7GSPA

Ribonuclease t1/2',3'-cgps, non-productive
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Hydrolysis of a slow cyclic thiophosphate substrate of RNase T1 analyzed by time-resolved crystallography.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Endoribonuclease
total genus 27
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 7gspA00
1R4YA 1RNBA 1DE3A 1BRSA 1FUTA 1LRAA 1UCLA 1RMSA 1BNJA 1RGCA 2RBIA 1BSBA 1GOYA 3HOHA 4HOHA 1JBTA 3BU4A 2F5WA 2HOHA 1PYLA 1GMQA 1I70A 1BUJA 2KAAA 1BGSA 1X1UA 2KF5A 1RGFA 1RTUA 1BNFA 1RN4A 1B2XA 1BU4A 2GSPA 1UCKA 1BRIA 1RGAA 1RLSA 1RHLA 1B2SA 1Q9EA 5GSPA 1RCKA 3DGYA 4BIRA 1B20A 3A5EA 1RDSA 3AHWA 1X1XA 2KF3A 1BAOA 1TRQA 1RN1A 7RNTA 1BSCA 1FYSA 1RNTA 2F4YA 3WHOA 1RGEA 1JBSA 1B2MA 1JBRA 1I3FA 1UCIA 3D5GA 7GSPA 8RNTA 1HZ1A 3DH2A 3AGOA 1FUSA 2KF6A 1SARA 1X1WA 1TTOA 2F5MA 1I3IA 1B3SA 1BNEA 1LOYA 1GMRA 1YNVX 3GSPA 1RGLA 3URPA 1GSPA 2AAEA 1BSDA 1BRJA 2BU4A 3RNTA 1BANA 5BU4A 1I0VA 1X1YA 1BVIA 1GMPA 4BU4A 1I2EA 4J5KA 2KF4A 1CH0A 1AY7A 1RGHA 1C54A 1MGRA 1RCLA 3AHSA 1LNIA 3AGNA 1I0XA 1TRPA 1LOVA 1BIRA 1BNGA 1I8VA 3D4AA 2C4BA 2SARA 6GSPA 1BNSA 1T2IA 1YVSA 9RNTA 4GHOA 1T2HA 5BIRA 1BNIA 1PY3A 1B2ZA 1B2UA 1RGGA 3BIRA 1A2PA 1AQZA 3WR2A 1GOUA 1I2GA 1IYYA 2ZA4A 3KCHA 1LOWA 1YGWA 1B21A 5HOHA 1DETA 1FZUA 3D5IA 1ZGXA 1BSAA 1G02A 1B27A 1I2FA 1BNRA 1BRGA 1HYFA 1GOVA 1RSNA 1BRKA 4RNTA 2RNTA 2BIRA 6RNTA 4HAAA 4GSPA 1BOXA 1MGWA 1FW7A 3Q3FA 1UCJA 1BRNL 2AADA 1BSEA 1RGKA 2F56A 1BRHA 5RNTA 3SYUA 4J5GA
chains in the Genus database with same CATH superfamily
5KP4A 1QVF2 2H0GA 1FUTA 2XGLA 1DMMA 3DY5A 2OQEA 4J8TA 3F9SA 3SXXA 4RZMA 2RBIA 4KFFA 4CDLA 1EQKA 2KCDA 3F7XA 3NX0A 5BVBA 3CNMA 4N6LA 2BT3A 3BU4A 3J7Yd 3KZTA 3PGBA 1IT8A 3QRDA 1IQ8A 3O8YA 2K54A 1GMQA 1BUJA 1W2ZA 4BTYA 1VQ43 4BL2A 3NV0A 2D42A 1A2VA 1V57A 3K7CA 1RGFA 3GWRA 1RTUA 3BNBA 1UGHI 3F40A 4HM7B 1M9GA 2O9UX 2UUGC 1OCVA 4LGQA 3JUQA 1LVNA 3NXJA 1WNHA 3MG3A 3GZXB 3LTBA 1STFI 3HK4A 2B24B 1IV7A 3FZWA 1ZO2A 1F8NA 1B20A 1RKYA 4K1UA 1X1XA 3MSOA 1NU3A 1TRQA 1IV9A 1EUIC 1E97A 4N6TA 5A0OB 2QEX3 1AVKA 1FYSA 2XH9A 3BNEA 1ROAA 2R4IA 3PCSA 3WHOA 1T3BA 1YIJ3 1KC84 1M1K4 8RNTA 2OOVA 3DH2A 3AGOA 1KD14 4XBYA 2WOHA 1FUSA 2KF6A 5DRVA 1FUWA 3SOYA 1S5AA 2CWVA 1CYUA 1FGOA 1VQ83 1KWIA 3LTDA 1BNEA 3URPA 1YNVX 2R41A 1UI8A 1GSPA 2BU4A 3BNCA 3MYTA 3V92A 1BANA 3NBRA 4XDWA 3KKGA 1X1YA 2QIYA 1I2EA 4N6OB 2SBLA 3LTCA 4AEQA 1BIRA 1BNGA 2HMJB 3D4AA 1YJW3 3WA3A 1A67A 2RFRA 4L7KA 6GSPA 3CC43 3NBJA 4O3VA 5AEWB 1DMQA 1LXEA 3X41A 2H0HA 3CCL3 2L4VA 3D9RA 3EQQB 1T2HA 4HM8B 2PZVA 1N8R4 2RCDA 3LTAA 2MC8A 1B2UA 2XSOB 2GEXA 1M1XB 2FXTA 3CPOA 3OWYA 3G16A 1VZZA 1OPYA 3EB8A 3WDGB 2W9PA 2CG0A 1DYUA 1B21A 1FZUA 5JPUA 3OXAA 3CCE3 2INXA 5LC6A 1JN5B 1JZDA 2W2CA 1ZGXA 1R4CA 1G02A 1T5YA 3IPTA 2RSXA 