7GSPA

Ribonuclease t1/2',3'-cgps, non-productive
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
molecule tags Endoribonuclease
source organism Aspergillus oryzae
publication title Hydrolysis of a slow cyclic thiophosphate substrate of RNase T1 analyzed by time-resolved crystallography.
pubmed doi rcsb
total genus 27
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 7gspA00
1BSCA 1RGEA 1BAOA 1RGCA 4J5KA 1LNIA 1BVIA 1GOYA 3RNTA 1RTUA 2GSPA 1I2FA 1RMSA 4BU4A 1B3SA 1G02A 2C4BA 1RCKA 1BIRA 1GOUA 4GHOA 1FUTA 1X1UA 1MGRA 1I3FA 2F56A 3GSPA 1YGWA 1BSAA 1RLSA 1I8VA 2F4YA 4BIRA 1AQZA 1AY7A 1BRKA 1LOVA 1LOWA 1RGLA 1UCKA 1X1YA 1X1WA 2SARA 1RGHA 1IYYA 3BIRA 1JBRA 4GSPA 1RN4A 3WR2A 1RGKA 3KCHA 4HOHA 1BRJA 3A5EA 3AHSA 5RNTA 2KF5A 1BGSA 3D5IA 5BU4A 1BOXA 3HOHA 2ZA4A 2F5WA 1B2UA 3AHWA 7GSPA 1BNEA 1LRAA 1MGWA 1BRSA 2BU4A 1B21A 1BNJA 2KF3A 1ZGXA 2KAAA 1BRNL 2RBIA 1GMRA 1RDSA 1UCLA 2F5MA 1JBSA 1TRPA 1C54A 3DH2A 1CH0A 2AAEA 1B2MA 1T2HA 1YVSA 4RNTA 1HYFA 1RGGA 1GMPA 2AADA 1PY3A 1I2EA 2KF4A 6GSPA 5HOHA 3URPA 3WHOA 1RNTA 2RNTA 1GMQA 1RSNA 1BNSA 1BRHA 1B2ZA 1BNGA 7RNTA 1I3IA 1TTOA 1FUSA 3AGOA 1RCLA 1B2XA 1HZ1A 3D4AA 1I2GA 6RNTA 1LOYA 1B2SA 1RNBA 1FYSA 3SYUA 1RHLA 1BNRA 1UCJA 1YNVX 1I0VA 1SARA 1GOVA 1BRIA 3DGYA 1I0XA 1UCIA 1RGFA 1BNFA 3D5GA 8RNTA 2BIRA 1JBTA 4HAAA 1FW7A 5BIRA 1RGAA 1A2PA 1R4YA 1BANA 1BSBA 1TRQA 2HOHA 1DE3A 1GSPA 1X1XA 5GSPA 1BU4A 1FZUA 1BRGA 2KF6A 1PYLA 1B20A 4J5GA 3AGNA 3Q3FA 1RN1A 1BNIA 3BU4A 1BUJA 1B27A 1Q9EA 1DETA 1T2IA 1I70A 9RNTA 1BSDA 1BSEA
chains in the Genus database with same CATH superfamily
1TUHA 1BSCA 2IY2A 2LQVA 2XF3A 1RGCA 4I4KA 2C10A 2GBXB 5AIFA 1DYUA 1RMSA 4BU4A 2F98A 1KD14 3MSOA 3F40A 3N9HA 3Q1CA 1F8NA 1G02A 2P0MA 3B4OA 3PZWA 5KP4A 4TX4A 1IVUA 1TFKA 2RCDA 4O3VA 2CX0A 1W2ZA 3F14A 4NREA 3SX1A 3X40A 4JF8A 4EV2A 7STDA 1O7HB 2V1LA 5HGRA 1WMOA 1BSAA 8CHOA 2BHMA 2BMOB 1HU9A 2F99A 4BIRA 1M1XB 1QJGA 3HIIA 5LC6A 1X1YA 1LOVA 4R9KA 3SLUA 5IG4A 1IYYA 4AKYA 1RKYA 1YJW3 1NB5I 2A15A 1JBRA 2CWVA 2QGUA 2XH9A 2R41A 3LH4A 4HM6B 1RN4A 5DRVA 1W02A 1W4NA 1SPUA 3JUPA 3K5TA 2W56A 5D83A 3G6E3 3G8ZA 4N6V0 2QA43 1YI23 5BVBA 1NJI4 3MG1A 1CYVA 3EBTA 5M19A 1B2UA 3HZPA 5I97A 1AR0A 3NM7A 1OPYA 4FR9A 1BNEA 1QMAA 3KKGA 3FF2A 1Q40A 1BRSA 1V57A 2HMOB 3DGLA 4RNZA 3FLJA 1OF5A 2XFSA 3B7CA 2H0IA 2IUKA 3CC23 2RSXA 1K734 3DZLA 2CWUA 1GYBA 3OWSA 4WFOA 3S28A 1N5PA 2PNCA 1EQKA 2FGTA 3DH2A 2GU1A 2AAEA 3F9SA 3JUMA 1B2MA 4K1UA 1T2HA 2Z7AA 4XBYA 3STDA 4WHAA 1IK3A 1RGGA 1GMPA 2AADA 4BL2A 1SJWA 1VQQA 3CPOA 1JNQA 3LTBA 1YIJ3 3ALAA 3GZXB 3CXC2 1BNSA 1BRHA 3G0KA 3NV0B 3SEDA 3B4PA 1BNGA 4BTXA 7RNTA 2UUGC 1Z1SA 3NBJA 1M9GA 3N54B 1RCLA 5AIIA 1OGXA 3D4AA 1K9M4 2D1WA 2W9QA 6RNTA 3PXMA 3WOFB 3EC9A 1QAFA 3BNDA 1RNBA 5KP1A 3I553 3PCSA 1V74A 1RHLA 1D6YA 4LMIA 