7LPRA

Structural basis for broad specificity in alpha-lytic protease mutants
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for broad specificity in alpha-lytic protease mutants.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-LYTIC PROTEASE
total genus 53
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1991-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 7lprA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 7lprA01
2EC9H 1TWXB 1GI0A 4ZKRU 5FXLA 3SNAA 3PWCA 3UQVA 3MH6A 5K7RA 1G3DA 1MD8A 2W7SA 4Y8XA 3A8DA 4ABEA 3VB6A 3LH3A 1MTNB 1O5BB 4IC5A 3QTVH 1O2ZA 1P57B 3FP7E 1GBDA 3SV6A 1MZAA 4ISNA 2O8WA 2M5TA 1DPOA 1IQKA 1QQ4A 2J4IA 5E2PA 5LH8A 3E1XB 1ARCA 1HGTH 2YNBA 4NGAH 1N8OB 3L3TA 1DWBH 3SJOA 3GY2A 3ZZAA 5E8EH 3SJ9A 1YPHC 1LVMA 1HAXB 1L1GA 2FZZA 2QV1A 4Y8ZA 3PTNA 5EXMA 1T31A 3QDZB 1O3LA 3NKKA 2XBWA 1BQYA 1TA2A 3SNEA 1HXFH 1OP8A 1VJAU 3GCHC 1QTFA 4R8TB 3SU5A 3RC4A 3VFEA 1F5RA 1PQAA 1VITF 2AEIH 1GVZA 1V2PT 3B9FH 1GG6C 4BANB 5A8YA 1GBAA 1GJ7B 3URCA 6CHAC 1S0RA 4Q80A 3RXQA 3PLPA 1HAZB 2CHAB 2ZPQA 2ODQA 2Y6TA 1OWHA 2AGGX 5HM2A 5T6FA 1ZPZA 1W2KH 2J38A 4JK6A 1AB9B 1BITA 2BLVA 2H6MA 1CA0B 5A0BA 5B6OA 3KEEA 3GYLB 2G81E 1TRYA 3H5CB 1AVGH 2PSYA 1UO6A 2P93A 1KLTA 4B75A 3KN2A 3MU8A 3HGPA 1TNIA 1TNJA 3R3GB 4UD9H 1SC8U 1GDNA 1E0FD 3SV7A 2FYRA 3E91A 4WY3A 1GHYH 1O5AB 3KHVA 2AIQA 1HAPH 1UVSH 1SLVB 3A83A 5GCHF 2ZFSA 3M3SA 1BCUH 2ZFFH 2ZFTA 3AAVA 3LGWA 1JRSA 2FI5E 2HWLB 1C1VH 1SHYA 3ATKA 5CE1A 2R3UA 1V2WT 3MMGA 4M7GA 4YTAA 4X1RU 4UFEH 4ZKOU 2Z6BD 4LOYH 1GJ5H 1DSTA 2ODPA 1UVPA 1MKXK 6CHAB 3C1KA 1O3NA 1J14A 2UWLA 1TOMH 3A80A 1Y3YA 2H5DA 3GY5A 3RXGA 3ZZ5A 3SBKA 5DP3A 3ZZ9A 1ZGVA 4HZHA 1HJAC 2P3FH 4CBOA 1C2MA 3PROA 1CE5A 1A7SA 3O8CA 3LGUA 4AB9A 1NU9A 2XXLA 2R2WU 3BF6H 3A87A 1CGIE 2ZHQH 3STJA 2BVSH 4JZEH 3W95A 4AFZA 4A1TA 3UNQA 1J17T 2I6QA 1O36A 5I25A 3RM2H 1F7ZA 