1EA2A 1QJGA 3JUNA 1RSNA 4FR9A 1DMNA 1OH0A 2P38A 1IVVA 4RNTA 4XDVA 4AKYA 2Y74A 3EBYA 3RGRA 1US1A 3NQYA 1FW7A 4BTWA 1G0TA 2ZDJA 3WOEB 2WO0A 2AADA 2ZL8A 3H51A 2HMMB 4MMZB 2CW9A 2CFGA 1ROVA 3MPHA 1RNBA 1O7HB 1DE3A 2UGIA 1LRAA 3F8HA 3SLUA 1YIT3 1Q814 2QGUA 4KT3B 5IW9A 3PCRA 1NB5I 3VSYA 2CFDA 1BSBA 3I0YA 1PFPA 5STDA 2CX0A 1A2KA 4HZ9B 5FGOA 4EW5A 4XBTA 3NBBA 3EE1A 3FG3A 4RNYA 3HOHA 3U1WA 1JBTA 1NWWA 4HVNA 1HKXA 2GU1A 4J9AA 2HOHA 1PYLA 3DUKA 3HIIA 5BXQA 3CU3A 1OHPA 1TP6A 4I4KA 4L8PA 1BGSA 1FGTA 3EBTA 2KF5A 3ROBA 4N6MA 4OUQA 3JUMA 1Q824 1TIJA 1J2BA 3EN8A 1B2XA 1BU4A 2XSHB 4BTXA 1W01A 4LZIA 1NB3I 3WA2X 1V74A 1BRIA 1OF5B 1IVXA 1RLSA 5EQLA 1MWUA 5M1AA 3MG2A 1Q9EA 4RNZA 5GSPA 2W0QA 1RCKA 4CJNA 1YHQ3 4FCJA 1TFKA 4WP5A 4BIRA 1VQ53 1ULIB 1SQWA 3A5EA 1GD4A 3AHWA 3T8NA 1S723 2OOVC 4NHFA 4WYKB 4MJDA 2CX1A 3GZRA 1EKMA 3FF2A 2XRXB 1OF5A 2IA7A 3KE7A 3CCJ3 1JBSA 3FLJA 1B2MA 1JBRA 4STDA 1IVWA 1JNQA 1LQGC 1QMAA 4CPKA 1Y4KA 1HZ1A 1VQP3 3MG1A 2CG1A 2BO9B 1YI23 5AIGA 2I9WA 1TTOA 2XFTA 2GEYA 3EC9A 3EF8A 1JZOA 1B3SA 2P0XA 4IIAA 1NO3A 3ZFZA 3JUOA 4R4KA 3LT9A 2AAEA 1BRJA 2HMOB 3CXC2 3JUPA 1OGXA 2Z6BA 3HI7A 2WGQA 2YFLB 3F7SA 4CCVA 1Q7Y4 3RGAA 1SJWA 1CH0A 1GD3A 1RGHA 1W2B2 1C54A 1JV2B 4LSOA 2E2TA 3AGNA 1I0XA 3LT8A 1LOVA 2P0MA 3GZYB 1OUNA 5AIIA 3I553 3HIGA 3KIIA 5AIHA 3X42A 3KN4A 1T2IA 1YVSA 2RGQA 5M18A 3VGNA 4WHAA 4ORLA 1GY5A 2Z77A 3DZLA 2F86B 3T8UA 4HM2B 4O2HA 4AKZA 5IG4A 5JBSA 1RGGA 2GU3A 3STDA 1A2PA 1AQZA 4EC6A 3FCSB 1IYYA 1JJ22 2STDA 1G96A 1BUQA 3D79A 2CC3A 1OHSA 1PU4A 2IYJA 4NPBA 2IUJA 1LOWA 1WMPA 3K63A 2OTL3 3FKAA 3G713 1K8A4 3D5IA 3BLZA 2ZHXB 1VQO3 1JRQA 1ZX2A 1OGZA 1BSAA 2A15A 3EJVA 3IMAB 4FCMA 4O02B 1HYFA 1SIIA 1SPUA 2GBXB 3BB9A 1YJ93 2KXGA 4R1KA 3G8ZA 3I563 4RBNA 5G1LA 5IG0A 4BL3A 2BIRA 5CXOA 3SX1A 5ELUA 1W02A 2JDIH 4GSPA 3RDEA 3U97A 1QVG2 2OCTA 1VQN3 3CCS3 5CK6A 1IVUA 3S5CA 1MNLA 4K61A 6STDA 4K1VA 5IG5A 1KSIA 4N6UA 1RGKA 2K0MA 1QAKA 1Q40B 4J5GA 1RRHA 1R4YA 3FF0A 3CCR3 5D81A 1BRSA 1VQQA 1UCLA 1IK3A 1RMSA 1C7HA 3WOFB 1AV4A 5AI1A 3X3XA 4IT7A 3G0KA 1N5PA 4XBXA 1JB2A 1ZS7A 2B1XB 1VQ93 4NREA 1Q40A 1GOYA 1MWRA 1UGIA 2IMJA 2F5WA 2D1WA 3PZWA 1CEWI 1W6CA 5HGRA 5I97A 3NM7A 2F98A 1I70A 3DGNA 3N8BA 1O7NB 1HU9A 3N9HA 3OX9A 1JN5A 3A76A 4FMAA 4EYCA 3F8XA 4IPBA 4HZBB 3DGOA 5ELJA 3LYGA 4HJLB 2GXFA 1BNFA 1MOLA 1RN4A 3FG4A 1N9EA 2P09A 1QALA 5KP1A 1LNHA 3PS8A 4R9LA 3EHCA 1GYBA 4KFEA 4HM0B 1RGAA 3LOYA 5JPPA 2XGNA 2YFJB 2Z76A 4WWUC 2UX0A 1K28A 3TDGA 3UL5A 1E3VA 3MHEA 4X2HA 2KF3A 2ML6A 4Q53A 4JF8A 4H3UA 1FGQA 1BSCA 2F4YA 1WMNA 2MF7A 1K734 5LC7A 1N9JA 1W4NA 3KFQC 5EEOA 1I3FA 1UCIA 4MEIA 3B8LA 4HBRA 4X2OA 3DGLA 5IERA 2HMLB 3SOAA 1SARA 3MWZA 4JRFA 4DKIA 1V58A 8CHOA 1FGRA 2F5MA 2FNQA 4KZ1A 4MMXB 1I3IA 3SEDA 1Q7HA 4FMBA 3LXUX 4LEHA 1I0VA 1QAFA 3QK9A 3CCV3 4XB5A 3LMLA 