1JV2B 1I0VA 4FCJA 1O7MB 1K28A 2KXGA 1FGMA 2CX1A 2ZHXB 3N8BA 1BNFA 5AI1A 2FNQA 2O9UX 3NBRA 3PGBA 2BIRA 5EVHA 5G1LA 2I9WA 8RNTA 3X41A 3FSDA 5A0OB 5BIRA 1DMMA 2E2VA 2GU3A 3QRDA 4N6TA 1ISKA 1OUNA 1RJOA 4IT7A 4FCZA 4LSOA 2BNGA 3DGMA 4WWUC 2BO9B 2HMNB 4J8TA 4ORLA 3CMA3 1ROVA 4R80A 2Z6BA 4GL6A 1QVG2 1VQ43 1BRGA 1E97A 2P38A 4STDA 5M1AA 2O3OA 3D9RA 1Q7HA 5EEOA 3CCV3 3WOEB 1CQSA 4LZIA 1Q9EA 1GS3A 1RN7A 1DETA 2STDA 4DKIA 4EYCA 3CD63 1T2IA 3MKIA 1OF5B 2GXFA 1I70A 1EA2A 2XSHB 4J9AA 4BTYA 1GD4A 5BXQA 1K8A4 3PCRA 5LC7A 2K54A 4HZBB 3U97A 1LNIA 1KSIA 4KFFA 4HZ9B 2Z77A 1RTUA 3ZFZA 1OGZA 1B3SA 5G1KA 1W00A 3WA3A 2C4BA 3UL5A 3FG3A 4PEJA 1M1K4 4GHOA 1VQ83 4ILFA 2CG0A 1W6CA 4LEHA 1M904 3AMOA 1MGRA 1I3FA 1U5OA 1W01A 3WDGB 3T0UA 4BL3A 2ML6A 4LYLB 1N5HA 1CEWI 1ASKA 1I8VA 1RLSA 2F4YA 3G16A 3EB8A 3MWZA 1Q7Y4 1UCKA 1QVF2 4N3VA 1D6UA 1X1WA 2CKFB 1EKMA 2SARA 3E99A 3K7CA 2CW9A 1LVNA 3BIRA 5FW5A 3OV4A 1MOLA 1STDA 5DREA 3FG4A 2OTL3 3KFQC 3KCHA 3Q90A 1BRJA 3A5EA 4HOHA 4HYZA 2KF5A 1BGSA 5RNTA 4L8PA 2ZA4A 1GY7A 6STDA 2F5WA 3X3YA 2CFDA 5CF1A 3FKAA 1B21A 1MWUA 1RRHA 4R4KA 3CU3A 3V98A 3MG3A 3LTAA 1JN5A 1WMNA 2M7OA 1IT7A 4HJLB 1O7WB 5JBSA 5ELUA 1T5YA 3Q2PA 1TIJA 4X2HA 1JBSA 4KT3B 3CCE3 1CH0A 5STDA 3WMDA 4K1VA 3LT9A 2OOVA 1JKGB 1WNHA 1NNVA 5CLKA 1UUVB 2Q07A 1I2EA 5HOHA 3RDEA 3URPA 3WHOA 3NQZA 3EN8A 3F8XA 3FGYA 3K9MC 4RBNA 1OHOA 2LYXA 1YJ93 1JZDA 1O7NB 3NX0A 1ZS7A 1TFOA 2Y74A 4MJDA 1I3IA 3FZWA 1LQGC 1A2KA 2UX0A 1GY6A 2HMJB 4HVNA 4EC6A 1Q42A 1I2GA 2QEX3 1UUGB 2WOFA 1FGOA 4MEIA 1G96A 2QIYA 4FCMA 1IDPA 1FYSA 2H0HA 1VQ63 1BNRA 1JJ22 1UCJA 3CCL3 2E2TA 2JQ5A 4NHFA 5TGNA 2R4IA 1EG9B 5IG3A 4WP5A 1LNHA 5AYSC 1SARA 1KQS2 1BRIA 3DGYA 3DMCA 1VQK3 4AEQA 4IPBA 3EBYA 3ER7A 1FW7A 1D6ZA 3IJEB 4QWTA 1VQM3 1A2PA 1T3BA 4Q53A 1N9EA 4HBRA 2WO0A 1KC84 1BANA 1BSBA 3BNEA 3HIGA 4HM4B 1N8R4 2HOHA 3H3HA 3T8NA 3T8UA 1DE3A 2Z76A 3S5CA 1FZUA 1WTHA 4CJNA 4HM1B 3BNBA 4KFEA 5EQLA 3ZG5A 4AKZA 5IG5A 4R9LA 1B27A 1KWIA 4HKVB 4K90B 1AVLA 1FGTA 2IA7A 3F7SA 9RNTA 3LOYA 1BSDA 1BSEA 3MHEA 2CK3H 3MYTA 1US1A 1ZX2A 2CWTA 1GOYA 2KCDA 2GSPA 3FCSB 3HX8A 3MPHA 1Y4KA 3NV0A 1IQXA 1NU3A 4HM7B 4O8SA 5CF2A 3JUQA 3NHXA 1GOUA 2IYJA 4RZMA 5AEWB 3I563 1OCVA 2F56A 3CCJ3 3A76A 3GSPA 4H3UA 5CXOA 1ULJB 3X3XA 5JPUA 3CNXA 3X3ZA 2UGIA 1VQL3 2W56B 2MF7A 1DMNA 3O8YA 2OQEA 1BRKA 1AY7A 1IU7A 1O7PB 1RGLA 1QAKA 1MWSA 5IG0A 2W0QA 1RGHA 3CNMA 3NXJA 3KE7A 2L1SA 1NO3A 1UGHI 5IEPA 1TU5A 2XEPA 1RGKA 4K61A 3WR2A 3L0RA 5IENA 1YIT3 2XR8B 1OACA 5BU4A 3HOHA 1UUWB 3QK9A 3RGAA 3GRDA 3GZYB 4WYKA 4CCVA 2CHCA 2WGOA 3NQYA 2BMRB 1LRAA 1DVCA 2HMLB 1BNJA 1TJDA 4HM8B 1IVVA 3NBBA 4RNYA 1BRNL 2K0MA 3VSYA 1GMRA 2BT3A 1RDSA 4L8OA 3TDGA 1UCLA 2F5MA 4FMDA 2F86B 4R1KA 2XRXB 3IMAB 4IIAA 3OW22 3EN1B 4ZM8A 3J7Yd 1E3RA 1UGIA 2L4VA 1Q40B 4H61A 2W2CA 4RNTA 3PYJA 3UL6A 