1EB 2KN4A 1WF2A 4J9OA 3NGDA 2MGZB 5HVGA 4AT1B 4BLGA 2F1FA 1CJUA 3ET6B 1Q4RA 2R8KA 3UD5A 2M4MA 3RBXA 1XMBA 2AEMA 1T8EA 2K8GA 2W7PA 2BACA 4NCGA 4CO2A 2IJNA 1G3OA 2VKZG 2IRUA 4ECZA 1QAYA 1FE4A 3GFZA 3NMAA 3DLBA 2I0XA 1CJKB 3MWBA 5L9XA 4A8QA 1VS3A 3CC7S 5IT4A 1NPRA 2OEMA 2MLXA 4IQXA 4M5LA 4NXMJ 2GQQA 4MKAA 4UF4A 1B4SA 3W7BA 2YTCA 3AA9A 2YWGA 1NMEB 4YHHF 4JP8A 4OZJA 4DSKA 2VG6A 1RKJA 4V19X 1GFWB 2BX6A 3CMAS 3CJ2A 3W64A 3LAMA 4DF8A 2CJ9A 4JI6J 1YJWS 5CZVA 2M52A 5EN1A 4NRTA 4PRFA 1URRA 1YLXA 3C16B 4K2XA 3DMJA 2XGQA 4O3QA 4F2SA 5IV3A 2L3MA 2O01C 1FDAA 2VA3A 2IVYA 2HHUA 4QW9A 1OPIA 4WTOB 3E2EA 1C4CA 2Z57B 2ZC4A 2X1FA 1S97A 2CNOB 3ILJA 3MR3A 4RWXA 3TUIC 4LF8F 4ID5B 2F9DA 4ECRA 4X4RA 3EPGA 1HI1A 4M5IA 3HZEA 2LA6A 5KFQA 1HQUB 2GJFA 1CEZA 2AV5A 2G2ZA 2YKMA 2HLUA 4CZCA 2A2DA 3JS9A 3T1HF 5BXIA 5LMNJ 2HK2A 2H5JB 2KI2A 1SKWA 4OZ2A 4DS4A 2NLWA 2ZOMA 4FDFA 1W26A 5KFJA 2ROGA 4WTYA 1R0AA 3EM1A 3Q2TC 3SCKE 4C6AA 4U7UD 4ZCLA 3VAJA 4NA3A 1VDHA 1D9DA 2HHQA 3AD8C 3QAUA 2HG4A 4UY85 1FRHA 5F3TA 2UUBJ 4X4PA 1WC6A 2HFSA 4UZBA 3TNVA 2CAJA 1QSLA 2B4UA 1N32J 5CQGA 1XN9A 1FRLA 3NL0A 1K8AT 4RW6A 3X3UA 3HLUA 3AQOA 1O5JA 2Z2YB 1QTNB 2FYXA 5IV4A 5D4NA 1B70B 3ILOA 1VQ6S 4DR3J 5D0GA 4DZ6A 2FLLA 2BRLA 3AOAA 3QFHA 2PI5A 4TLRA 3F41A 2ZE2B 2HURA 5E0OA 2I6WA 4WFZA 1T11A 2QA1A 1R3NA 4FYXB 2ZZMA 4NZ0A 3A1YG 3DRPA 5M2RA 3CDWA 3N79A 1A0OB 5A8KA 4RW9B 4RLEA 1GNKA 3HP6A 1RYSA 4FYWB 5D78A 1JWWA 5L1IA 4P72A 5HO4A 3WX4A 4PG6A 4NYZA 4HDGA 1DQ9A 4HL9A 5C24A 2HQ3A 1OYEA 1F0XA 1Q8KA 3DRYA 2PA8D 4WP8A 4CO1A 1GX5A 3N4WA 1YKWA 5AE3A 2RF2B 4CLZA 1GTEA 4QCLA 4DR6F 4I2PB 1LQ9A 4OV1A 1TKXB 4BWMA 4DV4J 2OAUA 4PYDA 2CQCA 2GMLA 5D8HB 2XTJP 3A8JA 1FCAA 3B8HA 4ZLJA 3KLHA 3G4SS 1D9AA 4LFBJ 1I3OB 4JI2J 4DR1J 1JLBB 1JLGA 1JQGA 2DGWA 2Y1IA 2VPYB 4M95A 1U1PA 3TP2A 2OPRA 1U45A 3G6VA 3MECA 3JSYA 4GVBB 3C6TA 4I4BA 1RAHB 2R8JA 4RUCA 5E41A 2OPQB 3BKTA 2QX0A 3DLKA 4OX7A 2HAIA 1XC9A 4R5PA 5U47A 1WHVA 4ZDNA 1N8RT 5F8GA 3R97A 2PMZD 2A6OA 1NK7A 2G1DA 2BXJA 4IG0B 1S1VA 3M32B 2JFDA 1XMQJ 1S1WB 3IA0A 4PEOA 4DU8A 3A8EA 1WD6A 1C0UB 4G1QA 3MZIA 3OTBA 3IBFB 1WOSA 1K0VA 4KAIA 3HDSA 3BN4A 2H4YB 5D15A 1TK0A 1TK8A 5FDLA 1AZSB 1RDRA 3GFHA 4ATNA 5C25A 1B0VA 2RRAA 4Q8FA 1J5OB 1F5CA 2AJFE 3MPUB 3R8YA 3OJUA 4A8KA 1F2HA 1WI6A 4Q43A 3E51A 3MM6A 1VRTA 3TW0A 2O3DA 1RAGB 3N01A 2YX1A 7FD1A 3MM8A 3MR5A 1FFGB 4DV5J 1UZDA 5G0RA 3ELHA 2BE2A 2IVFB 4DSEA 4OHZA 4QIGA 1I51B 3BH7B 4C8NA 3W61A 3TUJC 4F4KA 1BWEA 3T41A 4IR1A 1QAXA 5E3RA 4L76A 3DRRB 3LP1A 3SEOA 2Q1LA 5IOLA 3J7Z5 3H5XA 4NLGA 1ZAXA 1WDDA 3EDQB 3T5LA 4C8KA 4NYPA 3ZZOA 2YNFB 3OJSA 1T9TA 3HO1A 1XEZA 2M3DA 3L95X 1TUWA 5KG1A 1B3TA 3KLEB 3UN3A 2AJ2A 3G6ES 4YY3J 3E3XA 3AY0A 2A3JA 5HSPA 1RAJA 3HFVA 2BDPA 4RNMA 3CDBA 1NK5A 4U8YA 4OL8A 2DY1A 1URNA 3OHAA 3LH2S 1YBTA 4RUHA 3UDEA 3VGSA 1EIYB 2C2KB 3UDCA 4DPTA 4L3NA 2FJAB 2X3DA 4OFZA 2D3ZA 4DI6A 4RX6A 3QAEA 1NB7A 4NXNJ 2LXIA 1Y0HA 3M8QB 5BR8J 2UVUA 4KPYA 5DM6Q 3I0SA 9ATCB 1DRZA 1RT3A 3CJ8A 4C9DA 1RWOB 4P2XA 3QBCA 3UPFA 4MFBB 4DHVA 1W2BR 3M05A 2DNLA 4FZVA 1U4BA 4RW4B 3MF5A 1L5UA 4B3OA 5D0EA 3PO4A 2Z30B 1AYEA 3I4HX 1TL1B 3FQLA 1SQEA 2VPXB 5A6WA 3M6VA 2MKHA 1RTZA 4MH8A 2E1RA 1MROB 4KIAA 1HYSA 4W92B 2DCUB 5K14B 1FRIA 3CCWA 2ZZNA 2H5IB 1QDUB 1TL7B 1YWXA 3LAKA 3C8YA 2QO3A 3IM9A 2DO0A 3CCUS 1XK8A 3K8VA 3MR7A 4USJC 2ZWPA 2AW0A 2CVEA 3D6HB 3M2VA 2FTRA 3SZ2A 1YRTA 1JIHA 4B3MF 3GU0A 4O3SA 4KGMA 2KH9A 4NMLA 2V8VA 4XTTA 3OVAA 2QMUB 3MEGB 1TP7A 4P2SA 1T94A 1VK3A 5BYRA 3OHBA 1LKZA 4O23A 3M8SA 2XSJA 4G1PA 2UXDF 2YKPA 5E33A 1OPZA 5DQHA 2W9AA 5HJYA 3KK3A 3C15A 3P3DA 1JB0C 1X60A 2CKWA 4NPOA 2JFKA 5KFNA 4ZHRB 4Y0FA 3OXLA 4ED8A 2GAGC 2MKCA 4NL5A 4CNZA 5H9FJ 2CJAA 4UW2A 4B3TF 2HHXA 4F4AA 4C3KA 4PABA 2E5LF 2SXLA 3UR0A 4V1Ak 1KWMA 3QGHA 2OHDA 3MMBB 3PW7A 5L38A 4LVNP 1U1KA 2PEHA 2R2RA 3MM9B 2V67A 3KXDA 2ZH3A 3GV5B 1Y10A 5AE1A 2V8DA 1S6QA 4O4RA 4TKTA 1IKXB 3G2XA 1MW7A 3H40A 2XEXA 4C97A 4ANEA 3MCNA 1H3DA 5DG9A 3HFKA 2W24A 3D2WA 3K5MA 3VALA 3SSSA 2ZKUA 2PE8A 5A2QU 3RGIA 3L4BC 4GKKJ 3RZAA 2CPJA 1U1RA 3NP5A 1FF2A 1VBXA 3ZTQA 1XNQJ 1NDLA 3OD2A 3MM5A 1Y00A 2VBXA 2GVDA 4RL1A 3GCXP 5HVFA 1HBNA 2XB2D 3OFGA 3CDEA 4JBCA 1VQPS 2R7QA 1HBUA 