4ISHH 2ANWA 1KY9A 1O3MA 9ESTA 2WV4A 1PQ8A 4FUIA 1H4WA 3S9CA 2Q1JA 5JYIA 4YOIA 2BLQA 2GMTB 3RMNH 5EODA 1GHAG 3M35A 2QA9E 1FMGA 2VB0A 1GPZA 3RLYH 3M7UA 3VGCB 4CR9A 1EOJA 4BXWA 2BLOA 1TMUH 1QL9A 1BA8B 2VWMA 4UDWH 1PPHE 1ZTLA 1TABE 5TJXA 1TGNA 2TIOA 2VH6A 5FPSA 2VVCA 2H9HA 2NU4E 5AHGH 1OP0A 3BTFE 2ZECA 3UTUH 5G4BA 7KMEH 5A2MH 1BHXB 2ZTZA 4THNH 1BB0B 3NCLA 3TK9A 4U30A 1RGQA 3M3TA 3K9XB 4E05H 2WUCA 5L6NH 1A5HA 2B8OH 2QF0A 2PKAB 1T4VH 2VIOA 5T6GA 5LPEA 1EP5A 4BTTB 4CRBA 2GZ7A 1UTLM 5FAHA 2SGAA 3A7VA 4QT8C 1BRBE 1RFNA 3MNSA 2QF3A 3M3VA 1OWJA 1XUKA 4D76A 2P94A 5ESBA 2XRCA 1TLDA 1ZLRA 1O2LA 5T6DA 2VVVA 1ZRKA 3VB7A 2XBYA 1CU1A 1O2WA 1W7GH 2OQ5A 1HXEH 1SGFA 3GOVB 1O5FH 1YPLH 3SU2A 1SBWA 5FHTA 2P3TB 4X8SH 4GUXA 1W11U 5FPTA 2GX4A 2ZI2H 3QLPH 3SNDA 2XC5A 3M7TA 3HK3B 2BY7X 3M36A 2Y82A 2OC0A 2OC1A 2QIQA 2VINA 1UJ1A 2CF9H 2AFQB 5A0CA 4FUDA 3S9BA 1S81A 3S7HB 3M37A 3TJNA 1O3OA 4FVDA 1NC6A 3O8RA 5GDSH 1CVWH 1NY22 2VWOA 2OCVB 1QB9A 4OGXA 1EAIA 4K2YA 4JZIA 4MNWA 1F0RA 4YO9A 5DP7A 3RXKA 2VIVA 1ZMJA 1Z1JA 3A7WA 5JBBS 1J15A 2Z9KA 1IQIA 3E16B 5EU8A 2A2XH 2RA0A 3U8TH 2GGVB 4ABDA 2WPKS 4ZROA 3KQDA 3UPEA 1XVMA 1DUEA 1EASA 1NRPH 2ZG0H 4ABGA 3MNCA 3K6ZA 1YLCA 2ZZUH 4NWKA 3RXCA 3QO6A 1CHOG 2VIQA 1K22H 1K1OA 1MTSA 3TH4H 5F6MA 6LPRA 1DOJA 4ISIH 1SGTA 2ZU4A 1ABJH 2SGDE 1LHGH 4IN2A 5A8ZA 1THSH 2VIDA 1P01A 4ZXXH 1O3BA 1BTZA 4NFEA 2GKVE 1A3EH 1PJPA 2A32A 1DT2A 1QCPA 3GISB 3UWIA 5L2YH 2Z9GA 3TLOA 1DWEH 1P04A 1GMHF 1DWDH 2VU8E 3F1SB 1SVPA 2OP9A 5FPYA 1KYNA 1H1BA 4MTBA 4XSKU 1ACBE 3RXAA 3PO1C 3EA7A 1HIAA 1BMNH 4KTCA 4DCDA 2JETC 1HB0B 5ETXA 4AFUA 1GBEA 1JBUH 1BUIA 3BEIB 3P70B 1BMAA 1DANH 3ZV8A 2GDEH 3UREA 1PPGE 2ALPA 5DP5A 2CF8H 4WMDA 2FEQH 1HIAB 1P06A 1H9LB 2ANYA 2ZPRA 3HGNA 2CXVA 4RSPA 1SHHB 4WWYA 1S83A 2LPRA 1C1WH 2BD2A 2TGDA 3U1JB 4ESTE 1RJXB 1ZGIA 3MH4A 1QRXA 1V2UT 2FOFA 1X7AC 1MKXH 1O3FA 4E7NA 1P2KA 