1N5HA 4HYZA 2K3DA 3G6E3 1AY7A 4GB5A 2CK3H 2L1SA 1YVBI 1RCLA 3AHSA 1D6UA 2GBWB 5IF6A 4LMIA 1UDII 2QA43 2C4BA 1M904 4GL6A 2FGTA 2SARA 5G1KA 4HM1B 1OHOA 5D82A 3UB1A 3ZG5A 1NNVA 3FSDA 3LZAA 3ZG0A 1ISKA 4GHOA 5BIRA 1VQ73 2HMKB 1ULJB 1BNIA 1FGMA 1OACA 3FG1A 3D3LA 1PY3A 1B2ZA 4WYKA 4XM4A 1D6ZA 1GOUA 2BNGA 2Y73A 2O3OA 1VQM3 2ZA4A 4ZM8A 1RN7A 2CFWA 1TUHA 3S29A 2CKFB 3L0RA 3K5TA 4K90B 1Z1SA 1EG9B 4N6V0 3PYJA 3NV0B 4H61A 1Q42A 3OWSA 1I2FA 3MKIA 4FMDA 1YGEA 1LOXA 1WMOA 5EVHA 1RRLA 5G2GA 2W03A 5AYSC 4EBGA 2Q07A 5TGNA 4HAAA 2H0IA 2CFLA 1W00A 4OK0A 1BOXA 3BNDA 4HM4B 3Q3FA 3WODG 4R80A 1VQL3 1UCJA 2CWTA 2WGOA 2YX9A 1BSEA 3EX9A 3CNXA 3UNLA 2F56A 1BRHA 3NM2A 1MWTA 1MWSA 3SYUA 4KFDA 4FMCA 1O7MB 1TJDA 2BMOB 1IT7A 1BNJA 1D6YA 2E2UA 2CIUA 1O7WB 4U13A 5D83A 1RGCA 1SIHA 1W7CA 1LQMB 3ALAA 5AEUB 4QWTA 1W6YA 3V98A 1GY7A 2W6JH 3GRDA 1FA3A 2CHCA 3HZPA 1IQXA 1TFOA 4HOHA 7STDA 4EV5A 1KQS2 1DVCA 1U8CB 3DMCA 3K0ZA 3JVCA 3CMA3 3Q90A 4HM3B 1K9M4 2KAAA 2CFKA 3ER7A 1X1UA 2E2VA 1W6GA 4HKVB 2WOFA 1CQSA 2XR8B 1WQLB 1UUVB 2KRTA 1U5OA 2GSPA 4WFOA 3NUVA 1UCKA 4R9KA 5IEOA 1E3RA 3K9MC 4FCZA 3S27A 3DGMA 1JB4A 4LYLB 1RHLA 4N3VA 3OWUA 1K41A 1B2SA 2C11A 5CF1A 3DGYA 3CCU3 1NJI4 3F14A 1RDSA 4L8OA 3Q2PA 5AIFA 4TX4A 1BAOA 4PEJA 1N8QA 1RN1A 7RNTA 1GY6A 1RNTA 3DM8A 3B4PA 1RGEA 1UW1A 5AYRB 3B7CA 1UI7A 2XF3A 1NDOB 3D5GA 3WMDA 7GSPA 2OTJ3 3GZBA 3VF1A 3X3YA 1X1WA 1DVDA 3CCQ3 4ILFA 4EXRA 1LOYA 3OV4A 1GMRA 2BHMA 3GSPA 1RGLA 2IY2A 3M8CA 5CLKA 3UL6A 3RNTA 1BSDA 2YFIB 3X40A 4HM5B 5BU4A 1EEJA 3ECFA 5IEPA 1CYVA 1BVIA 3FGYA 1GMPA 5KP3A 2BMRB 3X3ZA 4BU4A 1IU7A 2W04A 1YJN3 4J5KA 2OWPA 3IJEB 2KF4A 2IUKA 1W5ZA 3SVAA 3EN1B 1AVLA 1MGRA 3Q1CA 1LNIA 1TRPA 3CPW2 1JKGB 1I8VA 3GAXA 4I5QA 1WTHA 3G4S3 4O8SA 4MMYB 1A90A 4EV2A 3CD63 3AMOB 1BNSA 5IG3A 2J8XB 3E99A 9RNTA 2BMQB 2C10A 2F99A 2LQVA 3S67A 5M19A 3CC73 2XFSA 2ML5A 5CF2A 3H3HA 2P05A 3B4OA 5IENA 1IDPA 1JKGA 2OQEC 1TU5A 3BIRA 4G1MB 3WR2A 1I2GA 3UJMA 2LYXA 5FW5A 3AMOA 1UUGB 3KCHA 1YGWA 2JQ5A 2Z7AA 1DETA 5HOHA 1ASKA 2M7OA 1B27A 2W56B 5DREA 1AR0A 3NQZA 2CWUA 1VQ63 2W9QA 1BNRA 1BRGA 1GS3A 3OW22 1GOVA 3DXOA 3LH4A 3CCM3 3KSPA 4KVHA 1VQK3 3HX8A 1BRKA 3S28A 1O7GB 2CH9A 1L5GB 1O7PB 2RNTA 3FH1A 3KSED 1RJOA 1UUWB 3PXMA 6RNTA 2XEPA 1MGWA 2V1LA 2W56A 3T0UA 3CME3 4N6NB 1IQYA 4OVMA 1STDA 2HMNB 1BRNL 1JB5A 3NHXA 3V99A 3CC23 5RNTA 3N54B 1Q864 4HM6B 2PNCA
chains in the Genus database with same CATH topology