3MUVP 4ZP6A 3A12A 1OWXA 3KJNB 4ERDA 1F1BB 5A8RA 5CXTA 3QT5A 5KFOA 4DR4F 4XIUA 5L1LA 1KHWA 5KT2A 2R42A 2UV8G 3S6EA 2UUCJ 3TO8A 4I56A 2ZUAA 2NR0A 2CQHA 1IR0A 2EEYA 3PYEA 4A4JA 3GJTB 5ETNA 3BKUA 4EMDA 4ED1A 3IFEA 2XSFA 2FJDB 4BBYA 3VCDA 3TAPA 2OGUA 4WP9A 2W4PA 4KHPJ 5ETPA 1RACB 4CTAB 5EUHA 1AT1B 3K5PA 2B8QA 3EGZA 4WZMA 3LP0B 1PAUB 2IBOA 1RLCL 3ZZ0A 2AGOA 2J9EA 1XIQA 3TA1A 1RTIA 4CIOA 1HFEL 1RT2A 4PR6A 2H54B 3G71S 2HIQA 3EGVA 4H54A 1UPMB 5HQ8A 2DNGA 4DZDA 3LUYA 1PKUA 4O3PA 3MHYA 1F9FA 3EPIA 5AJ3J 1CC7A 4RNHA 1RGVA 2VQFJ 4MIBA 2WSCC 3D6MB 2F8EX 4X65F 1ZTTA 3UVJB 1NJZA 3FKBA 3GCWP 4A8YA 3G8QA 4W90B 3MCOA 3O1LA 1Y11A 1T0TV 2HYIB 3BSCA 2HFNA 2OD4A 3P96A 3IRXB 4CH0S 2XMVA 4B3SJ 4DPWA 4P2MA 3QJJA 3H2VE 4UQGA 1TFWA 3SFGA 2I5JB 4PWDA 4JI1F 5HP1B 3EZUA 4CLWA 3TANA 5KT5A 2VG7B 4K4UA 1RA7A 2GNKA 3UCZP 3R3TA 3BQ1A 3QSYB 4LRCA 2Y1JA 3QZ8A 2X51A 4DL2A 3R7BB 1R27B 3OT9A 3BGFA 1UW9A 2WCXA 2BYCA 1DZ5A 3PYFA 5AXKA 1Y5IB 4ECWA 5KFDA 3SV4A 4ZN1A 5DLFA 5H9FK 2ABYA 5K20B 3SQOP 3UN5A 2ZBCA 3PR4A 3GMGA 3AJ1A 3C14B 4LF2A 4AL5A 2JC0A 7FDRA 3PW0A 3T3FA 2HBYB 1RTJA 4ED4A 1R0BG 1ITPA 2V69A 3QFWA 4FVMA 2QC3A 3KUHA 1S76D 2OEJA 2QYGA 4IRCA 2VBZA 4LF7J 3EX7B 4MT1A 2EPIA 1IKVB 2JEGA 2R7XA 4EUVA 2E5HA 4J9RA 2VDIA 1YJTA 3D0HE 4PQAA 3V6DB 2DR5A 1KP6A 2HZAA 4C4WA 2PA3A 4K4TA 1AFIA 1VRUA 4YB5A 4ID8A 3M2UA 1M5SA 1RT7B 4ED5A 4RBVA 2GW8A 1NNDA 3R1LA 3D1HA 3BDEA 4KKOA 5SZTA 3W62A 2RNEA 4DUYJ 2MGZA 3PCOB 2IAJA 4C8MA 2DH8A 1N56A 3ET6A 4J90A 2CJBA 1YRUA 4EK2A 1I94J 2A18A 3HHKA 4XPCA 3GIMA 4DR5F 3EWGA 3BS9A 1S10A 3J7YI 3ZTOA 1HQ2A 3RU0A 2L08A 4LFCF 2NXNA 4LF9J 3LP2B 3K59A 3SMZA 5CYMB 4QYRA 1DLOB 2HRYA 4J9LA 3H2UB 4QIWD 1YI2S 2XNRA 4JI8F 4KC5A 2AHOB 3ZZZA 4KSEB 1FJEB 3NBPA 1N5VA 5HJXA 3HVTB 3NY0A 2EBGA 4C98A 4OZ0A 1CJTB 1VBYA 2PO4A 2E9RX 4K8RA 1BQMB 3BV8A 3OTCA 3BGLA 2MKIA 4ES2A 3CNQP 1A6LA 2O1PA 2IJFA 4DLGA 1TVRB 1B7YB 5L9NA 1DTTA 4WK1A 2IC3B 2XI2A 1RWXB 3DN9A 3M4XA 2RQKA 4F0KA 2FJVA 5A76A 3EUNA 2JRSA 3M9NB 1IQTA 1R8CA 4LF5F 1HBOA 3CJSA 4PPDA 2OJ3A 1U1OA 2I1RA 3CCRS 4ZVFA 5T41A 4ANCA 4WBFA 5KFVA 4KT0C 2BJ3A 2OPPB 1Q82T 1CPZA 1SC4B 2V63A 1IBKF 4QU6A 3UFCX 1U48A 2WHOA 1R31A 4ELTA 2P6SA 1V5VA 3TAMB 4DFPA 1Y5LB 2YKOA 3Q8SB 4DBQA 1P8GA 1NUEA 2YBVA 4YB1P 1FRMA 1X4HA 2K3IA 2QL5B 3SCJE 1SC6A 3T1AA 2FLNA 3ULHA 4JI0F 4ECVA 3PJXA 1Q8LA 1PBAA 2Z2LA 4IOBA 1VQ8S 2ASJA 4UTGA 1VIXA 2OKQA 2ZNZA 3UWTA 1LWFB 3J81j 3QPIA 4G3IA 4ETZA 2W8KA 4N41A 1RT5B 1JJCB 2DPIA 3NRBA 3EVOA 2ZE2A 4NLTA 4MYTA 1SJRA 4GVLA 1U0HB 4K4WA 2V2VA 4RW9A 4HI2A 4I69A 1NKBA 3NGTA 4LFAF 2KRRA 2VASA 3MUTP 3OTDA 2G13A 4DLEA 1RADB 4B9SA 4ZPBA 1WKKA 3FUYA 5J2MA 2ZDOA 2W2MP 2O67A 3KUEA 2E1AA 2RF2A 1TKXA 2X1AA 5ITHA 3MMJA 1U24A 1SH0A 3R5AA 4LR9A 4JI5F 4FPRA 3RYLA 1S6OA 1VC6A 2VFRA 1NZAA 1L3KA 1JLBA 4DV6F 1X4DA 2J7UA 1UA1A 2W2OP 4K0KF 1WACA 1IBMJ 3JYTB 4GVBA 2NSBA 5B0AA 3D1QA 2XLIA 1SIZA 3NOGA 3BH6B 3DFEA 2LP4A 3AJDA 2DHGA 4NCBA 1C4AA 1RT4A 1WEYA 2FIUA 5JMNA 3VAKA 4DG1B 4JUZA 1FEHA 3PRDA 1CC8A 1H7WA 4HDHA 2G0CA 1BLUA 3M32A 4RUBA 2RB7A 5B0GA 1S1WA 1NSKL 2DHSA 5LSLA 2B9YA 3UW1A 2G9OA 2QN6B 3M7VA 1FRKA 4ANDA 4QR2A 1VQLS 1U2RA 4DV2F 2G1HA 3KLGA 2UXBF 3AODA 2WSFC 4OHXA 1ZYQA 4F4WA 5K8PA 3U1LA 3EICA 1IKYA 1YG0A 1WHXA 1UL3A 1YDLA 4DQPA 4LJMA 2FLPA 1XNRJ 1NU4A 3AFGA 1YZ6A 3KMSA 1AZSA 3VVTA 1S0OA 3FBFA 3KNAA 4I0WA 5GVQA 4NASA 4K4YA 4DR2J 2EFQA 2J8AA 1TKDA 5EWGA 2K7JA 3FMWA 2RHSB 1PYTA 1HR0J 1Y4ZB 3SSRA 5G4DA 1ACMB 2V9WA 2B7BB 2W2NP 4ZVHA 1VI7A 2HLTA 1LWCB 2BZ2A 2B4PA 5JJBA 3CJKB 2WVCA 2QZ8A 5HROB 2OH2A 4OZLA 3D7SB 3U1NA 4XO0A 1WC4A 4G6VB 4O44B 1Q53A 5GAGI 2X1BA 1M5OC 2F8HA 1OS5A 2HHWA 3OL9A 4FF4A 1UA0A 4O3NA 3MCSA 4Z37A 2V8PA 1JLCB 5L39A 5RUBA 1JJ2R 1X5OA 4ZCMA 1VQOS 1TL3A 3EMTA 4DN9A 2HWIA 2XWYA 5J2PB 1GH8A 4WWSA 1LW2A 2WBMA 2GZOA 4RU2A 3A4TA 1SUQA 3BO3A 3MM7B 4X64F 2E7WA 2ILZA 2YNFA 1IWAA 2HHHF 2CPZA 1TK5A 2HGMA 1S12A 5IS2A 1RHRB 2FVSA 4LR8A 4E98A 1U47A 3O8WA 3M6WA 2HSEB 5F0WA 4L6V3 1T9XA 4OI6A 4YR3A 4R8UB 3QLHB 1D1UA 1QAJA 2DH7A 3DGPA 3D67A 4HT7A 1WDTA 4F8RA 2U2FA 3I32A 4DMZA 1NHVA 1XBWA 2N7CA 2J0XA 3NXZA 3EJMA 1DHMA 4PUOA 1EETB 3N6MA 3SCIE 2EC0A 5T7LB 3PX6A 1SJQA 3LGHA 2V4JB 3Q8RB 4WIQA 2QYCA 