4YESB 3NPSA 2GT7A 2H9TH 4GCHG 4VGCC 2F9BH 1LVOA 3OTJE 1EZUC 1YBWA 1V2QT 1AZ8A 4CHAC 2SGFE 3ZZ6A 3K2UA 3AASA 1UTJA 3RC6A 1O31A 1DSUA 1HNEE 1QHRB 1UK3A 1ZSJA 2FOHA 2F9NA 4Z6AH 1ZYOA 2H1UA 2F83A 1AUTC 1F92A 1K28D 4Y0YE 2O8UA 3RXUA 3SHCH 1C9PA 3Q3KA 4O97A 2JETB 4NA7A 1ANBA 3TJUA 3V0XA 4X6PA 1G36A 3TNTA 1T8LA 1C2HA 4LZ1H 1NRNH 2G51A 3EYDA 1P09A 3KF2A 1C1PA 3O8BA 2XBXA 1SGIB 3SV8A 1WAYB 3VPKA 3KGPA 5C5OA 1DDJA 2HRVA 2WV5A 2R2MB 1C1RA 1SGFG 3LKWA 4JYTA 3GCNA 2XC0A 1ZMLA 1O5CB 3RXIA 3NWUA 1YPGH 1HJ8A 1YM0A 2FYQA 4I8GA 2C8WB 1BTPA 1NROH 3TGJE 1MUEB 2V6NA 4VGCB 3MO9A 2PKSC 2W7UA 3SU3A 1CGJE 2CHAC 1SR5C 1DVAH 1S6FA 5DG6A 5SGAE 3ZYEA 3ATLA 4INLA 1GCTB 2BD9A 2D2DA 1C1QA 1IQGA 2WPMS 1UVUH 4JMYA 1YPJH 5FBIA 4X8VH 4NFFA 3SUGA 4SGBE 2EI7A 2BD4A 1AE8H 3MWIU 1GI7B 4OS7A 2THFB 3DD2H 4DJZB 3RXTA 3OSYA 4ISOA 3BTHE 2WPJS 2VH0A 1TNLA 2FLBH 3H7OA 5TCAA 1ETRH 3SJKA 1DXPA 2C90B 1P3EA 4IGDA 1F2SE 4LZ4B 1GJ6A 4I8HA 1JIRA 3LGVA 4X2WA 1E37B 1AVWA 1P03A 2BDYA 1NRSH 2PTNA 1O39A 1P9SA 1QFKH 1XMNB 3MOCA 1RTKA 1Q3XA 4JCNA 3I77A 1KDQA 1FAXA 1O2PA 1ZJDA 1ESTA 3RM0H 3SGBE 1S82A 1NN6A 5TCCA 1HV7A 3NXPA 1NRQH 3ZVDA 5JB9S 3R0FA 5GWZA 4OS2A 1TNKA 4UONA 2OC7A 5F8XA 1GBIA 2GCHG 4I31A 1GL1A 1TPPA 2NU1E 2VIWA 1FN6A 4D8NA 4F49A 4B74A 4FVBA 1A5GH 2CN0H 1MKWH 2PR3A 2ZO3H 1IQJA 2B7DH 3TGKE 1C5VA 1BTUA 4KELA 1W13U 4K1EA 1XUHA 2G52A 3E6PH 2ZDMA 2C8YB 2P59A 4FXGH 4Z0KA 1KXAA 3M5LA 4Y71A 3T28A 1O5GH 1MCTA 3MYWA 1SQTA 3P8FA 3D49H 4INKA 4E7RG 4TWYA 2ANKH 1GBTA 1TB6H 2ALVA 3Q3XA 4NIYA 4DT7B 4R0IA 4I7YH 2ZQ2A 2QCYA 4RKOB 2FOAA 1ELBA 2F9UA 4K8BA 1UMAH 3SI4H 1T32A 3I78A 3U98H 1SGRE 1DXWA 1C5TA 2GZ8A 1C5YB 1L1JA 1WQVH 1Z8IB 5GJ4B 1FJSA 2TBSA 1SGQE 3BG8A 3MU0A 4IBLH 3BTKE 3A7XA 4ZKNU 3F9HA 1DLKB 1WTHD 3BTEE 2GVFA 2WYJA 1O2YA 1BHXF 1OPHB 1SLUB 1A46H 1UHBB 1FY8E 2BXTH 2Z9JA 1GDQA 2ZNKH 3C27B 2CJIA 4NA8A 1NM6A 5DPAA 4TPYA 1YC0A 