1R4YA 1RNBA 1DE3A 1BRSA 1FUTA 1LRAA 1UCLA 1RMSA 1BNJA 1RGCA 2RBIA 1BSBA 1GOYA 3HOHA 4HOHA 1JBTA 3BU4A 2F5WA 2HOHA 1PYLA 1GMQA 1I70A 1BUJA 2KAAA 1BGSA 1X1UA 2KF5A 1RGFA 1RTUA 1BNFA 1RN4A 1B2XA 1BU4A 2GSPA 1UCKA 1BRIA 1RGAA 1RLSA 1RHLA 1B2SA 1Q9EA 5GSPA 1RCKA 3DGYA 4BIRA 1B20A 3A5EA 1RDSA 3AHWA 1X1XA 2KF3A 1BAOA 1TRQA 1RN1A 7RNTA 1BSCA 1FYSA 1RNTA 2F4YA 3WHOA 1RGEA 1JBSA 1B2MA 1JBRA 1I3FA 1UCIA 3D5GA 7GSPA 8RNTA 1HZ1A 3DH2A 3AGOA 1FUSA 2KF6A 1SARA 1X1WA 1TTOA 2F5MA 1I3IA 1B3SA 1BNEA 1LOYA 1GMRA 1YNVX 3GSPA 1RGLA 3URPA 1GSPA 2AAEA 1BSDA 1BRJA 2BU4A 3RNTA 1BANA 5BU4A 1I0VA 1X1YA 1BVIA 1GMPA 4BU4A 1I2EA 4J5KA 2KF4A 1CH0A 1AY7A 1RGHA 1C54A 1MGRA 1RCLA 3AHSA 1LNIA 3AGNA 1I0XA 1TRPA 1LOVA 1BIRA 1BNGA 1I8VA 3D4AA 2C4BA 2SARA 6GSPA 1BNSA 1T2IA 1YVSA 9RNTA 4GHOA 1T2HA 5BIRA 1BNIA 1PY3A 1B2ZA 1B2UA 1RGGA 3BIRA 1A2PA 1AQZA 3WR2A 1GOUA 1I2GA 1IYYA 2ZA4A 3KCHA 1LOWA 1YGWA 1B21A 5HOHA 1DETA 1FZUA 3D5IA 1ZGXA 1BSAA 1G02A 1B27A 1I2FA 1BNRA 1BRGA 1HYFA 1GOVA 1RSNA 1BRKA 4RNTA 2RNTA 2BIRA 6RNTA 4HAAA 4GSPA 1BOXA 1MGWA 1FW7A 3Q3FA 1UCJA 1BRNL 2AADA 1BSEA 1RGKA 2F56A 1BRHA 5RNTA 3SYUA 4J5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4Y A;  1RNB A;  1DE3 A;  1BRS A;  1FUT A;  1LRA A;  1UCL A;  1RMS A;  1BNJ A;  1RGC A;  2RBI A;  1BSB A;  1GOY A;  3HOH A;  4HOH A;  1JBT A;  3BU4 A;  2F5W A;  2HOH A;  1PYL A;  1GMQ A;  1I70 A;  1BUJ A;  2KAA A;  1BGS A;  1X1U A;  2KF5 A;  1RGF A;  1RTU A;  1BNF A;  1RN4 A;  1B2X A;  1BU4 A;  2GSP A;  1UCK A;  1BRI A;  1RGA A;  1RLS A;  1RHL A;  1B2S A;  1Q9E A;  5GSP A;  1RCK A;  3DGY A;  4BIR A;  1B20 A;  3A5E A;  1RDS A;  3AHW A;  1X1X A;  2KF3 A;  1BAO A;  1TRQ A;  1RN1 A;  7RNT A;  1BSC A;  1FYS A;  1RNT A;  2F4Y A;  3WHO A;  1RGE A;  1JBS A;  1B2M A;  1JBR A;  1I3F A;  1UCI A;  3D5G A;  7GSP A;  8RNT A;  1HZ1 A;  3DH2 A;  3AGO A;  1FUS A;  2KF6 A;  1SAR A;  1X1W A;  1TTO A;  2F5M A;  1I3I A;  1B3S A;  1BNE A;  1LOY A;  1GMR A;  1YNV X;  3GSP A;  1RGL A;  3URP A;  1GSP A;  2AAE A;  1BSD A;  1BRJ A;  2BU4 A;  3RNT A;  1BAN A;  5BU4 A;  1I0V A;  1X1Y A;  1BVI A;  1GMP A;  4BU4 A;  1I2E A;  4J5K A;  2KF4 A;  1CH0 A;  1AY7 A;  1RGH A;  1C54 A;  1MGR A;  1RCL A;  3AHS A;  1LNI A;  3AGN A;  1I0X A;  1TRP A;  1LOV A;  1BIR A;  1BNG A;  1I8V A;  3D4A A;  2C4B A;  2SAR A;  6GSP A;  1BNS A;  1T2I A;  1YVS A;  9RNT A;  4GHO A;  1T2H A;  5BIR A;  1BNI A;  1PY3 A;  1B2Z A;  1B2U A;  1RGG A;  3BIR A;  1A2P A;  1AQZ A;  3WR2 A;  1GOU A;  1I2G A;  1IYY A;  2ZA4 A;  3KCH A;  1LOW A;  1YGW A;  1B21 A;  5HOH A;  1DET A;  1FZU A;  3D5I A;  1ZGX A;  1BSA A;  1G02 A;  1B27 A;  1I2F A;  1BNR A;  1BRG A;  1HYF A;  1GOV A;  1RSN A;  1BRK A;  4RNT A;  2RNT A;  2BIR A;  6RNT A;  4HAA A;  4GSP A;  1BOX A;  1MGW A;  1FW7 A;  3Q3F A;  1UCJ A;  1BRN L;  2AAD A;  1BSE A;  1RGK A;  2F56 A;  1BRH A;  5RNT A;  3SYU A;  4J5G A; 
#chains in the Genus database with same CATH topology