3KWMA 4LUBA 9RUBA 4ILMA 4ZN3A 4HH1A 1FFWB 3MAAB 4RBTA 3CC4S 5A8WB 5C2CA 1F5BA 2FZKB 2F40A 4URSA 2R8IA 4IO1A 2BKOA 3Q23A 2F4VJ 2Y0BB 3H5UA 3A8KA 2WVBA 4X4NA 1MNEA 2GO9A 2BABA 3M8QA 2NXEA 4CWBA 4UOGA 1NJXA 1JK9B 3C2PA 1Q81T 1M1GA 4AXJA 2BOAA 3L7OA 1R8BA 3TRGA 3OBIA 1HWKA 5H9EJ 1GXUA 1R6VA 1NJWA 3DNCA 4OJ1A 4E8UA 3H4DA 2KT5A 3ENAA 1RBAA 2E66A 4P74A 5A0YB 1UVKA 3S1TA 3IP0A 3DLEB 4DXLA 1RT6B 1S1XA 2ALZA 4ZPTR 3R5CA 4ZIVA 2XMKA 1H73A 1ZH5A 5LM7E 2DGTA 3C3LA 3PRBA 4RBUA 1TL7A 4NLOA 2ZH4A 2V2QA 2WVFA 4FF2A 4J9KA 4J9PA 1JLEB 3T5HA 3W8GA 2XS5A 3CJ0A 2VD3A 2ZEJA 5HLFA 1U2CA 4TY8B 1KSPA 3KK2B 4C7QA 4JI6F 2XMUA 5HQLA 1ZBTA 2L48A 1H2TZ 3VF0B 2QTWA 3EGWB 1S1UB 1ZPVA 2BBEA 5IWAJ 2VFSA 4WE1B 3I96A 3MPDA 1DTQA 4Q0BB 1SJ1A 4NEZA 2I38A 2KYXA 4ZPWR 3R9LA 1F60B 2YWWA 1YITS 3CUNA 4HACB 4A8WA 4Y2CA 4CLSA 3LALA 2R9LA 2GX8A 1HQEA 5I4MA 1HNIB 3PACA 3THVA 4LSNB 1HWJA 2ZHBA 2QA2A 3K57A 4B9NA 1CQNA 4GKJJ 2QEXS 4KHMA 2BEFA 4C0HA 3MMBA 2LDYA 1NH8A 1Q7YT 2P9CA 2VFUA 1HI8A 5KFHA 5K8OA 3MM9A 3MXHP 1Q5YA 2UUBF 3KUGA 3QIPA 2IBKA 1P9YA 4ETXA 3QT7A 3ZXWA 4G1IA 1N36F 1WOPA 2P9GA 3UD4P 4MIWA 1OY6A 3TVYA 1RTHB 3OSNA 5KFZA 2FQQB 2MQNA 2PSZA 4OI1A 2VBWA 4B9TA 1GEHA 2YNGA 2R3VA 4O4GA 4X4UA 5KFGA 4F36A 2JNJA 3JQKA 3DKDA 3HD1A 1OY9A 3ZTPA 2HMIB 2E5GA 3O3LA 2LQJA 2LCWA 2FZCB 2AGPA 3EVWA 3GPAA 1EKRA 4CYUB 3QQCD 2COLA 5B0DA 4QYZJ 2ASYA 4PXBA 3G6XA 4OX8A 2YY3A 2AZ1A 3D6TB 3FDSA 3W60A 3GV8B 4NOHA 3KOAA 3IO1A 4M63A 2CQDA 5I42A 2JX2A 1N5YA 4DV4F 1UWAA 4MK8A 1T3OA 4I6WA 4USUA 2KB2A 4ICLA 2HHVA 3WIVA 2YKNA 3ZNJ1 3H0PA 3K5OA 2WAQD 4LFBF 5B09A 5IM0B 4JI2F 5DGAA 1IUJA 3QRRA 1N54B 4CTAA 3L09A 1FESA 2BW7A 3KLFB 1K44A 2OMLA 3BQ0A 2DNYA 4KO0A 3RRKA 4M1KA 5I3QA 3FSYA 2XY6A 2CPIA 4J91A 4I1TA 2MDAA 3SI8A 5H9EK 2MQ8A 4AFFA 4Y6IA 4Y2IA 3HI9A 4U95A 4CP5A 1C1CB 4OJ3A 1MN7A 4L72B 4K50A 3PR5B 1GXTA 4YHHJ 2Y8YA 3QGIA 2C3UA 2BM1A 3S7RA 1ZS6A 4Q2LA 1F2GA 2FDNA 1EJ7L 1DBDA 2XY5A 3TJAA 1DARA 2RH3A 3G82B 2VF3A 2E5JA 4CI0B 3JTOA 2HS0A 2QIFA 4EZ6A 3T6JA 3VGUA 2DNMA 3IRXA 3BGRA 3V6KA 1IJFB 1JKHA 3H7HB 3E01B 1E6YB 1KNZA 2VA2A 2I5JA 2W25A 5ETVA 3HULA 2YX4A 1WHWA 2EG2A 2IRXA 5HP1A 1HLWA 1SVDA 3T1HJ 2MY7A 2ZD1A 4DWIA 4K5SA 1HPZB 2FY8A 5B08A 5AE2A 1K73T 5C42B 5C7PA 4I7FA 3R27A 4DV5F 5DS7A 3RBZA 3DI6A 4KJIA 2HNDB 2B0GA 1UETA 2HW3A 3GJRB 5LXYA 4Y2AA 1N0VC 1PJ5A 4NA1A 3K5NA 2MQQA 4DFMA 3TJ8A 2B5JB 4JI3J 1XR5A 1JLFA 1LOUA 3R7SB 3DOMA 1AROP 2WBRA 2AYEA 2ZBRA 4EU0A 1RXOB 1SH2A 1UWBB 1V9OA 1U6ZA 1QY7A 5F8IA 1HNZJ 1SJ4P 3LF0A 2JHEA 2AJ1A 5KFAA 5IXUA 3SIPB 1MWYA 4XPEA 2B9WA 4DEZA 3GR1A 1ZAVA 2C3YA 2XZWA 2B56A 4RWWA 4RZRA 3MFIA 4DQSA 5ETOA 3LPEA 2AJ4A 3ZO7A 3Q89A 4F4XA 2XCAA 4V19J 1Y3JA 4H4OA 2ZWOA 4ES1A 5T14A 5GAHU 3OVBA 3FFIA 3PKYA 3ZZYA 2YWEA 5KOXA 3K8WA 5KFEA 5D77A 1S1TA 2YNHB 2UU9J 2LU2A 3LWMA 1LFWA 3X1LB 4AL7A 4IUFA 3W9IA 3KHGA 4KH1B 1X9WA 1KHVA 3W5YA 1IBCB 4M5DB 2OIHA 4EYHB 5EDWA 3QWPA 1R89A 3GR0A 2J9DE 4N47A 3DU6A 5DDQC 2EFPA 2HRUA 3I5AA 1PYSB 2DB1A 4RW8B 2H3EB 3R2DJ 4NXNF 4QYZK 1YJNS 1UJ6A 3NNCA 1TUGB 4NZ6A 3QJPA 3T6BA 2VC1A 2BW2A 2B8PA 2K1RB 1HWLA 3LP2A 3AT1B 1NPKA 5CYMA 1S6PA 1DLOA 4FKXA 4M5MA 3DRSB 3MD1A 2NZCA 1S9FA 4Y3CA 4J37A 4ECUA 1GQEA 1MMLA 4IDKB 2ZOFA 1CJTA 4LSLB 5CYQB 2JL9A 2JZ5A 4KGVB 1XMOJ 1LW0B 1RUSA 3D5MA 4LRBA 4JI7F 1WOOA 1UVJA 1RCOB 1AB8A 4F67A 4DR7F 5F8NA 5F9LA 3I5CA 5F8LA 3GP9A 3L3CA 2XMMA 1TL5A 4DN0A 4KFBB 4NLYA 1LXNA 3W2VB 3MMAB 3M30A 4DV1F 3PZPA 1K47A 2MZJA 1LXJA 1G7CB 2HVDA 1N48A 2OSQA 2RILA 2AEFA 4LT6A 1TU0B 5GAEU 1FX2A 3RW7A 5KFFA 5KG0A 1QE1B 3GQCA 2OPPA 3ZNUA 1WNEA 2DGQA 2EWHA 1KN6A 1VC0A 3KK1B 3DDKA 1NCLA 4AE5A 3K89A 2BANB 4NE9C 2OFGX 1WJ9A 3C66A 2D9OA 5DDPC 2RKIA 1HMVB 2A2CA 3NWRA 3ZFVA 3BEGB 3TAQA 1RAEB 3DLLQ 2HGNA 2UUTA 1VQYA 2DT9A 5HMYA 2AJQA 1RYRA 2CVIA 3Q8YA 2FUG9 1UKUA 2C3OA 4N77A 2Q79A 3QGPA 4KGZB 3P5TL 5E3PA 3GIIA 2NREA 1XJWB 4JV5F 1NEEA 8RUCA 5I3UB 1RT5A 4DL0C 4DOZA 3CDAA 1PO6A 3RR8A 4X4VA 3FVYA 2DHXA 4KRWA 2HS3A 1S59A 3GB0A 2AYMA 4UZCA 3H2LA 4USTA 2G4BA 4DJBA 3D68A 3VGTA 2WSEC 3DHXA 4C11B 1Y7PA 2AKWB 2HNYB 1T02A 4X4QA 1HNVB 2KTQA 2JVOA 2EFVA 2R4FA 4D3GA 1QTMA 4FF1A 2ZVIA 4KHRA 1XNQF 1NDKA 3I0RB 3Q86A 4OHWA 1EB0A 1YBUA 2JSXA 2Q6BA 4NCAA 