3G4S3 3DM8A 2KF4A 6GSPA 1Q814 2ZL8A 4MMYB 3S29A 4CDLA 1RNTA 1RSNA 3B8LA 3LYGA 1IV7A 2KRTA 1B2ZA 3HK4A 1UI8A 4XBTA 2RFRA 1S723 2CG1A 1FUWA 1FA3A 3IPTA 1TTOA 3KN4A 3AGOA 1NB3I 1B2XA 1HZ1A 2GBWB 3CC43 2OQEC 2XGLA 3DGNA 4N6MA 1VQN3 2J8XB 3EHCA 3UNLA 2W03A 1YGEA 2CFWA 1V58A 3S67A 3DGOA 5M18A 3CC73 3LTDA 1LXEA 3UJMA 1YVBI 1R4CA 3ECFA 3LXUX 2CC3A 4N6LA 1Q864 4MMZB 1MWRA 4BTWA 1MWTA 1GY5A 2WOHA 2B1XB 1GOVA 2ML5A 2Y73A 2MC8A 1I0XA 1S5AA 1AVKA 3BB9A 3EX9A 2P0XA 1VQO3 5AEUB 4HAAA 1L5GB 3OXAA 3VGNA 3RGRA 1RGAA 1DMQA 2GEYA 2ZDJA 3X42A 4OVMA 3FF0A 4KVHA 1ZO2A 1NWWA 2E2UA 2CIUA 1SIIA 1HKXA 1JN5B 3GZBA 1JRQA 3F7XA 3K63A 5KP3A 1PYLA 4XBXA 4CPKA 1B20A 2GEXA 3AGNA 3DY5A 3LZAA 1RRLA 2K3DA 4WYKB 3SXXA 3CME3 4G1MB 1CYUA 1IQYA 3OWYA 4FMCA 1W7CA 3LTCA 3CPW2 4O2HA 1BAOA 1YHQ3 4HM5B 3DXOA 2YFIB 2C11A 1A67A 1C7HA 5G2GA 3NUVA 1RGEA 1JZOA 2CFGA 4J5KA 1BVIA 1IV9A 3KSED 3RNTA 1I2FA 1YJN3 1QALA 1UW1A 3FG1A 3VF1A 2YFLB 1RCKA 3SOYA 1WMPA 1BIRA 4HM0B 4LGQA 3K0ZA 4N6NB 3FH1A 4XB5A 3GWRA 3OWUA 1FUTA 1X1UA 4EW5A 1YGWA 1PU4A 4HM2B 2CH9A 4OUQA 4U13A 3PS8A 1E3VA 1Q824 3V92A 1AQZA 1LOWA 3CCU3 3JVCA 4O02B 3NM2A 4L7KA 3SOAA 1OHPA 5D81A 1UI7A 4FMBA 4GSPA 1O7GB 1EEJA 3GAXA 3UB1A 1IQ8A 3EJVA 3OX9A 3MG2A 3LMLA 1VQ93 3AHSA 3ROBA 1NDOB 3D5IA 1BOXA 2OWPA 2WGQA 3ZG0A 2OTJ3 2CFKA 1W2B2 3U1WA 3AHWA 3EF8A 5D82A 7GSPA 4OK0A 1JB5A 1MGWA 2B24B 2BU4A 1JB4A 1OHSA 2H0GA 5AIHA 3WODG 4GB5A 2KF3A 1BUQA 3KIIA 4EV5A 1STFI 1WQLB 1ZGXA 1LQMB 2KAAA 2RBIA 1AV4A 2HMMB 2W04A 3LT8A 3CCR3 1DVDA 1IVXA 1TRPA 1C54A 5AIGA 1LOXA 4EBGA 1UDII 1PFPA 3G713 1YVSA 2HMKB 3F8HA 1G0TA 3DUKA 1HYFA 3JUOA 3M8CA 3KZTA 2P05A 1PY3A 2IMJA 2JDIH 3HI7A 3S27A 2RNTA 1GMQA 3CCQ3 3CCM3 5JPPA 4N6UA 4KFDA 4X2OA 1EUIC 3BNCA 1FUSA 4XDWA 1JKGA 1GD3A 3AMOB 4XM4A 2RGQA 1SIHA 1U8CB 5IERA 2OOVC 5CK6A 3EQQB 2W9PA 3V99A 2YFJB 4KZ1A 1ROAA 1LOYA 4MMXB 2YX9A 1B2SA 1N9JA 1VQP3 3SYUA 2D42A 4HM3B 5IEOA 2IUJA 1YNVX 3D79A 5FGOA 2OCTA 3WA2X 1W6GA 2XGNA 1MNLA 1VQ53 3H51A 3KSPA 2XFTA 3EE1A 1A90A 3SVAA 3CCS3 4FMAA 1JB2A 4JRFA 1UCIA 1RGFA 3D5GA 4NPBA 3D3LA 1FGRA 4EXRA 1W6YA 1FGQA 2BMQB 2SBLA 1N8QA 5IF6A 1JBTA 1VZZA 1J2BA 1A2VA 1VQ73 2XSOB 1IT8A 1R4YA 1IVWA 1K41A 1OH0A 2P09A 1TRQA 1ULIB 1W5ZA 2INXA 2PZVA 2W6JH 1GSPA 1X1XA 3BLZA 1BU4A 3GZRA 3I0YA 3JUNA 4I5QA 2KF6A 5AYRB 5GSPA 4J5GA 3Q3FA 1RN1A 1BNIA 4N6OB 3BU4A 5IW9A 1BUJA 1TP6A 2FXTA 4XDVA 5ELJA 1SQWA 2CFLA
chains in the Genus database with same CATH topology