 5KP4 A;  1QVF 2;  2H0G A;  1FUT A;  2XGL A;  1DMM A;  3DY5 A;  2OQE A;  4J8T A;  3F9S A;  3SXX A;  4RZM A;  2RBI A;  4KFF A;  4CDL A;  1EQK A;  2KCD A;  3F7X A;  3NX0 A;  5BVB A;  3CNM A;  4N6L A;  2BT3 A;  3BU4 A;  3J7Y d;  3KZT A;  3PGB A;  1IT8 A;  3QRD A;  1IQ8 A;  3O8Y A;  2K54 A;  1GMQ A;  1BUJ A;  1W2Z A;  4BTY A;  1VQ4 3;  4BL2 A;  3NV0 A;  2D42 A;  1A2V A;  1V57 A;  3K7C A;  1RGF A;  3GWR A;  1RTU A;  3BNB A;  1UGH I;  3F40 A;  4HM7 B;  1M9G A;  2O9U X;  2UUG C;  1OCV A;  4LGQ A;  3JUQ A;  1LVN A;  3NXJ A;  1WNH A;  3MG3 A;  3GZX B;  3LTB A;  1STF I;  3HK4 A;  2B24 B;  1IV7 A;  3FZW A;  1ZO2 A;  1F8N A;  1B20 A;  1RKY A;  4K1U A;  1X1X A;  3MSO A;  1NU3 A;  1TRQ A;  1IV9 A;  1EUI C;  1E97 A;  4N6T A;  5A0O B;  2QEX 3;  1AVK A;  1FYS A;  2XH9 A;  3BNE A;  1ROA A;  2R4I A;  3PCS A;  3WHO A;  1T3B A;  1YIJ 3;  1KC8 4;  1M1K 4;  8RNT A;  2OOV A;  3DH2 A;  3AGO A;  1KD1 4;  4XBY A;  2WOH A;  1FUS A;  2KF6 A;  5DRV A;  1FUW A;  3SOY A;  1S5A A;  2CWV A;  1CYU A;  1FGO A;  1VQ8 3;  1KWI A;  3LTD A;  1BNE A;  3URP A;  1YNV X;  2R41 A;  1UI8 A;  1GSP A;  2BU4 A;  3BNC A;  3MYT A;  3V92 A;  1BAN A;  3NBR A;  4XDW A;  3KKG A;  1X1Y A;  2QIY A;  1I2E A;  4N6O B;  2SBL A;  3LTC A;  4AEQ A;  1BIR A;  1BNG A;  2HMJ B;  3D4A A;  1YJW 3;  3WA3 A;  1A67 A;  2RFR A;  4L7K A;  6GSP A;  3CC4 3;  3NBJ A;  4O3V A;  5AEW B;  1DMQ A;  1LXE A;  3X41 A;  2H0H A;  3CCL 3;  2L4V A;  3D9R A;  3EQQ B;  1T2H A;  4HM8 B;  2PZV A;  1N8R 4;  2RCD A;  3LTA A;  2MC8 A;  1B2U A;  2XSO B;  2GEX A;  1M1X B;  2FXT A;  3CPO A;  3OWY A;  3G16 A;  1VZZ A;  1OPY A;  3EB8 A;  3WDG B;  2W9P A;  2CG0 A;  1DYU A;  1B21 A;  1FZU A;  5JPU A;  3OXA A;  3CCE 3;  2INX A;  5LC6 A;  1JN5 B;  1JZD A;  2W2C A;  1ZGX A;  1R4C A;  1G02 A;  1T5Y A;  3IPT A;  2RSX A;  1EA2 A;  1QJG A;  3JUN A;  1RSN A;  4FR9 A;  1DMN A;  1OH0 A;  2P38 A;  1IVV A;  4RNT A;  4XDV A;  4AKY A;  2Y74 A;  3EBY A;  3RGR A;  1US1 A;  3NQY A;  1FW7 A;  4BTW A;  1G0T A;  2ZDJ A;  3WOE B;  2WO0 A;  2AAD A;  2ZL8 A;  3H51 A;  2HMM B;  4MMZ B;  2CW9 A;  2CFG A;  1ROV A;  3MPH A;  1RNB A;  1O7H B;  1DE3 A;  2UGI A;  1LRA A;  3F8H A;  3SLU A;  1YIT 3;  1Q81 4;  2QGU A;  4KT3 B;  5IW9 A;  3PCR A;  1NB5 I;  3VSY A;  2CFD A;  1BSB A;  3I0Y A;  1PFP A;  5STD A;  2CX0 A;  1A2K A;  4HZ9 B;  5FGO A;  4EW5 A;  4XBT A;  3NBB A;  3EE1 A;  3FG3 A;  4RNY A;  3HOH A;  3U1W A;  1JBT A;  1NWW A;  4HVN A;  1HKX A;  2GU1 A;  4J9A A;  2HOH A;  1PYL A;  3DUK A;  3HII A;  5BXQ A;  3CU3 A;  1OHP A;  1TP6 A;  4I4K A;  4L8P A;  1BGS A;  1FGT A;  3EBT A;  2KF5 A;  3ROB A;  4N6M A;  4OUQ A;  3JUM A;  1Q82 4;  1TIJ A;  1J2B A;  3EN8 A;  1B2X A;  1BU4 A;  2XSH B;  4BTX A;  1W01 A;  4LZI A;  1NB3 I;  3WA2 X;  1V74 A;  1BRI A;  1OF5 B;  1IVX A;  1RLS A;  5EQL A;  1MWU A;  5M1A A;  3MG2 A;  1Q9E A;  4RNZ A;  5GSP A;  2W0Q A;  1RCK A;  4CJN A;  1YHQ 3;  4FCJ A;  1TFK A;  4WP5 A;  4BIR A;  1VQ5 3;  1ULI B;  1SQW A;  3A5E A;  