4XK8C 2VQEF 2KXFA 4NLDA 2LEBA 3OL7A 3D3CJ 1LV5A 2IM2A 1UEKA 3N9UC 1HA1A 4Z2XA 1VHFA 1BQNA 3I56S 1FE0A 2CQPA 1D0EA 1X9SA 4C8OA 4U8VA 5AXLA 3KLIB 1T9VA 2UUCF 4QQBA 4K4SA 1UJ5A 1NAQA 1Q86T 2E9ZA 2JEJA 1KQFB 2VPWB 1NSQA 4QIEA 3M8YA 1TAUA 2CPEA 2LXFA 2BUNA 5D0HA 3PX0A 4N56A 1NJYA 3MEEA 2OPSA 3BSOA 2RMLA 4HYKA 5LOQA 3CC2S 2VJVA 3NOCA 1QD1A 1VBKA 1WSVA 4NCGB 3MAHA 3LQVA 3DLGA 2KHDA 2AZ3A 1EQ0A 2DNHA 2FHKA 4H4KC 3FMBA 1N33J 2W8LA 2IY5B 3RG6A 5B0CA 4DX7A 1S9EB 1ZETA 3GV7B 4FN5A 4ZKAA 2R7UA 3G8SA 3PJ9A 2B3TB 1CJVB 2PDAA 3VVUA 2PEBA 2UXCJ 2VG6B 1SL1A 4ZMMA 1RK8A 1CS4B 1Z1ZA 2JDJA 4B3MJ 2VQFF 3B4MA 1WTFA 4NEYA 3BO4A 4KB7A 4OZ5A 4XDDA 3CULA 3ONQA 2J9DA 2DY9A 2KDOA 3DMJB 3KMQA 2ZC3A 2BVZA 2YNIA 5HMXA 1KD1T 1TAQA 4OYIA 3JB9k 4OZNA 2D7SA 3CJKA 5HROA 3RR7A 1IWGA 4EO6A 2CQBA 1KTVA 4OJGA 1KOOA 4WKYA 4BC7A 5F0UA 3IS9A 3SBMA 2F8MA 4OYOA 2XS7A 3W2WA 3ITHA 1F3VA 4DSJA 2ZZTA 2YPYA 5DLGA 1K9MT 2LMIA 1JLCA 4USWA 2VL1A 1UJ4A 1HNWF 1IXKA 2Q43A 2YX7A 1RAFB 5L1JA 1RBOB 2H1YA 2EI5A 3MM7A 4TQRA 3NCPA 4QOTA 3I4PA 1SB6A 1VQKS 4MTPA 5BJRA 4EBDA 3EGNA 2DISA 4R8UA 5KFRA 1VCTA 4J9SA 3WIUA 3DXSX 1TKZB 4I64A 3AD7C 1FXRA 2W4CA 1EETA 2APOA 2N4CA 3PRVA 5J2QA 1XERA 3N5BA 2QL7B 2GV1A 4KY3A 3CJQA 3IXQA 4LF7F 3IG1A 2V4JA 3CCMS 2DH9A 2OP5A 5A8KB 3PIPQ 4TU8A 2O66A 2W2QP 3I9ZA 3M9MB 4QIFA 5KG4A 2OD6A 5A8WA 4QR1A 2A1BA 1PG5B 2M88A 2GGPB 4QWDA 1OMSA 4ECTA 5DO2A 4FNHA 3OR1A 2HZVA 4DR4J 2G0IA 2HPUA 1S7HA 1GT8A 2ZM6J 1KRPA 3FC9A 3TZYA 3NS6A 1FVSA 1TL4A 4MKBA 5FLXU 2CPFA 5DZ6A 1VOMA 4ZLNA 2FHJD 5A0YA 4N5SA 3MR2A 3CD6S 3KLHB 1I94F 2AT1B 4K4VA 2Y1RI 1RT6A 4OIXA 1JLGB 3LGNA 1N34F 3FCVA 4ELUA 5CA5A 3MECB 3CCVS 3CDUA 5ETTA 3C6TB 4UY8T 3NEKA 4LF9F 3K17A 4IFYB 1FFSB 5K9FA 1N0UA 5B7WA 1C1BB 2J6TA 1LWEA 2RSQA 3BBBA 1FXLA 4KPCA 2IYIA 3PIOQ 4TY8A 2K2PA 2E5IA 1REVA 3KK2A 1J5EF 3TX8A 4CDIA 2F3JA 4EBEA 3LA0A 3CMQA 2DGXA 2XC9A 1LNQA 1GMUA 5IC6B 4DF4A 3BR9A 2GHWA 4WE1A 4PAAA 1FNXH 4LF4J 3AJ2A 4OI4A 4Q0BA 3FK4A 5GADU 4G1QB 2N82B 1K1QA 3QRPA 3J7AN 2NCKL 2DR8A 2CIMA 5FDLB 1JLAB 2RHQB 3G8TA 5C25B 2ZNYA 5AXNA 5DDOC 1JLQA 1NJIT 1OY8A 4HACA 2F9JA 3SFUA 1R8PA 2LU1A 4ZVEA 1SI9A 4JI1J 3WC2A 3C19A 2DPJA 2J9CA 4DUTA 1HNIA 2F5GA 1P6TA 2GO8A 3MM6B 2OSRA 1VRTB 4TU7A 4ED6A 3PDNA 3P6YC 1HHTP 2CRLA 4MJKA 3MM8B 3DXBA 5LL6d 2RRBA 4XAKA 4ES3A 2ZVSA 4YUDA 1DAXA 2R8GA 3BPDA 3D9BA 4PZVA 1CULA 1WC1A 2GFFA 4FYVB 5IT9U 4USIA 3TOQA 3JAMU 4ZA1A 3NGKA 1OYDA 3V6HA 1VJQA 2HWTA 3B82A 1RTHA 4F4ZA 3LP1B 3HMJG 2EFOA 3OVSA 3UD3P 5HI7A 5M2UA 3UE2A 4IH7A 1FERA 1RHUB 2AX0A 2KM8B 1QSSA 3WDOA 3PYDA 4PXEA 1YK9A 4WP3A 3MEDA 2N3LA 3T19A 2B43A 2QE5A 2LFVA 4ZS6A 2FHOB 2ZUGA 3PKMA 5CD4A 2QJ3A 4WXWA 4FXVA 4F0HA 4ZJOA 3R6LB 4ENOA 3T9NA 2QLXA 2FJWA 2ROEA 3KTQA 2M5YA 1LK7A 2MQPA 2MLYA 2QLWA 2FJXA 2AJ0A 4OYAA 4CCHA 2ADBA 1FD8A 3B4DA 1X5SA 2BR0A 4AQYJ 4DV7J 5MLCV 1UTAA 2CNNB 1NLKL 3MD3A 4UOCA 5KFTA 3VZHA 2J6SA 3IRWP 3DM2B 4MKVA 1NDCA 1S9GB 5F3ZA 2HVIA 2DXDA 1FRXA 3FBCA 3QO9A 4IFVB 3QYYA 3UR3C 3S8SA 4EI2A 4KV8A 3CWJA 3AB2B 4LQ9A 3OXFA 3V4IB 3NS7B 5CD4H 1C2PA 1LEOA 1WUUA 5BYSA 3EE3A 3P5BP 4USVA 5DG8A 3VWSA 2XO7A 3ZZUA 1S5ZA 2M8HA 2HVEA 4KR0B 3Q8VA 4HI1A 2HHTA 4DS5A 1FDDA 3HHLB 4JI8J 1IBLJ 5KG2A 2P9EA 2CQ4A 4NLRA 2HGLA 2HQIA 4B3OB 2OO4A 2FHMA 4CLKA 3CCZA 5LT5A 1KFSA 1SQFA 3CF5Q 5CZXA 2ZH9A 4HT5A 2J8SA 4WPAA 3HKWA 1RB0A 1WG4A 4ZIWA 1OIAA 3U1MA 4IO9Q 2ZKTA 2PN6A 3J7ZT 3IWNC 1O51A 2BQ3A 1N5TA 1X7VA 1U1LA 1KQSR 5IT0A 1HHQA 2E7VA 2RDIA 1U2FA 1YZ7A 1N6QA 4R0JA 2VFVA 4J7CA 2NXCA 3Q0AA 2XYHB 5C5JA 3M2VB 3U27A 1XNRF 3BBFA 1WTBA 2LA4A 4DR2F 2KG0A 3AXMA 2ACMA 3VTIA 1HR0F 3GFYA 2HQFA 4J9MA 4OHVA 2MJNA 2B6AB 3IC1A 2LECA 2JVRA 5IZHA 1UEVA 4M5KA 1X9MA 1IBKJ 4DPYA 3ZZRA 2CQIA 3LWLA 5D3GB 4CO0A 2EK1A 3KK3B 1VBZA 3C15B 3ILLA 4I68A 3HF5A 1PIEA 4MYUA 3FZ2A 2VPZB 2KKHA 3CEDA 3NGSA 2XMJA 5F41A 1G4CA 1WG1A 2W9CB 1ICEB 3W1YC 3MPVA 4JI0J 1ZOTA 4CLFA 4I6YA 3OTOF 3THTA 3PTWA 2GVZA 3UDLA 4OLOA 2MXYA 3BM7A 2X1GA 2L9WA 2Y0SD 1Q7LB 1S48A 2DGUA 5F9NA 2ACYA 3J80U 1ROFA 2UV8A 1FHTA 1HIYA 2VU5A 2IDLA 2XG8A 1B99A 1HWUA 3D54A 4ZVOB 1HHSA 2XULA 1GXLA 4PQUB 4WYWA 2XGPA 4ECYA 4F3MA 2VHGA 1N4LA 2Z8QA 5DJBA 3KHRA 3IBCB 3OUYB 4ZP9A 4XDCA 4S0MA 4L3KA 