1BSCA 1RGEA 1BAOA 1RGCA 4J5KA 1LNIA 1BVIA 1GOYA 3RNTA 1RTUA 2GSPA 1I2FA 1RMSA 4BU4A 1B3SA 1G02A 2C4BA 1RCKA 1BIRA 1GOUA 4GHOA 1FUTA 1X1UA 1MGRA 1I3FA 2F56A 3GSPA 1YGWA 1BSAA 1RLSA 1I8VA 2F4YA 4BIRA 1AQZA 1AY7A 1BRKA 1LOVA 1LOWA 1RGLA 1UCKA 1X1YA 1X1WA 2SARA 1RGHA 1IYYA 3BIRA 1JBRA 4GSPA 1RN4A 3WR2A 1RGKA 3KCHA 4HOHA 1BRJA 3A5EA 3AHSA 5RNTA 2KF5A 1BGSA 3D5IA 5BU4A 1BOXA 3HOHA 2ZA4A 2F5WA 1B2UA 3AHWA 7GSPA 1BNEA 1LRAA 1MGWA 1BRSA 2BU4A 1B21A 1BNJA 2KF3A 1ZGXA 2KAAA 1BRNL 2RBIA 1GMRA 1RDSA 1UCLA 2F5MA 1JBSA 1TRPA 1C54A 3DH2A 1CH0A 2AAEA 1B2MA 1T2HA 1YVSA 4RNTA 1HYFA 1RGGA 1GMPA 2AADA 1PY3A 1I2EA 2KF4A 6GSPA 5HOHA 3URPA 3WHOA 1RNTA 2RNTA 1GMQA 1RSNA 1BNSA 1BRHA 1B2ZA 1BNGA 7RNTA 1I3IA 1TTOA 1FUSA 3AGOA 1RCLA 1B2XA 1HZ1A 3D4AA 1I2GA 6RNTA 1LOYA 1B2SA 1RNBA 1FYSA 3SYUA 1RHLA 1BNRA 1UCJA 1YNVX 1I0VA 1SARA 1GOVA 1BRIA 3DGYA 1I0XA 1UCIA 1RGFA 1BNFA 3D5GA 8RNTA 2BIRA 1JBTA 4HAAA 1FW7A 5BIRA 1RGAA 1A2PA 1R4YA 1BANA 1BSBA 1TRQA 2HOHA 1DE3A 1GSPA 1X1XA 5GSPA 1BU4A 1FZUA 1BRGA 2KF6A 1PYLA 1B20A 4J5GA 3AGNA 3Q3FA 1RN1A 1BNIA 3BU4A 1BUJA 1B27A 1Q9EA 1DETA 1T2IA 1I70A 9RNTA 1BSDA 1BSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BSC A;  1RGE A;  1BAO A;  1RGC A;  4J5K A;  1LNI A;  1BVI A;  1GOY A;  3RNT A;  1RTU A;  2GSP A;  1I2F A;  1RMS A;  4BU4 A;  1B3S A;  1G02 A;  2C4B A;  1RCK A;  1BIR A;  1GOU A;  4GHO A;  1FUT A;  1X1U A;  1MGR A;  1I3F A;  2F56 A;  3GSP A;  1YGW A;  1BSA A;  1RLS A;  1I8V A;  2F4Y A;  4BIR A;  1AQZ A;  1AY7 A;  1BRK A;  1LOV A;  1LOW A;  1RGL A;  1UCK A;  1X1Y A;  1X1W A;  2SAR A;  1RGH A;  1IYY A;  3BIR A;  1JBR A;  4GSP A;  1RN4 A;  3WR2 A;  1RGK A;  3KCH A;  4HOH A;  1BRJ A;  3A5E A;  3AHS A;  5RNT A;  2KF5 A;  1BGS A;  3D5I A;  5BU4 A;  1BOX A;  3HOH A;  2ZA4 A;  2F5W A;  1B2U A;  3AHW A;  7GSP A;  1BNE A;  1LRA A;  1MGW A;  1BRS A;  2BU4 A;  1B21 A;  1BNJ A;  2KF3 A;  1ZGX A;  2KAA A;  1BRN L;  2RBI A;  1GMR A;  1RDS A;  1UCL A;  2F5M A;  1JBS A;  1TRP A;  1C54 A;  3DH2 A;  1CH0 A;  2AAE A;  1B2M A;  1T2H A;  1YVS A;  4RNT A;  1HYF A;  1RGG A;  1GMP A;  2AAD A;  1PY3 A;  1I2E A;  2KF4 A;  6GSP A;  5HOH A;  3URP A;  3WHO A;  1RNT A;  2RNT A;  1GMQ A;  1RSN A;  1BNS A;  1BRH A;  1B2Z A;  1BNG A;  7RNT A;  1I3I A;  1TTO A;  1FUS A;  3AGO A;  1RCL A;  1B2X A;  1HZ1 A;  3D4A A;  1I2G A;  6RNT A;  1LOY A;  1B2S A;  1RNB A;  1FYS A;  3SYU A;  1RHL A;  1BNR A;  1UCJ A;  1YNV X;  1I0V A;  1SAR A;  1GOV A;  1BRI A;  3DGY A;  1I0X A;  1UCI A;  1RGF A;  1BNF A;  3D5G A;  8RNT A;  2BIR A;  1JBT A;  4HAA A;  1FW7 A;  5BIR A;  1RGA A;  1A2P A;  1R4Y A;  1BAN A;  1BSB A;  1TRQ A;  2HOH A;  1DE3 A;  1GSP A;  1X1X A;  5GSP A;  1BU4 A;  1FZU A;  1BRG A;  2KF6 A;  1PYL A;  1B20 A;  4J5G A;  3AGN A;  3Q3F A;  1RN1 A;  1BNI A;  3BU4 A;  1BUJ A;  1B27 A;  1Q9E A;  1DET A;  1T2I A;  1I70 A;  9RNT A;  1BSD A;  1BSE A; 
#chains in the Genus database with same CATH topology