1GD4 A;  3AHW A;  3T8N A;  1S72 3;  2OOV C;  4NHF A;  4WYK B;  4MJD A;  2CX1 A;  3GZR A;  1EKM A;  3FF2 A;  2XRX B;  1OF5 A;  2IA7 A;  3KE7 A;  3CCJ 3;  1JBS A;  3FLJ A;  1B2M A;  1JBR A;  4STD A;  1IVW A;  1JNQ A;  1LQG C;  1QMA A;  4CPK A;  1Y4K A;  1HZ1 A;  1VQP 3;  3MG1 A;  2CG1 A;  2BO9 B;  1YI2 3;  5AIG A;  2I9W A;  1TTO A;  2XFT A;  2GEY A;  3EC9 A;  3EF8 A;  1JZO A;  1B3S A;  2P0X A;  4IIA A;  1NO3 A;  3ZFZ A;  3JUO A;  4R4K A;  3LT9 A;  2AAE A;  1BRJ A;  2HMO B;  3CXC 2;  3JUP A;  1OGX A;  2Z6B A;  3HI7 A;  2WGQ A;  2YFL B;  3F7S A;  4CCV A;  1Q7Y 4;  3RGA A;  1SJW A;  1CH0 A;  1GD3 A;  1RGH A;  1W2B 2;  1C54 A;  1JV2 B;  4LSO A;  2E2T A;  3AGN A;  1I0X A;  3LT8 A;  1LOV A;  2P0M A;  3GZY B;  1OUN A;  5AII A;  3I55 3;  3HIG A;  3KII A;  5AIH A;  3X42 A;  3KN4 A;  1T2I A;  1YVS A;  2RGQ A;  5M18 A;  3VGN A;  4WHA A;  4ORL A;  1GY5 A;  2Z77 A;  3DZL A;  2F86 B;  3T8U A;  4HM2 B;  4O2H A;  4AKZ A;  5IG4 A;  5JBS A;  1RGG A;  2GU3 A;  3STD A;  1A2P A;  1AQZ A;  4EC6 A;  3FCS B;  1IYY A;  1JJ2 2;  2STD A;  1G96 A;  1BUQ A;  3D79 A;  2CC3 A;  1OHS A;  1PU4 A;  2IYJ A;  4NPB A;  2IUJ A;  1LOW A;  1WMP A;  3K63 A;  2OTL 3;  3FKA A;  3G71 3;  1K8A 4;  3D5I A;  3BLZ A;  2ZHX B;  1VQO 3;  1JRQ A;  1ZX2 A;  1OGZ A;  1BSA A;  2A15 A;  3EJV A;  3IMA B;  4FCM A;  4O02 B;  1HYF A;  1SII A;  1SPU A;  2GBX B;  3BB9 A;  1YJ9 3;  2KXG A;  4R1K A;  3G8Z A;  3I56 3;  4RBN A;  5G1L A;  5IG0 A;  4BL3 A;  2BIR A;  5CXO A;  3SX1 A;  5ELU A;  1W02 A;  2JDI H;  4GSP A;  3RDE A;  3U97 A;  1QVG 2;  2OCT A;  1VQN 3;  3CCS 3;  5CK6 A;  1IVU A;  3S5C A;  1MNL A;  4K61 A;  6STD A;  4K1V A;  5IG5 A;  1KSI A;  4N6U A;  1RGK A;  2K0M A;  1QAK A;  1Q40 B;  4J5G A;  1RRH A;  1R4Y A;  3FF0 A;  3CCR 3;  5D81 A;  1BRS A;  1VQQ A;  1UCL A;  1IK3 A;  1RMS A;  1C7H A;  3WOF B;  1AV4 A;  5AI1 A;  3X3X A;  4IT7 A;  3G0K A;  1N5P A;  4XBX A;  1JB2 A;  1ZS7 A;  2B1X B;  1VQ9 3;  4NRE A;  1Q40 A;  1GOY A;  1MWR A;  1UGI A;  2IMJ A;  2F5W A;  2D1W A;  3PZW A;  1CEW I;  1W6C A;  5HGR A;  5I97 A;  3NM7 A;  2F98 A;  1I70 A;  3DGN A;  3N8B A;  1O7N B;  1HU9 A;  3N9H A;  3OX9 A;  1JN5 A;  3A76 A;  4FMA A;  4EYC A;  3F8X A;  4IPB A;  4HZB B;  3DGO A;  5ELJ A;  3LYG A;  4HJL B;  2GXF A;  1BNF A;  1MOL A;  1RN4 A;  3FG4 A;  1N9E A;  2P09 A;  1QAL A;  5KP1 A;  1LNH A;  3PS8 A;  4R9L A;  3EHC A;  1GYB A;  4KFE A;  4HM0 B;  1RGA A;  3LOY A;  5JPP A;  2XGN A;  2YFJ B;  2Z76 A;  4WWU C;  2UX0 A;  1K28 A;  3TDG A;  3UL5 A;  1E3V A;  3MHE A;  4X2H A;  2KF3 A;  2ML6 A;  4Q53 A;  4JF8 A;  4H3U A;  1FGQ A;  1BSC A;  2F4Y A;  1WMN A;  2MF7 A;  1K73 4;  5LC7 A;  1N9J A;  1W4N A;  3KFQ C;  5EEO A;  1I3F A;  1UCI A;  4MEI A;  3B8L A;  4HBR A;  4X2O A;  3DGL A;  5IER A;  2HML B;  