7HSCA

High resolution solution structure of the heat shock cognate-70 kd substrate binding domain obtained by multidimensional nmr techniques
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
159
structure length
159
Chain Sequence
SENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (HEAT SHOCK COGNATE 70 KD PROTEIN 1)
publication title High-resolution solution structure of the 18 kDa substrate-binding domain of the mammalian chaperone protein Hsc70.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Molecular chaperone
total genus 31
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 1999-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 7hscA00
4FL9A 1YUWA 4JWCA 4WV7A 4EZZA 4JNEA 1U00A 4R5GA 4EZQA 3DOBA 3D2FA 4R5IA 2V7YA 4EZYA 7HSCA 1DG4A 1BPRA 3DPQA 4JWEA 4R5KA 4WV5A 4F01A 1DKZA 4EZRA 4PO2A 3C7NA 2KHOA 4EZTA 3C7NB 4JNFA 4EZPA 3D2EA 4JN4A 5E84A 4EZUA 3DPPA 4EZVA 4B9QA 3DPOA 4JWIA 1CKRA 4R5LA 4F00A 1DKXA 4EZNA 2QXLA 4EZOA 4HY9A 1DKYA 2BPRA 1Q5LA 3N8EA 4EZSA 4HYBA 2OP6A 4EZXA 3DQGA 4R5JA 3QNJA 3H0XA 4JWDA 5TKYA 4E81A 4EZWA
chains in the Genus database with same CATH superfamily
4FL9A 1YUWA 4JWCA 4WV7A 4EZZA 4JNEA 1U00A 4R5GA 4EZQA 3DOBA 3D2FA 4R5IA 2V7YA 4EZYA 7HSCA 1DG4A 1BPRA 3DPQA 4I43A 4ILHB 4JWEA 4R5KA 4WV5A 3SBSA 1DKZA 4F01A 4EZRA 4PO2A 3C7NA 2KHOA 4EZTA 3C7NB 4JNFA 4EZPA 3D2EA 4JN4A 5E84A 4EZUA 3DPPA 4EZVA 4B9QA 3DPOA 4JWIA 1CKRA 4R5LA 4F00A 1DKXA 4EZNA 3ZEFA 2QXLA 4EZOA 4HY9A 1DKYA 2BPRA 1Q5LA 3N8EA 4ILIA 4ILGA 4EZSA 3SBTB 4HYBA 2OP6A 4EZXA 3DQGA 4R5JA 3QNJA 3H0XA 4JWDA 5TKYA 4E81A 4MQDA 4EZWA
chains in the Genus database with same CATH topology
4FL9A 1YUWA 4JWCA 4WV7A 4EZZA 4JNEA 1U00A 4R5GA 4EZQA 3DOBA 3D2FA 4R5IA 2V7YA 4EZYA 7HSCA 1DG4A 1BPRA 3DPQA 4I43A 4ILHB 4JWEA 4R5KA 4WV5A 3SBSA 1DKZA 4F01A 4EZRA 4PO2A 3C7NA 2KHOA 4EZTA 3C7NB 4JNFA 4EZPA 3D2EA 4JN4A 5E84A 4EZUA 3DPPA 4EZVA 4B9QA 3DPOA 4JWIA 1CKRA 4R5LA 4F00A 1DKXA 4EZNA 3ZEFA 2QXLA 4EZOA 4HY9A 1DKYA 2BPRA 1Q5LA 3N8EA 4ILIA 4ILGA 4EZSA 3SBTB 4HYBA 2OP6A 4EZXA 3DQGA 4R5JA 3QNJA 3H0XA 4JWDA 5TKYA 4E81A 4MQDA 4EZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FL9 A;  1YUW A;  4JWC A;  4WV7 A;  4EZZ A;  4JNE A;  1U00 A;  4R5G A;  4EZQ A;  3DOB A;  3D2F A;  4R5I A;  2V7Y A;  4EZY A;  7HSC A;  1DG4 A;  1BPR A;  3DPQ A;  4JWE A;  4R5K A;  4WV5 A;  4F01 A;  1DKZ A;  4EZR A;  4PO2 A;  3C7N A;  2KHO A;  4EZT A;  3C7N B;  4JNF A;  4EZP A;  3D2E A;  4JN4 A;  5E84 A;  4EZU A;  3DPP A;  4EZV A;  4B9Q A;  3DPO A;  4JWI A;  1CKR A;  4R5L A;  4F00 A;  1DKX A;  4EZN A;  2QXL A;  4EZO A;  4HY9 A;  1DKY A;  2BPR A;  1Q5L A;  3N8E A;  4EZS A;  4HYB A;  2OP6 A;  4EZX A;  3DQG A;  4R5J A;  3QNJ A;  3H0X A;  4JWD A;  5TKY A;  4E81 A;  4EZW A; 
#chains in the Genus database with same CATH topology
 4FL9 A;  1YUW A;  4JWC A;  4WV7 A;  4EZZ A;  4JNE A;  1U00 A;  4R5G A;  4EZQ A;  3DOB A;  3D2F A;  4R5I A;  2V7Y A;  4EZY A;  7HSC A;  1DG4 A;  1BPR A;  3DPQ A;  4I43 A;  4ILH B;  4JWE A;  4R5K A;  4WV5 A;  3SBS A;  1DKZ A;  4F01 A;  4EZR A;  4PO2 A;  3C7N A;  2KHO A;  4EZT A;  3C7N B;  4JNF A;  4EZP A;  3D2E A;  4JN4 A;  5E84 A;  4EZU A;  3DPP A;  4EZV A;  4B9Q A;  3DPO A;  4JWI A;  1CKR A;  4R5L A;  4F00 A;  1DKX A;  4EZN A;  3ZEF A;  2QXL A;  4EZO A;  4HY9 A;  1DKY A;  2BPR A;  1Q5L A;  3N8E A;  4ILI A;  4ILG A;  4EZS A;  3SBT B;  4HYB A;  2OP6 A;  4EZX A;  3DQG A;  4R5J A;  3QNJ A;  3H0X A;  4JWD A;  5TKY A;  4E81 A;  4MQD A;  4EZW A; 
#chains in the Genus database with same CATH homology
 4FL9 A;  1YUW A;  4JWC A;  4WV7 A;  4EZZ A;  4JNE A;  1U00 A;  4R5G A;  4EZQ A;  3DOB A;  3D2F A;  4R5I A;  2V7Y A;  4EZY A;  7HSC A;  1DG4 A;  1BPR A;  3DPQ A;  4I43 A;  4ILH B;  4JWE A;  4R5K A;  4WV5 A;  3SBS A;  1DKZ A;  4F01 A;  4EZR A;  4PO2 A;  3C7N A;  2KHO A;  4EZT A;  3C7N B;  4JNF A;  4EZP A;  3D2E A;  4JN4 A;  5E84 A;  4EZU A;  3DPP A;  4EZV A;  4B9Q A;  3DPO A;  4JWI A;  1CKR A;  4R5L A;  4F00 A;  1DKX A;  4EZN A;  3ZEF A;  2QXL A;  4EZO A;  4HY9 A;  1DKY A;  2BPR A;  1Q5L A;  3N8E A;  4ILI A;  4ILG A;  4EZS A;  3SBT B;  4HYB A;  2OP6 A;  4EZX A;  3DQG A;  4R5J A;  3QNJ A;  3H0X A;  4JWD A;  5TKY A;  4E81 A;  4MQD A;  4EZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...