2XM3A 2PGCA 2AYGA 4ECSA 4HR2A 2D3UA 3C6UB 4LFAJ 4RW7A 3KHHA 2CADA 1GMWD 4NX9A 2BJDA 2UZAA 5ETRA 4M5DA 2Q6CA 3KG1A 1T03B 1HBNB 2Y9HA 1JXEA 2RQCA 4ELVA 2FJBB 3IGVA 1VQ5S 1D8YA 2BJ9A 5KG7A 1AXQA 1EZZB 4F25A 5A8RB 4ECQA 4RW8A 4DV0F 5JVGQ 3HSDA 1E6VA 1KTQA 4DV6J 4K0KJ 1NDPA 2OMOA 3KDNA 3DYAA 2K1RA 1VR6A 4F3QA 3POTB 3ZTRA 1B0PA 2C3PA 1H2VZ 1Q8BA 3QJLA 2C2RA 2AWZA 3DRSA 4M8LA 2LXUA 1TV6B 3P4UB 4OHYA 4L74A 2E29A 4IDKA 3MEKA 1R8AA 2OTLS 5HAOA 1NSPA 1Q0NA 5CYQA 4LSZB 5EX0A 1P27B 3M9OB 1IR2A 2FVRA 3FBBA 4B9LA 3VZIA 3L7UA 1RTIB 4F7VA 4ECXA 5MAOA 1VISA 2ADCA 1RT2B 1VJWA 3H90A 3P49B 4DV2J 2RS2A 1FJGJ 4P75A 1FWLA 1Q1KA 5IQQA 1JX4A 1UP1A 3MMAA 1D09B 1YX2A 1RHKB 3QMQA 3BYRA 2W7OA 4OYWA 2CZ4A 3NCQA 1OSCA 1U02A 4NZ7A 3ETOA 5CHCB 3ISNC 1CQMA 2CJKA 2DCLA 3R7NB 4PPZA 3JXOA 6FD1A 4LMZA 4LF6J 3WQPA 4I2QA 1S7IA 2UVWA 5IWAF 4ZPDA 3M8RA 1QE1A 3SQGA 4QWEA 2QSFA 1FWKA 2QA4G 4CNYA 4QBUA 2DNZA 2F4FA 3GIRA 2CPHA 3GYXB 4LBPA 2GMHA 2DITA 1H7XA 2DR9A 2WONA 2VONA 3D66A 3M1VB 1TZ0A 4EEYA 3KLVA 2W9BA 3LPYA 1P1TA 2HHPA 3RAXA 1FJ7A 2DD8S 4NLPA 3DLJA 1NSAA 2JLGA 3MTJA 1U8SA 5DQGA 3FCWA 5ETKA 2PMWA 2GQCA 3I87A 1ZA2B 4DPUA 1MN9A 3CIMA 2J0WA 3HM9A 4DUZJ 2K3KA 1VC5A 3BGUA 2YWHA 4JI4J 2DRDA 2DEJA 2R7WA 3HJVA 3MPYA 2XCPA 3IR6B 1FI4A 4EYIB 3I9V9 1S72S 2DEIA 4B17A 2NQPA 4U9RA 2BM0A 2IA6A 2ZOGA 1KVKA 1S49A 1RTJB 2HNYA 2XMTA 4MAKA 2MKSA 3KJVB 5HATA 2DTJA 4OX9J 3I0RA 2GHPA 3IBWA 5L46A 3TZXA 3CIZA 4QR0A 3DOLB 1DJ0A 2QFJA 2LQ9A 2CYYA 3GONA 5J2NA 5KG3A 1WC3A 5E3CA 5KFIA 2LEPA 5LJ5Y 3D0GE 1FTRA 4DX6A 3GJSB 3EDRB 3GG0A 3BGOP 1VLOA 3V4MA 2I8EA 1HBMA 2CQ2A 3QSIA 4USHA 2R7RA 3BBCA 3A13A 3M8PA 3TUPA 2RDJA 1UW4A 2HQGA 1GTHA 3VAGA 5F8MA 1RT1B 3KFWX 2IAJB 2V9KA 1TKTA 2RE1A 4DCJB 3M2RA 4FVCA 1SV5B 1HNXJ 2HK3A 1HD0A 2VFTA 1V3SA 3R5BA 2RQ4A 2V2ZA 2DNOA 1YTYA 1FO1A 3DDIA 4IOCQ 3G6YA 1YSJA 1OQ6A 2VZ9A 5ETSA 4CO4A 3JTNA 4EZ9A 1CSJA 2XYPB 2ZBIA 3FEXB 1S9EA 1UFLA 1GK8A 2ZJPQ 2PD1A 4UOFA 2FHJA 1GAOA 2BKNA 3NBPB 1H98A 3N28A 2LQ8A 1CJVA 1TUVA 4FBTA 4HHUA 4OMFG 3V5RA 1CS4A 4X62F 5J1EA 3WC0A 2QGFB 4CM2A 2HAFA 4WZQA 1DTTB 2MSSA 1D9FA 4EGLA 3HKZD 3BJYA 4YOEA 4F04B 1ZPWX 3K5LA 1HBOB 2QLJB 2KFYA 2DNPA 2VG5B 1WKLA 1GMVA 2E1MC 1NRKA 2HFOA 1CJKA 3TYTA 4UUXA 3NWGA 3HSJA 2FPHX 3GWCA 3OSPA 3PX4A 4MK7A 4DPOA 2DIVA 5K8NA 3HFZB 4B3RJ 2OUGA 4NA2A 1S0MA 2PFFB 2MQOA 4NMXA 4X4SA 3CMES 3IWLA 2W4DA 2BJ1A 2EKNA 2KU7A 5FJ4A 2MZ1A 2IMOA 5ETMA 2FZGB 1ZM3A 2CNKB 5CABA 2DIUA 4QW8A 1M5HA 2IM3A 3HD2A 3CCLS 3FEZA 1N36J 2RIJA 4C0BA 3TARA 4JI3F 3C16A 5E5NA 2C2MB 1S6UA 3HHDA 2IJRA 2N4DA 1NH7A 1HNZF 3ADAC 3OL8A 1R0CB 2R7SA 2POKA 4ILRA 2OFHX 3UCGA 4G65A 1DFDA 2G2OA 2V2KA 3TWZA 4ID5A 1TKZA 1SXLA 1HQUA 4X4OA 2QLBB 3RAQA 3OR2B 2Q3PA 3CXCR 2MSTA 2UU9F 1PBUA 4WF9Q 4QJVA 1N5QA 4R0EA 1R43A 2K7KA 2NUHA 2GGPA 2U1AA 4O0IA 2MB0B 1JXVA 2JOQA 2NPFA 4DL5A 1U8WA 2KL8A 4LVOP 1T95A 2E9TA 2XMAA 3BYPA 2YQ0A 3WBZA 5J2MB 3PFEA 2AX1A 4ZVUB 2VV5A 3OTEA 3H25A 5I3PA 1SJFA 5CCLA 3HT3A 3GJQB 4WYLA 2VODA 4O3OA 2NZ4A 2BOPA 4M5NA 2LYVA 1TMMA 1U25A 2MZQA 1T9YA 2CJQA 1C0TB 3NCRA 4FNIA 2JWNA 2D69A 1FTCA 1SQGA 3EZOA 4X66J 1NK9A 3N6NA 3T9ZA 1U49A 4IFYA 2IRYA 2WRMA 2PIIA 4DV3F 1C1BA 3KKFA 1RT4B 4ZLLA 2BV3A 2UUAF 5FD1A 3A3PB 1SL2A 1ZAWA 2B4OA 1XMOF 1I5OB 3N6LA 3RW6A 2W1BA 3GSDA 2M8DB 4I2PA 2D3O1 1BWVA 4E0DA 1K1SA 5HVHA 3KLGB 1UVNA 2G0JA 3CJ5A 1PC5A 1IKYB 4KH0B 4DPXA 5HK4A 2XQCA 4FXDA 1D8ZA 1JLAA 4DX8H 2J0SD 2PFDA 1S4EA 1I6JA 1FX4A 2GIRA 2J6UA 4FYDA 3LANA 4K5RA 4OJHA 3HVWA 1P1LA 2NXUA 2OPQA 3QGGA 1RWKB 1H2UX 4UT4A 1WORA 2KT2A 4JYAF 1KFDA 2CPDA 3NNHA 3K7RA 2IMWP 4YR0A 1NBEB 2DXEA 4IG0A 1RLDA 1WC5A 1JNZB 4BHQA 2O5DA 2HNZB 1RSCA 4Q7AA 2DNRA 3A8IA 2VOPA 3VGVA 1RTDB 1S99A 1C0UA 1JMTA 2RU3A 3VAMA 1TL3B 1BY9A 1V3ZA 3R5JB 1FWPA 3OFEA 1LW2B 2CXEA 4KGKA 1U0SA 1BE4A 3AH6A 5KFXA 1UFWA 3PVXA 1UVLA 1SUQB 1NXIA 1J5OA 4WIIA 2XHWA 1RWMB 3VR1A 3BO2A 1RWPB 3W8PA 1FRJA 2KG1A 2J0QD 1M5VC 2VB6A 3BREA 4NYOA 1O6XA 3DGPB 3OLBA 1BMQB 5D4LA 3NMRA 2AMCB 4IH5A 2H5EA 1ELOA 1RHMB 1I1GA 4PUOB 5BYQA 2BQUA 2CA9A 5A6PA 1A9NB 2ILYA 3VAFA 4Y00A 3SYZA 6FDRA 4N8NA 3CSKA 1TMJA 4C8ZA 3HT0A 4YDXA 3DRRA 1SKRA 2KXNB 2DYAA 3NAIA 3DM2A 3J7A1 4CH1A 2F63A 2M0GB 4LF1A 4LBHA 