3SOA A;  1SAR A;  3MWZ A;  4JRF A;  4DKI A;  1V58 A;  8CHO A;  1FGR A;  2F5M A;  2FNQ A;  4KZ1 A;  4MMX B;  1I3I A;  3SED A;  1Q7H A;  4FMB A;  3LXU X;  4LEH A;  1I0V A;  1QAF A;  3QK9 A;  3CCV 3;  4XB5 A;  3LML A;  1N5H A;  4HYZ A;  2K3D A;  3G6E 3;  1AY7 A;  4GB5 A;  2CK3 H;  2L1S A;  1YVB I;  1RCL A;  3AHS A;  1D6U A;  2GBW B;  5IF6 A;  4LMI A;  1UDI I;  2QA4 3;  2C4B A;  1M90 4;  4GL6 A;  2FGT A;  2SAR A;  5G1K A;  4HM1 B;  1OHO A;  5D82 A;  3UB1 A;  3ZG5 A;  1NNV A;  3FSD A;  3LZA A;  3ZG0 A;  1ISK A;  4GHO A;  5BIR A;  1VQ7 3;  2HMK B;  1ULJ B;  1BNI A;  1FGM A;  1OAC A;  3FG1 A;  3D3L A;  1PY3 A;  1B2Z A;  4WYK A;  4XM4 A;  1D6Z A;  1GOU A;  2BNG A;  2Y73 A;  2O3O A;  1VQM 3;  2ZA4 A;  4ZM8 A;  1RN7 A;  2CFW A;  1TUH A;  3S29 A;  2CKF B;  3L0R A;  3K5T A;  4K90 B;  1Z1S A;  1EG9 B;  4N6V 0;  3PYJ A;  3NV0 B;  4H61 A;  1Q42 A;  3OWS A;  1I2F A;  3MKI A;  4FMD A;  1YGE A;  1LOX A;  1WMO A;  5EVH A;  1RRL A;  5G2G A;  2W03 A;  5AYS C;  4EBG A;  2Q07 A;  5TGN A;  4HAA A;  2H0I A;  2CFL A;  1W00 A;  4OK0 A;  1BOX A;  3BND A;  4HM4 B;  3Q3F A;  3WOD G;  4R80 A;  1VQL 3;  1UCJ A;  2CWT A;  2WGO A;  2YX9 A;  1BSE A;  3EX9 A;  3CNX A;  3UNL A;  2F56 A;  1BRH A;  3NM2 A;  1MWT A;  1MWS A;  3SYU A;  4KFD A;  4FMC A;  1O7M B;  1TJD A;  2BMO B;  1IT7 A;  1BNJ A;  1D6Y A;  2E2U A;  2CIU A;  1O7W B;  4U13 A;  5D83 A;  1RGC A;  1SIH A;  1W7C A;  1LQM B;  3ALA A;  5AEU B;  4QWT A;  1W6Y A;  3V98 A;  1GY7 A;  2W6J H;  3GRD A;  1FA3 A;  2CHC A;  3HZP A;  1IQX A;  1TFO A;  4HOH A;  7STD A;  4EV5 A;  1KQS 2;  1DVC A;  1U8C B;  3DMC A;  3K0Z A;  3JVC A;  3CMA 3;  3Q90 A;  4HM3 B;  1K9M 4;  2KAA A;  2CFK A;  3ER7 A;  1X1U A;  2E2V A;  1W6G A;  4HKV B;  2WOF A;  1CQS A;  2XR8 B;  1WQL B;  1UUV B;  2KRT A;  1U5O A;  2GSP A;  4WFO A;  3NUV A;  1UCK A;  4R9K A;  5IEO A;  1E3R A;  3K9M C;  4FCZ A;  3S27 A;  3DGM A;  1JB4 A;  4LYL B;  1RHL A;  4N3V A;  3OWU A;  1K41 A;  1B2S A;  2C11 A;  5CF1 A;  3DGY A;  3CCU 3;  1NJI 4;  3F14 A;  1RDS A;  4L8O A;  3Q2P A;  5AIF A;  4TX4 A;  1BAO A;  4PEJ A;  1N8Q A;  1RN1 A;  7RNT A;  1GY6 A;  1RNT A;  3DM8 A;  3B4P A;  1RGE A;  1UW1 A;  5AYR B;  3B7C A;  1UI7 A;  2XF3 A;  1NDO B;  3D5G A;  3WMD A;  7GSP A;  2OTJ 3;  3GZB A;  3VF1 A;  3X3Y A;  1X1W A;  1DVD A;  3CCQ 3;  4ILF A;  4EXR A;  1LOY A;  3OV4 A;  1GMR A;  2BHM A;  3GSP A;  1RGL A;  2IY2 A;  3M8C A;  5CLK A;  3UL6 A;  3RNT A;  1BSD A;  2YFI B;  3X40 A;  4HM5 B;  5BU4 A;  1EEJ A;  3ECF A;  5IEP A;  1CYV A;  1BVI A;  3FGY A;  1GMP A;  5KP3 A;  2BMR B;  3X3Z A;  4BU4 A;  1IU7 A;  2W04 A;  1YJN 3;  4J5K A;  2OWP A;  3IJE B;  2KF4 A;  2IUK A;  1W5Z A;  3SVA A;  3EN1 B;  1AVL A;  1MGR A;  3Q1C A;  1LNI A;  1TRP A;  3CPW 2;  1JKG B;  1I8V A;  3GAX A;  