 1TUH A;  1BSC A;  2IY2 A;  2LQV A;  2XF3 A;  1RGC A;  4I4K A;  2C10 A;  2GBX B;  5AIF A;  1DYU A;  1RMS A;  4BU4 A;  2F98 A;  1KD1 4;  3MSO A;  3F40 A;  3N9H A;  3Q1C A;  1F8N A;  1G02 A;  2P0M A;  3B4O A;  3PZW A;  5KP4 A;  4TX4 A;  1IVU A;  1TFK A;  2RCD A;  4O3V A;  2CX0 A;  1W2Z A;  3F14 A;  4NRE A;  3SX1 A;  3X40 A;  4JF8 A;  4EV2 A;  7STD A;  1O7H B;  2V1L A;  5HGR A;  1WMO A;  1BSA A;  8CHO A;  2BHM A;  2BMO B;  1HU9 A;  2F99 A;  4BIR A;  1M1X B;  1QJG A;  3HII A;  5LC6 A;  1X1Y A;  1LOV A;  4R9K A;  3SLU A;  5IG4 A;  1IYY A;  4AKY A;  1RKY A;  1YJW 3;  1NB5 I;  2A15 A;  1JBR A;  2CWV A;  2QGU A;  2XH9 A;  2R41 A;  3LH4 A;  4HM6 B;  1RN4 A;  5DRV A;  1W02 A;  1W4N A;  1SPU A;  3JUP A;  3K5T A;  2W56 A;  5D83 A;  3G6E 3;  3G8Z A;  4N6V 0;  2QA4 3;  1YI2 3;  5BVB A;  1NJI 4;  3MG1 A;  1CYV A;  3EBT A;  5M19 A;  1B2U A;  3HZP A;  5I97 A;  1AR0 A;  3NM7 A;  1OPY A;  4FR9 A;  1BNE A;  1QMA A;  3KKG A;  3FF2 A;  1Q40 A;  1BRS A;  1V57 A;  2HMO B;  3DGL A;  4RNZ A;  3FLJ A;  1OF5 A;  2XFS A;  3B7C A;  2H0I A;  2IUK A;  3CC2 3;  2RSX A;  1K73 4;  3DZL A;  2CWU A;  1GYB A;  3OWS A;  4WFO A;  3S28 A;  1N5P A;  2PNC A;  1EQK A;  2FGT A;  3DH2 A;  2GU1 A;  2AAE A;  3F9S A;  3JUM A;  1B2M A;  4K1U A;  1T2H A;  2Z7A A;  4XBY A;  3STD A;  4WHA A;  1IK3 A;  1RGG A;  1GMP A;  2AAD A;  4BL2 A;  1SJW A;  1VQQ A;  3CPO A;  1JNQ A;  3LTB A;  1YIJ 3;  3ALA A;  3GZX B;  3CXC 2;  1BNS A;  1BRH A;  3G0K A;  3NV0 B;  3SED A;  3B4P A;  1BNG A;  4BTX A;  7RNT A;  2UUG C;  1Z1S A;  3NBJ A;  1M9G A;  3N54 B;  1RCL A;  5AII A;  1OGX A;  3D4A A;  1K9M 4;  2D1W A;  2W9Q A;  6RNT A;  3PXM A;  3WOF B;  3EC9 A;  1QAF A;  3BND A;  1RNB A;  5KP1 A;  3I55 3;  3PCS A;  1V74 A;  1RHL A;  1D6Y A;  4LMI A;  1JV2 B;  1I0V A;  4FCJ A;  1O7M B;  1K28 A;  2KXG A;  1FGM A;  2CX1 A;  2ZHX B;  3N8B A;  1BNF A;  5AI1 A;  2FNQ A;  2O9U X;  3NBR A;  3PGB A;  2BIR A;  5EVH A;  5G1L A;  2I9W A;  8RNT A;  3X41 A;  3FSD A;  5A0O B;  5BIR A;  1DMM A;  2E2V A;  2GU3 A;  3QRD A;  4N6T A;  1ISK A;  1OUN A;  1RJO A;  4IT7 A;  4FCZ A;  4LSO A;  2BNG A;  3DGM A;  4WWU C;  2BO9 B;  2HMN B;  4J8T A;  4ORL A;  3CMA 3;  1ROV A;  4R80 A;  2Z6B A;  4GL6 A;  1QVG 2;  1VQ4 3;  1BRG A;  1E97 A;  2P38 A;  4STD A;  5M1A A;  2O3O A;  3D9R A;  1Q7H A;  5EEO A;  3CCV 3;  3WOE B;  1CQS A;  4LZI A;  1Q9E A;  1GS3 A;  1RN7 A;  1DET A;  2STD A;  4DKI A;  4EYC A;  3CD6 3;  1T2I A;  3MKI A;  1OF5 B;  2GXF A;  1I70 A;  1EA2 A;  2XSH B;  4J9A A;  4BTY A;  1GD4 A;  5BXQ A;  1K8A 4;  3PCR A;  5LC7 A;  2K54 A;  4HZB B;  3U97 A;  1LNI A;  1KSI A;  4KFF A;  4HZ9 B;  2Z77 A;  1RTU A;  3ZFZ A;  1OGZ A;  1B3S A;  5G1K A;  1W00 A;  3WA3 A;  2C4B A;  3UL5 A;  3FG3 A;  4PEJ A;  1M1K 4;  4GHO A;  1VQ8 3;  4ILF A;  2CG0 A;  1W6C A;  4LEH A;  1M90 4;  3AMO A;  1MGR A;  1I3F A;  1U5O A;  1W01 A;  3WDG B;  3T0U A;  4BL3 A;  2ML6 A;  4LYL B;  1N5H A;  1CEW I;  1ASK A;  1I8V A;  1RLS A;  2F4Y A;  