2I2YA 1S9GA 4IFVA 2LVWA 3ILIA 4OZ1A 3CCSS 4UQTA 2ZH7A 1YIJS 2FGOA 3V4IA 4P7VA 4QPTA 1RU2A 4NRUA 4ZJQA 3J81U 2RDDA 1BUXA 1GMWA 3PJWA 4J9VA 3I55S 4CLYA 4ZVRB 1PSDA 5KT7A 3KLEA 1QUPA 4GRSA 2D9PA 1MMDA 2KO1A 4PWUA 2ZH8A 1N5SA 4FXWA 1NZ8A 3HHLA 3DU5A 2HBZB 2MHNA 1WHYA 3NAHA 4P10A 1S1XB 4ZPCA 4QU7A 5FLXY 1L3UA 5B0FA 1N33F 2GJ2A 2Z0GA 2C22A 2JLEA 1S57A 1JJ4A 4JI7J 1UMJA 2JH3A 4DR7J 1NK6A 2CG8A 2E44A 1NK4A 1RP5A 1VFJA 3DCAA 2MLZA 1KDNA 3OV7A 4TN2A 4WFAQ 5HLFB 2UXCF 3W65A 3TJ9A 2DHHA 5DRKA 4JV2A 4LRAA 1IM4A 1U09A 2MZRA 2NYIA 4DV1J 3QIDA 2QT7A 2IFXA 1V5IB 1M90T 4RKUC 3RB3A 4PG4A 2E7XA 4J5OA 2IIHA 1U6BA 1T9UA 2B6AA 4MFBA 1T05B 2B9EA 2VDHA 3PW2A 2PT0A 2OI2A 1DTQB 3QRQA 1U7LA 1SIWB 4RW4A 4WJBA 2VJUA 3MR6A 5D3GA 2GA7A 1TL1A 4P52A 1BHNA 3FQKA 4J9UE 3T1YJ 2MQLA 3W66A 3I31A 3O2IA 1MROA 5FIIA 5K14A 3RTVA 4CM0A 4K59A 2YWKA 4AUKA 2XWXA 1HQEB 2W9CA 3FGVA 2BJ7A 1TFYA 1KKHA 3F56A 4NXMF 3Q22A 1UFKA 3GZ7A 3K58A 3JQMA 1L3TA 4QWCA 2WB4A 3UNYA 4C0OC 3BSNA 4FP9A 5D4OA 3PO5A 2M70A 1SL0A 3MUMP 4JV5J 1FDBA 5D6GA 4EBCA 4O0NA 2KJWA 3DOKB 3QIPB 3H42A 1FD2A 2FVPA 1IQZA 2KRBA 4PQUA 3AAWB 3MEGA 4UUWA 3BPSP 3J7YU 2DKOB 3O5TB 5K5MA 3PM9A 2XHCA 3R6GB 3OUYA 3IWXA 3QT8A 4C8YA 2BE7D 3D6FB 1ZM9A 1V3RA 3PV8A 3H20A 4A8SA 3C6UA 2P6TA 5GMDA 5IT9Y 2RUGA 2YNGB 4CT8A 1RA6A 3JAMY 1YJ9S 2WVDA 4TQSA 4ZHRA 4WFYA 4O4GB 3CVKA 5LSOA 4WFXA 1X0FA 4A8XA 2HIYA 1DQAA 5KG5A 1T03A 5LMNF 2ZBQA 1RJJA 1VQ9S 4ED3A 1IN0A 2KXHA 1KLMB 2YQ1A 2VQEJ 4RNFA 4TXSA 2DXFA 1RAOA 3B6BA 4FYYB 5ADZA 3TI0A 4F0MA 2GJIA 2AGQA 1IKXA 1KR4A 2ZM6F 4GC6A 3OW2R 1N32F 1ZTWA 2AP6A 1EQMA 4ZOSA 3Q8PB 5EX3A 1G2EA 1X4AA 3IR7B 5DGBA 3POTA 5I42B 2LEAA 2KJVA 1N5YB 4Y2KA 4Y28C 4B08A 4DR3F 1H6KX 2JJ4D 4H4MB 2DRBA 3GYNA 1FXDA 4ICLB 1NK0A 2YKNB 2MPUA 4WFNQ 2FVQA 1TV6A 1B0TA 1OO0B 1M0SA 3VV2B 4KO0B 1S0NA 4HHHA 3UDVA 4KQZA 3RB4A 3A3NB 2EBEA 4F4YA 3Q8QB 4NI2B 2RU9A 1KVIA 4PYAA 2MZTA 5ETQA 3LTOA 2A10A 2OTJS 2FC8A 4LIRA 2V94A 2XZDB 3QZ7A 2L9DA 4TLQA 3MAQA 2ZBPA 1WEZA 1CLFA 3KDOA 2A6MA 3SV3A 4NWBA 1APSA 4OV6A 1KVJA 5DDRC 1OSDA 1U1NA 2GCFA 6AT1B 1XTZA 2AQ4A 5KOWA 2KM8C 5LMUJ 3CJRA 2HQDA 3GILA 3HX9A 3ZC4A 4LF4F 4HKQA 1PAEX 3MPWA 3TR5A 4BS2A 4DR1F 1Z2LA 3ICLA 4L75A 1U1MA 3BGRB 1UEUA 1N88A 1JKHB 4ZCKA 3V81B 3LP0A 3M1VA 3F44A 5KFWA 1PGZA 5F8HA 3ENWA 3M6XA 2OLWA 2DHAA 1KQGB 1CBKA 4Q2MA 3Q24A 2YKAA 2V4RA 3OQ2A 4U7CA 5LSRA 2CPYA 4PXCA 2ZD1B 1YJUA 2DO4A 2ATCB 3U7JA 3BKFA 4I7FB 1HNWJ 4IR9A 3MTKA 1R8HA 1X4FA 1PJ7A 3DI6B 2LDIA 3A3OB 1TTHB 3CJ4A 1XMQF 4ZP7A 2C2DA 1EHWA 2HHSA 4Q45A 2KHCA 2QRRA 3UVJA 1JLFB 2NXJA 3DOMB 4QPXA 4ER8A 3VAIA 2HFZA 3GIJA 1S77D 2E1CA 1B64A 1X4CA 2AU0A 3Q8UA 2DK2A 3QWUA 4M94A 3HHLC 4PG8A 3KJVA 4LF8J 4PXDA 2L9NA 4IKAA 3H4BA 5HANA 3EVMA 4C48A 3E8OA 2J7WA 1QJHA 4H4OB 3HSZA 4J9NA 3GFXA 4CLLA 4P9SA 1SC1B 2CJYB 2VG7A 3FFIB 4ED2A 3DOLA 4CLPA 3F73A 3RUBL 4ZPAA 1SCJB 3J80Y 2R7TA 3FJ2A 2DJWA 1S1TB 2AD9A 2Z56B 3TA2A 2N7YA 1QSYA 3ISND 1XR7A 1YQHA 2BQRA 1U6FA 4H4KA 2WOMB 2FGCA 1SJ3P 2R2SA 5F8JA 4U7UK 4AQYF 4OYMA 4DV7F 1YJVA 4HEA9 5KG6A 4CLTA 3C14A 2KZZA 2MY8A 4A46A 3JSMB 3BR8A 1QM9A 2XLJA 5KFYA 2JLFA 3PG9A 2YVSA 1VK8A 1RU1A 1W25A 1IJEB 1RT1A 1BGXT 4B9VA 3NG8A 1SV5A 2AEJA 4ZCIA 5AT1B 2ZJRQ 3LGMA 3ZTSA 5GAGU 4Y65A 1N34J 1X5TA 4Y2MA 3CTRA 4DX5A 2C2NA 5DQIA 1KC8T 3HSGA 2ATLA 3QT6A 1IKVA 4CO3A 4RPFA 1ZM4A 4QZVB 1WEXA 1S6PB 1XWLA 2QMWA 4YY3F 3KG4A 2NS1B 1MG7A 3V6DA 1IBLF 1IKWB 2LQ5A 5CYJA 4RNOA 4K2JA 1F3FA 1VQMS 4PG5A 2XBPA 1WKJA 4FKYA 4FBUA 1RT7A 3R2CJ 2WW4A 1IR1A 3JSBA 1J5EJ 1Z4UA 5HBMB 2ZHAA 2KZMA 4DR6J 1U1QA 2DVIA 4YP3A 3W9JA 2KFNA 2RD5C 1SKSA 3AB4B 1FKOB 2RQMA 3GTYX 4C8LA 1LWXA 3LO3A 2MQMA 3ZZPA 3M30B 5BR8F 4U6PA 1V6HA 2MYFA 2VG5A 4DL4A 2FY1A 3AXKA 2MZSA 1PCAA 2CQ0A 5D0RA 4BDPA 2VKRA 3UCUP 2P5VA 1F5AA 1EP4B 4UOHA 2X7IA 2CPXA 3IN5A 2VUGA 2D74B 1S0VA 2GQ2A 3HVTA 5IC4B 1PC4A 2HVHA 1BQMA 2RKIB 3CO0P 2AIRB 2WZ1A 3MMCB 2C2EA 3GE9A 2HFUA 2ZHOA 1Q78A 4ITSA 2IM1A 2WK4A 4DQRA 5L1KA 4LBIA 1TVRA 1TELA 4HHJA 1VQ4S 4A47A 2IC3A 4DSFA 2DNNA 1H72C 2J7KA 3UI3A 4L73A 4C3MA 4OI0A 2QSWA 2IVMA 5L8RC 3OR2A 4YB6A 2LLZA 1KS2A 4ZVTB 1J2VA 3KG0A 4WU2A 4I6AA 5KFUA 3NNAA 4CQ1A 2EFGA 4O3RA 3TAMA 1Q79A 3RRHA 2PC6A 1UAWA 3D3BJ 1MU2B 