1HJ9A 1C5SA 1N8OC 5F8ZA 4GPGA 5EW1H 4X1SU 2SFAA 2GT8A 1VCQA 1F0TA 2ZCLP 5EPYA 2PGBB 1E34B 2CV3A 1UHBA 4Y7AA 1C2KA 2XC4A 1G30B 3QUMP 1GDUA 5ESTE 3MU4A 2P3UB 4CRAA 2GP9B 1TPSA 1W3CA 4MNXA 1FPHH 4ZHLU 2HVXA 1YPHE 1OWIA 2UWOA 2ZC9H 4NSVA 1AKSB 1KXDA 3M5MA 1SGDE 3RXMA 1GMCF 1AE5A 1C5OH 1IQLA 1RRKA 3GYMA 4CR5A 1GHBG 1HYLA 3CP7A 3V3MA 4BXSA 2C8XB 3BTGE 5HXFA 1MU6B 3O8DA 1O5EH 2R0KA 1ZJKA 1NFXA 2TGTA 2EI8A 4B2CA 1GI8B 4UFFH 1UTPA 5ABWA 4TPIZ 4H6SB 1BBRE 3TGIE 1Y3VA 2BX3A 3SN8A 1EJAA 1BT7A 5FBEA 4PROA 4NA9H 4X6NA 2AIPA 1ZSKA 2F91A 2BY8X 4IMQA 4KGAA 3LONA 1D3DB 2ZDAH 1C5XB 1FI8A 5GPIB 1FY5A 1CHGA 1LHCH 2H2ZA 3UWJH 4FU8A 2ZHFH 2IPHA 5A8XA 2A0QB 2ASUB 4U01A 1O3PB 1ANCA 2BD5A 1V2LT 3ZVGA 3TK5A 5C1UA 3TITA 3MFJA 1V2VT 2VGCC 1TPOA 2OINA 1QRWA 3ATIA 3BTME 4I8KA 1E35B 4UE7H 2JH6D 1O2JA 3A89A 2EA3A 1NFUA 4OS4A 1Q31A 2A4RA 2DE8A 1AKSA 3ESTA 3IG6B 2AERH 1CBWB 2G4TA 1UCYE 1O2UA 3P92A 4B73A 4BTIB 1C1NA 4AGKA 1K1PA 2UUKB 3H7TA 1D6RA 1O37A 3E0PB 4MLFB 4ZH8A 2HPPH 2Y80A 1G37A 3RMMH 2PKAA 2Z3EA 4I8JA 2PHBA 5L2ZH 1HJAB 1DICA 1HUTH 1EATA 4AYYB 5DJ7A 5DK1A 2NU3E 1UTNA 1SGEE 1LPZB 1TBRH 3ODFA 4U32A 1ID5H 1GHZA 3RXFA 5JBAS 3SU0A 3TH3H 1CO7E 2PV9B 1WTGH 3UY9A 2BQ7B 3T2NA 2RDLA 2PSXA 6ESTA 4D9QA 1AN1E 5C2ZA 1HAOH 3BEFB 3T5FH 4JZDH 2BMGB 1SQAA 2ZU2A 2NWNA 1TFXA 4WXIA 1P0SH 5L30H 1EPTA 2Y81A 1FPCH 1JWTA 1S6HA 1OP2A 3Q76A 1OKXA 1O3KA 3PMJA 7GCHF 3SW2B 4B71A 3GY3A 3SGAE 1TAWA 1P2IA 1PPEE 3GCHB 4WXVA 5EXNA 1MTUA 3TH2H 4E06H 4X2XA 1EZXC 4FUBA 1WYKA 2PTCE 4TY6A 4D9RA 1C5UA 2QY0B 3SV9A 1ARBA 3A8AA 2WYGA 3FP8E 1GI5A 3BTQE 1IHSH 1C5MD 1W0ZU 1AY6H 3GDVA 4A92A 4GLYA 1O2KA 1V2JT 8LPRA 5GCHG 3PLKA 2QN5T 4TY7A 1UCYK 1PPZA 1PPFE 3OX7U 3QZRA 3TNSA 3Q77A 2A7JA 1AQ7A 1PYTC 2AMDA 3U8RH 3PMHB 2G00A 1SGCA 1V2KT 1W8BH 3DT0H 9LPRA 1SB1H 5DP6A 5GXPA 3GICB 1V2ST 1P2OA 3S69A 3SUDA 4D7FA 2D26C 3UQOA 2XCFA 5F8TA 1C5LH 1AD8H 