3G16 A;  3EB8 A;  3MWZ A;  1Q7Y 4;  1UCK A;  1QVF 2;  4N3V A;  1D6U A;  1X1W A;  2CKF B;  1EKM A;  2SAR A;  3E99 A;  3K7C A;  2CW9 A;  1LVN A;  3BIR A;  5FW5 A;  3OV4 A;  1MOL A;  1STD A;  5DRE A;  3FG4 A;  2OTL 3;  3KFQ C;  3KCH A;  3Q90 A;  1BRJ A;  3A5E A;  4HOH A;  4HYZ A;  2KF5 A;  1BGS A;  5RNT A;  4L8P A;  2ZA4 A;  1GY7 A;  6STD A;  2F5W A;  3X3Y A;  2CFD A;  5CF1 A;  3FKA A;  1B21 A;  1MWU A;  1RRH A;  4R4K A;  3CU3 A;  3V98 A;  3MG3 A;  3LTA A;  1JN5 A;  1WMN A;  2M7O A;  1IT7 A;  4HJL B;  1O7W B;  5JBS A;  5ELU A;  1T5Y A;  3Q2P A;  1TIJ A;  4X2H A;  1JBS A;  4KT3 B;  3CCE 3;  1CH0 A;  5STD A;  3WMD A;  4K1V A;  3LT9 A;  2OOV A;  1JKG B;  1WNH A;  1NNV A;  5CLK A;  1UUV B;  2Q07 A;  1I2E A;  5HOH A;  3RDE A;  3URP A;  3WHO A;  3NQZ A;  3EN8 A;  3F8X A;  3FGY A;  3K9M C;  4RBN A;  1OHO A;  2LYX A;  1YJ9 3;  1JZD A;  1O7N B;  3NX0 A;  1ZS7 A;  1TFO A;  2Y74 A;  4MJD A;  1I3I A;  3FZW A;  1LQG C;  1A2K A;  2UX0 A;  1GY6 A;  2HMJ B;  4HVN A;  4EC6 A;  1Q42 A;  1I2G A;  2QEX 3;  1UUG B;  2WOF A;  1FGO A;  4MEI A;  1G96 A;  2QIY A;  4FCM A;  1IDP A;  1FYS A;  2H0H A;  1VQ6 3;  1BNR A;  1JJ2 2;  1UCJ A;  3CCL 3;  2E2T A;  2JQ5 A;  4NHF A;  5TGN A;  2R4I A;  1EG9 B;  5IG3 A;  4WP5 A;  1LNH A;  5AYS C;  1SAR A;  1KQS 2;  1BRI A;  3DGY A;  3DMC A;  1VQK 3;  4AEQ A;  4IPB A;  3EBY A;  3ER7 A;  1FW7 A;  1D6Z A;  3IJE B;  4QWT A;  1VQM 3;  1A2P A;  1T3B A;  4Q53 A;  1N9E A;  4HBR A;  2WO0 A;  1KC8 4;  1BAN A;  1BSB A;  3BNE A;  3HIG A;  4HM4 B;  1N8R 4;  2HOH A;  3H3H A;  3T8N A;  3T8U A;  1DE3 A;  2Z76 A;  3S5C A;  1FZU A;  1WTH A;  4CJN A;  4HM1 B;  3BNB A;  4KFE A;  5EQL A;  3ZG5 A;  4AKZ A;  5IG5 A;  4R9L A;  1B27 A;  1KWI A;  4HKV B;  4K90 B;  1AVL A;  1FGT A;  2IA7 A;  3F7S A;  9RNT A;  3LOY A;  1BSD A;  1BSE A;  3MHE A;  2CK3 H;  3MYT A;  1US1 A;  1ZX2 A;  2CWT A;  1GOY A;  2KCD A;  2GSP A;  3FCS B;  3HX8 A;  3MPH A;  1Y4K A;  3NV0 A;  1IQX A;  1NU3 A;  4HM7 B;  4O8S A;  5CF2 A;  3JUQ A;  3NHX A;  1GOU A;  2IYJ A;  4RZM A;  5AEW B;  3I56 3;  1OCV A;  2F56 A;  3CCJ 3;  3A76 A;  3GSP A;  4H3U A;  5CXO A;  1ULJ B;  3X3X A;  5JPU A;  3CNX A;  3X3Z A;  2UGI A;  1VQL 3;  2W56 B;  2MF7 A;  1DMN A;  3O8Y A;  2OQE A;  1BRK A;  1AY7 A;  1IU7 A;  1O7P B;  1RGL A;  1QAK A;  1MWS A;  5IG0 A;  2W0Q A;  1RGH A;  3CNM A;  3NXJ A;  3KE7 A;  2L1S A;  1NO3 A;  1UGH I;  5IEP A;  1TU5 A;  2XEP A;  1RGK A;  4K61 A;  3WR2 A;  3L0R A;  5IEN A;  1YIT 3;  2XR8 B;  1OAC A;  5BU4 A;  3HOH A;  1UUW B;  3QK9 A;  3RGA A;  3GRD A;  3GZY B;  4WYK A;  4CCV A;  2CHC A;  2WGO A;  3NQY A;  2BMR B;  1LRA A;  1DVC A;  2HML B;  1BNJ A;  1TJD A;  4HM8 B;  1IVV A;  3NBB A;  4RNY A;  1BRN L;  2K0M A;  3VSY A;  1GMR A;  2BT3 A;  1RDS A;  4L8O A;  3TDG A;  