4I5Q A;  1WTH A;  3G4S 3;  4O8S A;  4MMY B;  1A90 A;  4EV2 A;  3CD6 3;  3AMO B;  1BNS A;  5IG3 A;  2J8X B;  3E99 A;  9RNT A;  2BMQ B;  2C10 A;  2F99 A;  2LQV A;  3S67 A;  5M19 A;  3CC7 3;  2XFS A;  2ML5 A;  5CF2 A;  3H3H A;  2P05 A;  3B4O A;  5IEN A;  1IDP A;  1JKG A;  2OQE C;  1TU5 A;  3BIR A;  4G1M B;  3WR2 A;  1I2G A;  3UJM A;  2LYX A;  5FW5 A;  3AMO A;  1UUG B;  3KCH A;  1YGW A;  2JQ5 A;  2Z7A A;  1DET A;  5HOH A;  1ASK A;  2M7O A;  1B27 A;  2W56 B;  5DRE A;  1AR0 A;  3NQZ A;  2CWU A;  1VQ6 3;  2W9Q A;  1BNR A;  1BRG A;  1GS3 A;  3OW2 2;  1GOV A;  3DXO A;  3LH4 A;  3CCM 3;  3KSP A;  4KVH A;  1VQK 3;  3HX8 A;  1BRK A;  3S28 A;  1O7G B;  2CH9 A;  1L5G B;  1O7P B;  2RNT A;  3FH1 A;  3KSE D;  1RJO A;  1UUW B;  3PXM A;  6RNT A;  2XEP A;  1MGW A;  2V1L A;  2W56 A;  3T0U A;  3CME 3;  4N6N B;  1IQY A;  4OVM A;  1STD A;  2HMN B;  1BRN L;  1JB5 A;  3NHX A;  3V99 A;  3CC2 3;  5RNT A;  3N54 B;  1Q86 4;  4HM6 B;  2PNC A; 
#chains in the Genus database with same CATH homology
 1R4Y A;  1RNB A;  1DE3 A;  1BRS A;  1FUT A;  1LRA A;  1UCL A;  1RMS A;  1BNJ A;  1RGC A;  2RBI A;  1BSB A;  1GOY A;  3HOH A;  4HOH A;  1JBT A;  3BU4 A;  2F5W A;  2HOH A;  1PYL A;  1GMQ A;  1I70 A;  1BUJ A;  2KAA A;  1BGS A;  1X1U A;  2KF5 A;  1RGF A;  1RTU A;  1BNF A;  1RN4 A;  1B2X A;  1BU4 A;  2GSP A;  1UCK A;  1BRI A;  1RGA A;  1RLS A;  1RHL A;  1B2S A;  1Q9E A;  5GSP A;  1RCK A;  3DGY A;  4BIR A;  1B20 A;  3A5E A;  1RDS A;  3AHW A;  1X1X A;  2KF3 A;  1BAO A;  1TRQ A;  1RN1 A;  7RNT A;  1BSC A;  1FYS A;  1RNT A;  2F4Y A;  3WHO A;  1RGE A;  1JBS A;  1B2M A;  1JBR A;  1I3F A;  1UCI A;  3D5G A;  7GSP A;  8RNT A;  1HZ1 A;  3DH2 A;  3AGO A;  1FUS A;  2KF6 A;  1SAR A;  1X1W A;  1TTO A;  2F5M A;  1I3I A;  1B3S A;  1BNE A;  1LOY A;  1GMR A;  1YNV X;  3GSP A;  1RGL A;  3URP A;  1GSP A;  2AAE A;  1BSD A;  1BRJ A;  2BU4 A;  3RNT A;  1BAN A;  5BU4 A;  1I0V A;  1X1Y A;  1BVI A;  1GMP A;  4BU4 A;  1I2E A;  4J5K A;  2KF4 A;  1CH0 A;  1AY7 A;  1RGH A;  1C54 A;  1MGR A;  1RCL A;  3AHS A;  1LNI A;  3AGN A;  1I0X A;  1TRP A;  1LOV A;  1BIR A;  1BNG A;  1I8V A;  3D4A A;  2C4B A;  2SAR A;  6GSP A;  1BNS A;  1T2I A;  1YVS A;  9RNT A;  4GHO A;  1T2H A;  5BIR A;  1BNI A;  1PY3 A;  1B2Z A;  1B2U A;  1RGG A;  3BIR A;  1A2P A;  1AQZ A;  3WR2 A;  1GOU A;  1I2G A;  1IYY A;  2ZA4 A;  3KCH A;  1LOW A;  1YGW A;  1B21 A;  5HOH A;  1DET A;  1FZU A;  3D5I A;  1ZGX A;  1BSA A;  1G02 A;  1B27 A;  1I2F A;  1BNR A;  1BRG A;  1HYF A;  1GOV A;  1RSN A;  1BRK A;  4RNT A;  2RNT A;  2BIR A;  6RNT A;  4HAA A;  4GSP A;  1BOX A;  1MGW A;  1FW7 A;  3Q3F A;  1UCJ A;  1BRN L;  2AAD A;  1BSE A;  1RGK A;  2F56 A;  1BRH A;  5RNT A;  3SYU A;  4J5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...