1KXCA 2EI6A 2ZQ1A 3PB1E 1Z1IA 3SNBA 3RDZA 5IYTA 1TYNA 3MNBA 3SOSA 1UTQA 2LNCA 2CGAA 1MQ6A 1YCPH 1VCWA 2ZTXA 2QYIA 3I29A 1BZXE 2OQUA 4ZAEA 1TMTH 3GY4A 5JBCS 4B2BA 1SGYE 1EZSC 3HATH 3MH5A 5AFZH 5FCRA 4I33A 4DVAU 4F4OC 3RMOH 1P2NA 2QAAA 2P8OC 1XVOA 2YNAA 1MBQA 2STBE 4CRDA 1YCPM 2OBQA 2AGEX 6GCHF 4DGJA 5J4QA 3QGJA 1C2LA 1GMHG 1RXPA 5FX6A 4UFDH 5LGOA 4HTCH 1DLEA 2DE9A 1MKWK 3LPRA 3QZQA 1TNHA 1J8AA 1UTMA 2A5AA 3A84A 3SQHE 3MHWU 4H4FA 3RLWH 4AGJA 1K1LA 2AMQA 1C5QA 1GMDG 1SFIA 1UTKA 2JKHA 1JMOH 4X6MA 1TBZH 1B0FA 4IW4E 2CMYA 2V35A 3DFLA 1C1MA 1GJAB 2ANMH 4K5ZA 1P2QA 2FDAA 1YGCH 1OYQA 1JIMA 7ESTE 5LPFA 3L33A 3LGTA 1FY4A 1GI1A 1QR3E 1Q2WA 1S0QA 3KL6A 1FIWA 1F0SA 2F9VA 2GDDA 1SOZA 1F0UA 5GIBA 5AVDA 2IOTA 3N7OA 4OGYA 3ZVFA 1VITH 4DIIH 1QJ7B 4FUGA 1SLWB 1FAKH 1GMCG 3FVFB 4GSOA 2R0LA 2G8TA 1EXFA 4K60A 3A88A 2BY6X 1O2VA 2FTLE 1TGSZ 1MTWA 1SOTA 3E8LA 5K0HA 3TU7H 5I46H 1Z8JB 2FS8A 4JZ1A 3ZVEA 3PO1B 5A0AE 1KDQB 1MMJN 1FY3A 1RTLA 1EZQA 2QGRA 1YCPK 5T3HA 1BMMH 5F03A 5C3NA 3LU9B 2BDCA 1MCVA 2G5VA 2ZGCA 1LKBA 5AF9H 3T27A 2SNWA 1S5SA 1LTOA 2B5TB 2ZU5A 3LT3A 4H6TA 3QX5H 4X0WU 3T62A 1A4WH 2BY9X 4KKDA 5H4IB 1Y59T 1BTHH 1GHAF 1MQ5A 1NRRH 4RKJB 2FX6A 2UUYA 3FAOA 4NWLA 3DFJA 1FXYA 1P8VC 1JOUB 2Q6FA 4ZMAH 3D65E 4I8LA 3LH1A 2D8WA 3UR6A 1UCYH 4JYVH 1GGDC 1GL0E 1B7XB 2ZFRH 3V7TA 2WUBA 4KP0A 1D3TB 2D1JA 2W3IA 4CRFA 3UOUA 2RG3A 3LIWA 1K9OE 1AFEH 2H9EH 1HDTH 4CHAB 1O2HA 1Z6JH 1PYTD 1ESAA 2PUQH 2BD3A 2OC8A 1AWHB 1GBJA 2FM2A 1UK2A 1FZZA 3BEUA 1O32A 1QGFA 1GVLA 2Q6DA 1A1RA 1V2RT 5C1XA 2J92A 2BOKA 2A31A 2FOGA 1EB2A 1ZHPA 4MPWA 1L4DA 4YLQH 4CRGA 1L4ZA 3VXFH 5C5NA 5JDUB 1PPBH 4B2AA 1HPGA 1O3GA 1U6QA 1L1NA 1W14U 5EOKA 3OYPA 5PTPA 2SGQE 3T26A 1DFPA 3SU4A 1ZSLA 1KIGH 1C1SA 1C2GA 1C4V2 2ODYB 1H8DH 1WUNH 3U9AH 1TQ7B 2UUJB 1QB1A 5E0GA 1Z8GA 1S85A 4A7IB 3SI3H 1SGPE 1QBOA 3UIRA 1G2LA 1O2IA 4WJG2 4JK5A 4Y10E 1C2FA 