1FKPB 1RAIB 2C42A 4N76A 4IRKA 3MURP 3FSIA 2XNQA 4RR5A 2CWXA 1FK9B 1M1KT 2F65A 4USMA 3JTPA 4N7TA 3SDEB 1LWFA 2EK6A 4AL6A 5ETLA 1BQNB 3T5KA 8ATCB 4A8MP 4OZ3A 2XYGB 3V6JA 3HPOA 3HCXA 1RHJB 2R2UA 2BKPA 2YQ3A 3AQPA 4K7QA 2GC8A 1YJ7A 4FS1A 1AUDA 2Z2ZA 1C0TA 2CFXA 4NLVA 2Z4PA 3W3SA 1MMNA 1U0HA 3HXMA 4ZP8A 3OFFA 3DHWC 2IDEA 1CVJA 1RQ0A 2WW8A 1RHQB 2EKYA 5J1PA 4GKKF 2B4VA 1Q95G 3MEEB 2OPSB 1B7FA 2HS4A 1RWWB 4C3LA 5JUMA 3DLGB 4ZVSB 2QMXA 3TZWA 4JB8B 3I82A 3NLCA 4RO0A 4IG3B 1UVMA 1MWZA 2YXLA 1NKCA 1WF1A 4DL3A 4MKYA 1EKSA 1FJGF 2J76E 1PYOB 2CQGA 3CE8A 4MMOA 4HTIA 2MTLA 3H5SA 4TVAB 1IM6A 2P2CB 2PMHA 3JYTA 2VH7A 3HVRA 2HVZA 4LF6F 2JEFA
chains in the Genus database with same CATH topology
3B78A 3DRRB 3LP1A 3SEOA 3I0RA 2Q1LA 3PR5B 1GXTA 4K50A 2GHPA 3IBWA 3J7Z5 4QWAA 3QGIA 4BC9A 3H5XA 2C3UA 2BM1A 3CIZA 4QR0A 3S7RA 4NLGA 1ZAXA 3DOLB 2YNIB 4DQIA 4OQJA 4Q2LA 1DJ0A 2QFJA 2LQ9A 4KHPF 1O0PA 2CYYA 1F2GA 2FDNA 3SSQA 3T5LA 4C8KA 3FRZA 1DBDA 2XY5A 4DG1A 5J2NA 1TQLA 4OI2A 5KG3A 4NYPA 1DARA 5E3CA 5KFIA 3ZZOA 2RH3A 2LEPA 2YNFB 3OJSA 3HO1A 5LJ5Y 3D0GE 1XEZA 2IA0A 2E5JA 2MJUA 2M3DA 4OI3A 3IS9B 4CI0B 1WI8A 3JTOA 1FTRA 4Y34A 2HS0A 2QIFA 3L95X 3VQTA 1KEKA 5KG1A 4EZ6A 3W2WB 2HNZA 3ITHB 2DNKA 2RT3A 4JV0A 3T6JA 5GAHI 3GG0A 3KLEB 3IAS9 3V4MA 2DNMA 2I8EA 3IRXA 1HBMA 3BGRA 2CQ2A 3O6QA 1IJFB 4USHA 2R7RA 3V6KA 1JKHA 3EXCX 1HW8A 3E01B 1E6YB 5IFMA 3M8PA 3G6ES 3E3XA 1YBAA 3FRYA 3AY0A 2A3JA 4EWTA 1RTDA 4MIAA 1QUVA 3EZ5A 1KNZA 1RAJA 2RDJA 2BDPA 2VA2A 2M2BA 2I5JA 1BC6A 4RNMA 3CDBA 1X4EA 2D1CA 1UW4A 2W25A 1NK5A 1GTHA 2YX4A 3VAGA 1WHWA 2EG2A 2IRXA 5F8MA 5EWFA 5HP1A 1RT1B 3KFWX 4DUZF 4OL8A 2IAJB 1URNA 2V9KA 3OHAA 1NK8A 3LH2S 1TKTA 5KFLA 2RE1A 5AJ3F 4RUHA 2MY7A 3V2UC 3MFHA 3KHLA 3M2RA 2ZD1A 4FVCA 4DSIA 1SV5B 3PW5A 4DWIA 1HD0A 1HPZB 4K5SA 4JI4F 2VFTA 5B08A 1V3SA 3UDCA 4A8OA 5AE2A 1K73T 2CQ3A 3R5BA 4L3NA 2RQ4A 5C42B 2DNOA 1YTYA 4GO5X 2B9XA 2FJAB 4I7FA 4DDFA 1FO1A 4IOCQ 4OFZA 3G6YA 4PUOA 1YSJA 1OQ6A 2D3ZA 2VZ9A 3R27A 4CO4A 4DV5F 5DS7A 3JTNA 3DI6A 4EZ9A 4KJIA 2HNDB 4RX6A 3RAMA 3QAEA 2B0GA 1UETA 2HW3A 5LXYA 1LWCA 4Y2AA 1NB7A 1N0VC 2X3GA 1CSJA 2LXIA 3D0IE 1Y0HA 4B9UA 2ZBIA 3FEXB 4NA1A 3K5NA 2DNQA 2MQQA 4LQ3A 3M8QB 1S9EA 4B3SF 4DFMA 1UVIA 2B5JB 1UFLA 5DETA 1X4GA 1XR5A 2UVUA 4KPYA 1JLFA 5DM6Q 4U67Q 3I0SA 4O44A 2ZJPQ 1KQKA 1LOUA 2PD1A 3DOMA 1AROP 2WBRA 2AYEA 1L3VA 1DRZA 3G9CA 1RT3A 4OX9F 4EU0A 4C9DA 2FHJA 1GAOA 1SH2A 1UWBB 3NBPB 1H98A 1V9OA 1U6ZA 1QY7A 3N28A 5F8IA 1TUVA 1SJ4P 3LF0A 3UPFA 1WF0A 2JHEA 2HWHA 2AJ1A 4MFBB 4FBTA 4DHVA 5J2QB 5KFAA 2YKMB 5IXUA 5EHHA 2YH0A 1W2BR 3M05A 1MWYA 2DNLA 4OMFG 3V5RA 3IG1B 4XPEA 2B9WA 4FZVA 4DEZA 1U4BA 3GR1A 1ZAVA 4RW4B 2C3YA 2XZWA 2B56A 4X62F 4RWWA 4RZRA 3MFIA 3MF5A 1L5UA 4DQSA 4B3OA 1U26A 3WC0A 5J1EA 3PO4A 2AJ4A 5J2PA 1R0AB 4HTJA 2AF6A 4F4XA 2XCAA 4V19J 3I4HX 1TL1B 1Y3JA 3FQLA 4H4OA 5JVHQ 2JEIA 1SQEA 2VPXB 5A6WA 4WZQA 3M6VA 5T14A 2MKHA 1DTTB 4ES1A 5GAHU 3OVBA 3FFIA 3LOUA 4MH8A 2E1RA 1MROB 4KIAA 1HYSA 3PKYA 2MSSA 4W92B 3AA8A 2DCUB 5K14B 3ZZYA 1FRIA 3CCWA 2YWEA 1D9FA 4EGLA 5KOXA 3HKZD 3K8WA 3OR1B 2ZZNA 5KFEA 1SH3A 3BJYA 5D77A 1H38A 5LXRA 4YOEA 1S1TA 2YNHB 1KONA 1YWXA 4URGA 1ZPWX 3K5LA 3LAKA 2LU2A 3C8YA 3LWMA 2QO3A 1HBOB 1LFWA 3X1LB 2GIQA 4OLPA 2KFYA 4AL7A 2DNPA 4IUFA 3K0JA 2VG5B 3KHGA 5KFKA 1X9WA 4TNOA 4RW6B 2DO0A 3CCUS 1KHVA 1XK8A 2E1MC 3DC2A 1X5PA 3K8VA 4USJC 4X84A 1NRKA 2HFOA 2AW0A 3TYTA 3OLAA 1R7IA 2CVEA 4BWJA 1WG5A 3CCJS 4UUXA 3NWGA 2FPHX 3M2VA 4ILLA 1VIOA 2FTRA 3GWCA 3OL6A 3SZ2A 3OSPA 5KFSA 4M5DB 2OIHA 3PX4A 4MK7A 4DPOA 4EYHB 4JV1A 3FZBA 2DIVA 2XMWA 3QLHA 1YRTA 5K8NA 5EDWA 4B9MA 3QWPA 3MOZA 1JIHA 2BRKA 4B3MF 3CCQS 4O3SA 4NA2A 1S0MA 2PFFB 4KGMA 3CD0A 2MQOA 1HNXF 4N8OA 4X4SA 3ENVA 2KH9A 1R89A 1FT8A 4NMLA 2V8VA 3GR0A 3CMES 3IWLA 3OVAA 2J9DE 2W4DA 3DU6A 4N47A 5DDQC 2EFPA 3MEGB 2HRUA 4KTQA 2KU7A 2V8HA 5FJ4A 2MZ1A 1TP7A 4TU9A 3I5AA 4P2SA 2ZDPA 1T94A 1VK3A 5BYRA 5T7LA 2DB1A 3OHBA 2IMOA 1G1XA 3VAHA 4RW8B 2L41A 2IM0A 5GAEI 3PEJA 1LKZA 4O23A 2NPIA 1ZM3A 3DRPB 3M8SA 3SXLA 4NXNF 1HD1A 2DIUA 2XSJA 1YJNS 4G1PA 2UXDF 1UJ6A 2YKPA 5E33A 1M5HA 2IM3A 1OPZA 1RWUA 4QW8A 5DQHA 3NNCA 1YHQS 2W9AA 3CCLS 3KK3A 3FEZA 3P3DA 2RIJA 