1UCL A;  2F5M A;  4FMD A;  2F86 B;  4R1K A;  2XRX B;  3IMA B;  4IIA A;  3OW2 2;  3EN1 B;  4ZM8 A;  3J7Y d;  1E3R A;  1UGI A;  2L4V A;  1Q40 B;  4H61 A;  2W2C A;  4RNT A;  3PYJ A;  3UL6 A;  3G4S 3;  3DM8 A;  2KF4 A;  6GSP A;  1Q81 4;  2ZL8 A;  4MMY B;  3S29 A;  4CDL A;  1RNT A;  1RSN A;  3B8L A;  3LYG A;  1IV7 A;  2KRT A;  1B2Z A;  3HK4 A;  1UI8 A;  4XBT A;  2RFR A;  1S72 3;  2CG1 A;  1FUW A;  1FA3 A;  3IPT A;  1TTO A;  3KN4 A;  3AGO A;  1NB3 I;  1B2X A;  1HZ1 A;  2GBW B;  3CC4 3;  2OQE C;  2XGL A;  3DGN A;  4N6M A;  1VQN 3;  2J8X B;  3EHC A;  3UNL A;  2W03 A;  1YGE A;  2CFW A;  1V58 A;  3S67 A;  3DGO A;  5M18 A;  3CC7 3;  3LTD A;  1LXE A;  3UJM A;  1YVB I;  1R4C A;  3ECF A;  3LXU X;  2CC3 A;  4N6L A;  1Q86 4;  4MMZ B;  1MWR A;  4BTW A;  1MWT A;  1GY5 A;  2WOH A;  2B1X B;  1GOV A;  2ML5 A;  2Y73 A;  2MC8 A;  1I0X A;  1S5A A;  1AVK A;  3BB9 A;  3EX9 A;  2P0X A;  1VQO 3;  5AEU B;  4HAA A;  1L5G B;  3OXA A;  3VGN A;  3RGR A;  1RGA A;  1DMQ A;  2GEY A;  2ZDJ A;  3X42 A;  4OVM A;  3FF0 A;  4KVH A;  1ZO2 A;  1NWW A;  2E2U A;  2CIU A;  1SII A;  1HKX A;  1JN5 B;  3GZB A;  1JRQ A;  3F7X A;  3K63 A;  5KP3 A;  1PYL A;  4XBX A;  4CPK A;  1B20 A;  2GEX A;  3AGN A;  3DY5 A;  3LZA A;  1RRL A;  2K3D A;  4WYK B;  3SXX A;  3CME 3;  4G1M B;  1CYU A;  1IQY A;  3OWY A;  4FMC A;  1W7C A;  3LTC A;  3CPW 2;  4O2H A;  1BAO A;  1YHQ 3;  4HM5 B;  3DXO A;  2YFI B;  2C11 A;  1A67 A;  1C7H A;  5G2G A;  3NUV A;  1RGE A;  1JZO A;  2CFG A;  4J5K A;  1BVI A;  1IV9 A;  3KSE D;  3RNT A;  1I2F A;  1YJN 3;  1QAL A;  1UW1 A;  3FG1 A;  3VF1 A;  2YFL B;  1RCK A;  3SOY A;  1WMP A;  1BIR A;  4HM0 B;  4LGQ A;  3K0Z A;  4N6N B;  3FH1 A;  4XB5 A;  3GWR A;  3OWU A;  1FUT A;  1X1U A;  4EW5 A;  1YGW A;  1PU4 A;  4HM2 B;  2CH9 A;  4OUQ A;  4U13 A;  3PS8 A;  1E3V A;  1Q82 4;  3V92 A;  1AQZ A;  1LOW A;  3CCU 3;  3JVC A;  4O02 B;  3NM2 A;  4L7K A;  3SOA A;  1OHP A;  5D81 A;  1UI7 A;  4FMB A;  4GSP A;  1O7G B;  1EEJ A;  3GAX A;  3UB1 A;  1IQ8 A;  3EJV A;  3OX9 A;  3MG2 A;  3LML A;  1VQ9 3;  3AHS A;  3ROB A;  1NDO B;  3D5I A;  1BOX A;  2OWP A;  2WGQ A;  3ZG0 A;  2OTJ 3;  2CFK A;  1W2B 2;  3U1W A;  3AHW A;  3EF8 A;  5D82 A;  7GSP A;  4OK0 A;  1JB5 A;  1MGW A;  2B24 B;  2BU4 A;  1JB4 A;  1OHS A;  2H0G A;  5AIH A;  3WOD G;  4GB5 A;  2KF3 A;  1BUQ A;  3KII A;  4EV5 A;  1STF I;  1WQL B;  1ZGX A;  1LQM B;  2KAA A;  2RBI A;  1AV4 A;  2HMM B;  2W04 A;  3LT8 A;  3CCR 3;  1DVD A;  1IVX A;  1TRP A;  1C54 A;  5AIG A;  1LOX A;  4EBG A;  1UDI I;  1PFP A;  3G71 3;  1YVS A;  2HMK B;  3F8H A;  1G0T A;  3DUK A;  1HYF A;  3JUO A;  3M8C A;  3KZT A;  2P05 A;  1PY3 A;  2IMJ A;  2JDI H;  3HI7 A;  3S27 A;  2RNT A;  1GMQ A;  3CCQ 3;  3CCM 3;  5JPP A;  4N6U A;  4KFD A;  4X2O A;  1EUI C;  3BNC A;  1FUS