1JRTA 3L6PA 1FNIA 3SGQE 3SUFA 4ABFA 3ZVAA 1XUJA 1NS3A 2PW8H 1DWCH 2QXJA 4FU7A 1V2OT 3T25A 1LHDH 3A7TA 2PKSB 4FU9A 8GCHF 2O9QA 3E0NB 2XTTB 1WSSH 2BYAX 3CS7A 4CBNA 1QQUA 2FP7B 1ABIH 1SPJA 1AHTH 1NFYA 4MNVA 1IAUA 3DA9B 1SI5H 2Q6GA 1MU8B 1FIZA 3QTOH 2BDAA 2GMTC 3URDA 3WY8A 2GZ9A 1P12E 4BAMB 2WPIS 1EAXA 1QNJA 2KAIA 1XUGA 2A4OA 3EGKH 3FFGA 2BDGA 1LQEA 4YZUA 3BG4B 1TX8A 1V6DA 1EUFA 1K1MA 2OTVA 2FO9A 1S84A 5EPNA 4AN7A 3A86A 3A8BA 1BTYA 3P17H 3PTBA 5BRRE 1NTPA 2TGPZ 2FX4A 1ELTA 3GCTG 2Z3DA 3M7QA 1MTVA 2TPIZ 4K3JA 2BDBA 3JZ1B 2O8LA 1QRZA 1N6XA 1ZOMA 7LPRA 2BLWA 4Q7YA 3VGCC 1XXFA 4HI3A 1O3JA 2W3KA 1O3IA 1ZR0A 4GHQA 4ZXYH 5DP4A 1QY6A 1P05A 1P2MA 3ENSB 4K1SA 1O2QA 4ABJA 1XM1A 1F5LA 4NG9H 4KTUA 5J4SA 3ZYDA 3D23A 2BY5X 2P16A 1CBWC 3PMBB 3SV2H 1ETTH 3PM3A 4XBCA 3AW0A 3KQEA 1EPTC 5C1YA 2VJ1A 4A5TS 2SGEE 2GTBA 4UEHH 4MPVA 1D3PB 4WH8A 3AW1A 3EE0B 1TNGA 1QA0A 3IWMA 3MO3A 4AYVB 1AGJA 1EAUA 3PMAB 2B0FA 1KLJH 2BXUH 1TBQH 3ZZDA 1HRTH 2WPLS 2ZCKP 2ZFQH 2A7HA 1BJUA 3RUOA 1XKAC 1C5WB 2ZDNA 4Y8YA 4YOGA 3TK6A 1WU1A 2PWXA 1DITH 2FTMA 3MU1A 5DP8A 2XWAA 1GCDA 3Q00A 1QB6A 4IS5A 3RXEA 2A45B 4WVPE 1LHFH 2JH5D 2XNIA 1V2TT 3UR9A 2A4GA 1V3XA 4OS1A 3FANA 3F9GA 1FDPA 1C2IA 2G5NA 5DGJA 4A6LA 3ZVBA 1O2TA 1B0EA 3PV4A 5HM9A 3UNSA 1O38A 3M61U 1FLEE 3ITIA 1GBCA 1JXPA 3LDXH 1TPAE 1Y3UA 5HGGA 2BD7A 2TRMA 1CT0E 1LMWB 1YYY1 4X1PU 4DIHH 1ZHMA 3BIUH 3ODDA 4H42U 1EPTB 1GI2A 3GY8A 1KTTB 1OSSA 4DURA 1WV7H 1Y5AT 8GCHG 2FIRH 2HNTE 3LC5A 2GV6A 3GY6A 4ABHA 1O2XA 3SJ8A 1GI9B 3OU0A 3S9AA 4AOQA 2G4UA 3RXHA 4TYDA 1GCTC 4HFPB 3NUMA 1GGDB 2WPHS 3RXDA 3RU4E 1J9CH 1O2SA 5EQRA 1RIWB 1GI6A 3VB5A 1YPMH 1G3EA 1Y8TA 4XDEA 4LK4A 3ZZ3A 1M9UA 3BN9A 1K2I1 1D3QB 1W0YH 3RU4T 1N1LA 1T8MA 1SGNE 4J2YB 4A1VA 1Y3WA 1AO5A 3B23B 1GBLA 4B76A 1VJ9U 1AMHA 1HAIH 1G9IE 1NFWA 5EW2H 1AUJA 3GCOA 1WOFA 1TALA 4INHA 4Q7XA 2PLXA 3ELAH 2GV7A 1W10U 1CQQA 1K1JA 