4C0BA 1JB0C 3TARA 4JI3F 5E5NA 2IHR1 4NZ6A 3QJPA 4WCEQ 3T6BA 2VC1A 1S6UA 3HHDA 3EYZA 2N4DA 2CKWA 4NPOA 1NH7A 2JFKA 2BW2A 5KFNA 4ZHRB 4Y0FA 3OXLA 4ED8A 1HNZF 3OL8A 1LWEB 2R7SA 2K1RB 3VQSA 4EO8A 2MKCA 1HWLA 2POKA 4ILRA 2OFHX 4NL5A 3UCGA 4RNNA 3LP2A 4CNZA 1DFDA 5H9FJ 2CJAA 4UW2A 4B3TF 5CYMA 5C24B 1S6PA 2HHXA 2V2KA 1DLOA 3I6PA 3TUZC 1FNOA 4ID5A 1REVB 2VC0A 4C3KA 3DRSB 2E5LF 3MD1A 2FB0A 2SXLA 1S9FA 2W7AA 4Y3CA 1TKZA 3D1OA 3UR0A 4J37A 4ECUA 4DUYF 1GQEA 1MMLA 2HZCA 4IDKB 5B0EA 1SXLA 3QGHA 1ZM2A 3CD7A 1HQUA 4X4OA 3CCTA 2ZOFA 3MMBB 4LSLB 1NKEA 3PW7A 4NLWA 3RAQA 1T05A 5L38A 5CYQB 3OR2B 4LVNP 3C46A 1U1KA 2JL9A 2PEHA 1VQSA 2YWFA 3FSXA 2JZ5A 2R2RA 3MM9B 2ZH3A 1LW0B 2Q3PA 3D5MA 3GV5B 3CXCR 4JI7F 2C28A 2MSTA 5AE1A 1UVJA 1NHUA 2V8DA 1S6QA 2UU9F 4O4RA 4TKTA 1IKXB 4WF9Q 4F67A 4LIWA 3DLEA 4QJVA 1N5QA 5D4PA 4DR7F 1FDNA 5F8NA 4R0EA 5F9LA 1R43A 3I5CA 2K7KA 1MW7A 5F8LA 2OPRB 4GC7A 2GMJA 3H40A 2NUHA 2GGPA 2XEXA 4C97A 3L3CA 2XMMA 2U1AA 1JLQB 1TL5A 2D41A 4O0IA 2MB0B 1H3DA 4DN0A 5DG9A 3HFKA 4KFBB 2JOQA 2W24A 3RRGA 4NLYA 2NPFA 3D2WA 1LXNA 4DL5A 1WELA 3MMAB 3SSSA 3D28A 3W2VB 2ZKUA 2PE8A 3K5MA 3VALA 3M30A 4DV1F 3PZPA 4LVOP 1T95A 2E9TA 1FEEA 1JLEA 3DLKB 4B3RF 2MZJA 1LXJA 2DGSA 3OFHA 4IH6A 1G7CB 4DQQA 1N48A 5J2MB 3WBZA 2OSQA 3PFEA 4R5PB 2AX1A 3RZAA 2CPJA 2RILA 5DM7Q 1U1RA 3NP5A 1FF2A 1VBXA 4LT6A 2RS8A 5GAEU 3RW7A 3I5BA 1VQNS 2VV5A 3OTEA 3MM5A 5KFFA 3H25A 1Y00A 2VBXA 5I3PA 1SJFA 5KG0A 2YKQA 1QE1B 5CCLA 3GQCA 1HBNA 3HT3A 4X4TA 2OPPA 2XI3A 3DOKA 5HN0A 4WYLA 3OFGA 2ASDA 1WNEA 2XB2D 1S1VB 1ZZNA 2DGQA 2EWHA 3CDEA 2VODA 1KN6A 4JBCA 1VQPS 1VC0A 4O3OA 3KK1B 3DDKA 2NZ4A 2BOPA 2R7QA 4AE5A 1HBUA 2BANB 2LYVA 3MUVP 4ZP6A 2OFGX 3CCES 1OWXA 1S1UA 1FKAF 1KOHA 1U25A 4ERDA 3C66A 5A8RA 2D9OA 2MZQA 2CJQA 5CXTA 3MDFA 1C0TB 3NCRA 4FNIA 3PXGa 2XLKA 5KFOA 5DDPC 2RKIA 3IGNA 1HMVB 2JWNA 2A2CA 2NSCA 3ZFVA 2M9KA 4DR4F 3BEGB 1FTCA 4XIUA 5L1LA 2DR7A 1KHWA 5KT2A 3TAQA 4GO7X 3DLLQ 2UV8G 3S6EA 1NK9A 2HGNA 2UUTA 4P7TA 3N6NA 1VQYA 1XR6A 3TO8A 3T9ZA 2DT9A 1U49A 5HMYA 1FA0A 4IFYA 2IRYA 4I56A 2AJQA 2WRMA 1RYRA 2CVIA 2PIIA 5CH7B 1Y5NB 2FUG9 4DV3F 1UKUA 2KVIA 3M6UA 2NR0A 4NLUA 1C1BA 2CQHA 2C3OA 3KKFA 2Q79A 3QGPA 1RT4B 4N77A 4DSLA 2KFZA 1IR0A 3P5TL 4TYAA 2BV3A 2UUAF 5FD1A 3MEDB 4A4JA 5E3PA 4MK9A 2KT3A 4ED1A 3GIIA 2NREA 3IFEA 2ZH5A 1SL2A 4RU9A 4JV5F 1NEEA 2XSFA 2FJDB 5CCMA 1ZAWA 4BBYA 2B4OA 5I3UB 1XMOF 1H0HB 1RT5A 4LSNA 3VCDA 4DL0C 4DOZA 2D3OR 3TAPA 2AYBA 3CDAA 3N6LA 1FJCA 1PO6A 3RR8A 3RW6A 4X4VA 2W4PA 3GSDA 1KLMA 2M8DB 3FVYA 2DHXA 4I2PA 4KRWA 2HS3A 3MI7X 4CTAB 5EUHA 4YEAA 3GB0A 3DDNA 3Q2SC 3TA0A 3K5PA 4NLQA 2PI4A 4ED0A 4E0DA 1K1SA 5AXMA 2AYMA 3EGZA 4WZMA 3LP0B 2XY7A 2IBOA 3H2LA 3KLGB 5DG7A 2G4BA 5G0RB 2VBYA 1UVNA 3ZZ0A 4DJBA 2AGOA 2BE2B 3CJ5A 1PC5A 2J9EA 1IKYB 1HI0P 3TA1A 2WSEC 3DHXA 4FXDA 1RTIA 4C11B 1JNRB 1Y7PA 5THWA 1D8ZA 1JLAA 4DX8H 4CIOA 1QAIA 1HFEL 2HNYB 2J0SD 1RT2A 4PR6A 1T02A 2UVRA 3G71S 4X4QA 1HNVB 2HIQA 2KTQA 2JVOA 3G96A 1I6JA 2EFVA 2GIRA 2J6UA 2R4FA 4H54A 4D3GA 1QTMA 4FYDA 3LANA 2EG1A 4FF1A 4K5RA 4KE5A 4KHRA 4OJHA 1XNQF 2YH1A 5HQ8A 2DNGA 3HVWA 1P1LA 3I0RB 4OHWA 4HLBA 4CO5A 2NXUA 5M2PA 3LUYA 2OPQA 4O3PA 3QGGA 4WXOA 4ZK7M 4H4MA 4IQMA 2JSXA 4KBIA 1H2UX 3MHYA 3BSAA 5H1SV 1F9FA 3EPIA 2Q6BA 4DFJA 4NCAA 1HARA 2KT2A 1CC7A 3QO9B 4RNHA 4XK8C 1RGVA 4JYAF 1KFDA 4MIBA 4TY9A 5GMKa 2VQEF 2WSCC 2CPDA 2MKKA 3GG1A 2KXFA 4KV8B 4NLDA 4ZVGA 2LEBA 3NNHA 2F8EX 3K7RA 4X65F 3OL7A 2IMWP 3THPA 1LV5A 2IM2A 1ZTTA 4YMEA 4YR0A 3HK2A 3N9UC 1HA1A 1NJZA 2BA9A 4Z2XA 4DL6A 1VMBA 1VHFA 4IG0A 1BQNA 1HL6A 4A8YA 3I56S 1FE0A 3G8QA 4W90B 2CQPA 1D0EA 5EGYA 1X9SA 1JNZB 4BHQA 4C8OA 3O1LA 2HMIA 2O5DA 1Y9OA 5AXLA 4X66F 3KLIB 3K2YA 2HYIB 2HNZB 3BSCA 2V4QA 2HFNA 2UUCF 2OD4A 3P96A 4QQBA 3IRXB 4Q7AA 1Z2ZA 5KAKA 3MGJA 4K4SA 4CH0S 2XMVA 2DNRA 1S79A 1UJ5A 1NAQA 1Q86T 2E9ZA 1SBRA 2VOPA 2JEJA 1KQFB 3QJJA 1RTDB 1S99A 1C0UA 1DURA 1JMTA 2VPWB 3CGIA 3H2VE 4YDDB 3J81Y 4UQGA 1TFWA 3SFGA 4QIEA 5E7OB 2I5JB 5JXSA 2MMYA 2RU3A 2UVVA 3VAMA 4FS2A 3KYLA 4PWDA 4Q5VA 1TL3B 1BY9A 1V3ZA 1Y3KA 1TAUA 3OFEA 2FJEB 2GHVC 4JI1F 2CPEA 2LQBA 1LW2B 2LXFA 2BUNA 5HP1B 4HH0A 4KGKA 4F26A 3H8YA 3AH6A 3EZUA 5HMZA 5KFXA 1UFWA 3TANA 3CPWR