A;  4XDW A;  1JKG A;  1GD3 A;  3AMO B;  4XM4 A;  2RGQ A;  1SIH A;  1U8C B;  5IER A;  2OOV C;  5CK6 A;  3EQQ B;  2W9P A;  3V99 A;  2YFJ B;  4KZ1 A;  1ROA A;  1LOY A;  4MMX B;  2YX9 A;  1B2S A;  1N9J A;  1VQP 3;  3SYU A;  2D42 A;  4HM3 B;  5IEO A;  2IUJ A;  1YNV X;  3D79 A;  5FGO A;  2OCT A;  3WA2 X;  1W6G A;  2XGN A;  1MNL A;  1VQ5 3;  3H51 A;  3KSP A;  2XFT A;  3EE1 A;  1A90 A;  3SVA A;  3CCS 3;  4FMA A;  1JB2 A;  4JRF A;  1UCI A;  1RGF A;  3D5G A;  4NPB A;  3D3L A;  1FGR A;  4EXR A;  1W6Y A;  1FGQ A;  2BMQ B;  2SBL A;  1N8Q A;  5IF6 A;  1JBT A;  1VZZ A;  1J2B A;  1A2V A;  1VQ7 3;  2XSO B;  1IT8 A;  1R4Y A;  1IVW A;  1K41 A;  1OH0 A;  2P09 A;  1TRQ A;  1ULI B;  1W5Z A;  2INX A;  2PZV A;  2W6J H;  1GSP A;  1X1X A;  3BLZ A;  1BU4 A;  3GZR A;  3I0Y A;  3JUN A;  4I5Q A;  2KF6 A;  5AYR B;  5GSP A;  4J5G A;  3Q3F A;  1RN1 A;  1BNI A;  4N6O B;  3BU4 A;  5IW9 A;  1BUJ A;  1TP6 A;  2FXT A;  4XDV A;  5ELJ A;  1SQW A;  2CFL A; 
#chains in the Genus database with same CATH homology
 1BSC A;  1RGE A;  1BAO A;  1RGC A;  4J5K A;  1LNI A;  1BVI A;  1GOY A;  3RNT A;  1RTU A;  2GSP A;  1I2F A;  1RMS A;  4BU4 A;  1B3S A;  1G02 A;  2C4B A;  1RCK A;  1BIR A;  1GOU A;  4GHO A;  1FUT A;  1X1U A;  1MGR A;  1I3F A;  2F56 A;  3GSP A;  1YGW A;  1BSA A;  1RLS A;  1I8V A;  2F4Y A;  4BIR A;  1AQZ A;  1AY7 A;  1BRK A;  1LOV A;  1LOW A;  1RGL A;  1UCK A;  1X1Y A;  1X1W A;  2SAR A;  1RGH A;  1IYY A;  3BIR A;  1JBR A;  4GSP A;  1RN4 A;  3WR2 A;  1RGK A;  3KCH A;  4HOH A;  1BRJ A;  3A5E A;  3AHS A;  5RNT A;  2KF5 A;  1BGS A;  3D5I A;  5BU4 A;  1BOX A;  3HOH A;  2ZA4 A;  2F5W A;  1B2U A;  3AHW A;  7GSP A;  1BNE A;  1LRA A;  1MGW A;  1BRS A;  2BU4 A;  1B21 A;  1BNJ A;  2KF3 A;  1ZGX A;  2KAA A;  1BRN L;  2RBI A;  1GMR A;  1RDS A;  1UCL A;  2F5M A;  1JBS A;  1TRP A;  1C54 A;  3DH2 A;  1CH0 A;  2AAE A;  1B2M A;  1T2H A;  1YVS A;  4RNT A;  1HYF A;  1RGG A;  1GMP A;  2AAD A;  1PY3 A;  1I2E A;  2KF4 A;  6GSP A;  5HOH A;  3URP A;  3WHO A;  1RNT A;  2RNT A;  1GMQ A;  1RSN A;  1BNS A;  1BRH A;  1B2Z A;  1BNG A;  7RNT A;  1I3I A;  1TTO A;  1FUS A;  3AGO A;  1RCL A;  1B2X A;  1HZ1 A;  3D4A A;  1I2G A;  6RNT A;  1LOY A;  1B2S A;  1RNB A;  1FYS A;  3SYU A;  1RHL A;  1BNR A;  1UCJ A;  1YNV X;  1I0V A;  1SAR A;  1GOV A;  1BRI A;  3DGY A;  1I0X A;  1UCI A;  1RGF A;  1BNF A;  3D5G A;  8RNT A;  2BIR A;  1JBT A;  4HAA A;  1FW7 A;  5BIR A;  1RGA A;  1A2P A;  1R4Y A;  1BAN A;  1BSB A;  1TRQ A;  2HOH A;  1DE3 A;  1GSP A;  1X1X A;  5GSP A;  1BU4 A;  1FZU A;  1BRG A;  2KF6 A;  1PYL A;  1B20 A;  4J5G A;  3AGN A;  3Q3F A;  1RN1 A;  1BNI A;  3BU4 A;  1BUJ A;  1B27 A;  1Q9E A;  1DET A;  1T2I A;  1I70 A;  9RNT A;  1BSD A;  1BSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...