1O0DH 4FUCA 1GBFA 1TA6A 1AU8A 1OOKB 3AVZA 4XBDA 1MZDA 2ZFPH 1VITG 1HAHH 3SUEA 1YLDA 3SU6A 4X8UH 1OYTH 5DKMA 1T8OA 1ELAA 1AFQC 3BV9B 3P6ZB 1IOEA 1HCGA 4I32A 4Q2KA 3D62A 5E0HA 3M5NA 4GCHF 1BBRK 1BIOA 1XUIA 1RS0A 2HNTC 1P02A 1O3AA 3PWBA 3LJOA 2UUFB 1GG6B 1GBMA 3BTDE 4K1TA 3TJVA 1ZTJA 3V13A 4XE4A 1LPKB 1T4UH 1GBKA 3F68H 2K1QA 1P9UA 2GCHF 3ZZ8A 4KTSA 1MAXA 3K65B 4ABBA 2Z9IA 1NPMA 2BDHA 1ZMNA 1AB9C 1TGTA 3RU4D 3MTYA 4JZFH 1GMDF 2PUXB 1YF4A 4O3TA 2FODA 3QGNB 1FY1A 1RIWC 3TPIZ 1OS8A 2BVRH 2BD8A 1AWFH 1RD3B 1TQ0B 4X1QU 3ZZCA 4XBBA 3E90B 1OWDA 4BAKB 1C2JA 3M5OA 2QC2A 3UFAA 1KLIH 3VXEH 4O9VA 1VGCB 1XUFA 1AVXA 4OS5A 2GD4B 4D7GA 1CA8B 1Y5UT 4NIXA 3ZZ4A 3TJOA 2HOBA 2FOCA 1V2NT 1O2GH 4DG4A 3T29A 3SJIA 1TX6A 1Z7KA 2EEKA 2C4FH 3RC5A 1ZPBA 4K8YA 5C67A 5HYOA 3B8JA 1IQMA 1GWAA 1EQ9A 2VNTA 2IJOB 1EJNA 2Z3CA 2FOMB 1D6WA 1C2DA 4IC6A 1H9IE 1HAYB 2XWBI 4FUFA 2Z9LA 4BAQB 1INCA 3ZV9A 1SG8B 2BHGA 3A7ZA 1LCYA 2OXSA 5HMAA 1O2MA 5E0JA 3UNRA 3NZIA 3RMLH 2YOLA 1KXFA 1O33A 1K1IA 3SHAH 2V3OH 3QN7A 1ELFA 4Y6DA 5FX5A 2ZDKA 2HNTF 1KXBA 1MD7A 1HBTH 5EGMA 1FV9A 3RXBA 1ELEE 1O30A 3RXJA 1ZTKA 3HK6B 1LHEH 2A2QH 8KME2 1NZQH 5DP9A 1TE0A 4NCYA 4BNRA 1A2CH 1CT4E 1QBVH 1DY8A 1QJ1B 1ELGA 3UOPA 1BDAA 2Z94A 1HLTH 2BTCE 3MI4A 4X2YA 1N6YA 1HAVB 1GJDB 2ZPSA 4CH8B 1AZZA 1EP6A 2P95A 1GBBA 4JYUH 2J95A 1MAYA 1SL3A 2FI4E 2AS9A 1TX7A 1K1NA 2Z7FE 3CS0A 1CGHA 3ZZ7A 3DUXH 3GDUA 3MH7A 1WBGB 4AB8A 3ATWA 2VIPA 4Y79A 4DOQA 1O3CA 1GHBF 3ZZBA 2ZGXH 1OWKA 1A3BH 8ESTE 3JZ2B 3EDXB 4XOJA 2PGQB 1L2EA 2OUAA 3A82A 4X8TH 2AGIX 3ZVCA 1O3HA 1PQ5A 6GCHG 1H8IH 2VGCB 2HPQH 5A09A 2BX4A 1C1OA 1C5NH 1IHTH 1K21H 3LOXA 1BRAA 2QXIA 2W5EA 2O8MA 4NIVA 4YT7H 2QXGA 1G2MA 2FOEA 4X1NU 4DW2U 4CREA 4FUJA 4BTUB 1LDTT 4WMFA 3W94A 2STAE 3OY6U 4ZHMU 3KQBA 4X6OA 1D9IA 2VWNA 2FS9A 1Z71A 1LVBA 1GI4A 4Y11E 1GJBB 4NIWA 4IMZA 1QL7A 1CHOF 4WF8A 3P8NA 1A0JA 1HAGE 2ZHEH 1MBMA 3MU5A 4GVUA 1OXGA 2BM2A 2XW9A 1ZHRA 4UFGH 1GHXH 3STIA 3RXOA 2OLGA 3BIVH 4TWWA 1DX5M 4Y76A 2C93B 4Y7BA 3U1IB 1TOCB 5EXLA 2BZAA 3RXVA 4O03A 1G3CA 1RTFB 1LO6A 4MDSA 3RXRA 3SZNA 2ZA5A 1C9TA 3BSQA 2AYWA 3F9FA 4YT6H 5JB8S 1SSXA 3K6YA 4IN1A 1BOQA 2G55A 3KQCA 1C4U2 1SMFE 2VWLA 1ESBA 1XKBC 1KSNA 3SO3A 3LC3A 1EX3A 3A8CA 4GHTA 4MNYA 2ZKSA 3S0NA 2R9PA 3LGIA 3E3TA 2ZU3A 1DS2E 1BBRH 2W26A 4Q7ZA 1TMBH 4AX9H 4ABAA 2ZGHA 1EJMA 5AFYH 2V0BA 3U8OH 2RCEA 4BOHA 1GHWH 1BRCE 3P95A 2HALA 3UUZA 3SQEE 3GDSA 3MO6A 7GCHG 3RXLA 5EG4A 1GI3A 3LJJA 2ZTYA 2BDIA 2ZU1A 3SORA 1FONA 1YKTA 1SFQB 1ZPCA 4OS6A 2Y7XA 2F3CE 1E36B 1AI8H 1ELCA 1P11E 1TGBA 1YPKH 4MQAA 2FLRH 4CRCA 2F9OA 1QA7A 2FI3E 4K69A 2JH0D 4AFSA 3RXSA 4ZUHA 4MVNA 2BZ6H 1QURH 4YM9A 2ULLA 1VGCC 1T7CA 1PPCE 1GBHA 1XXDA 2PFEA 1NU7B 5IDKA 1DE7H 1BTWA 3A81A 4U2WA 4CH2B 2A1DB 2HGTH 1ETSH 1ZZZA 1KXEA 1L0ZA 4MPUA 4ZHAA 2FWWA 3VB3A 2FPZA 3P8OA 1THRH 3TVJB 1P10A 4FUEA 2IN2A 1GJ9B 3GY7A 3TIUA 3KIDU 2FESH 1T8NA 2TGAA 1C1UH 4B1TA 1EKBB 1BJVA 5CHAC 1A61H 1A0HB 1C5RA 1PQ7A 2WINI 3FP6E 1NESE 3EA9A 4AFQA 3A85A 5EQQA 1A0LA 3IITA 3S7KB 2XBVA 1IQFA 1TRNA 2A5KA 3MNXA 1ELVA 5JBTA 4MPXA 1GVKB 3G01A 1AIXH 4Y0ZE 2ZEBA 1SQOA 2NU0E 4ABIA 1NT1A 1W7XH 2KAIB 2J2UA 1VCPA 4FUHA 3NK8A 1H9HE 1ORFA 4NZQA 4BAOB 1GJCB 4O3UA 1IQNA 2XYAA 2GCTB 1O2RA 1O35A 2SNVA 3P8GA 4MG3A 2J9NA 4X2VA 1Z8RA 2HLCA 3VEQB 3GCTF 1G3BA 1WQSA 1Z6EA 1QIXB 2BVXH 3BTTE 3VB4A 5DO4H 1LKAA 2A4QA 2ZGJA 1CT2E 1O5DH 1Y5BT 4DY7B 5C20A 5LPRA 1FUJA 5JPMH 1UVTH 3SNCA 1C4Y2 3U69H 4J1YA 3HPTB 1BMLA 3CENA 1OX1A 3V12A 4NSYA 1ANDA 1DUAA 2ZHDA 2ZWLH 1O2NA 2C8ZB 2NU2E 1D4PB 3HKIB 1HAVA 4XFQA 4BAHB 1O3EA 1W12U 3OY5U 1LVYA 4WMEA 1AFQB 2H5CA 2OD3B 1WCZA 4AZ2B 2BQWB 3QK1A 1SLXB 1O2OA 1DM4B 1F5KU 4AORA 1O34A 4AG2A 2ZDLA 2I6SA 2O8TA 2RA3A 1VR1H 1VZQH 2FOBA 2Y5GA 2ZF0H 5CHAB 5CMXH 1DY9A 1QL8A 1TGCA 4A1XA 1A5IA 1KTSB 2R3YA 4ZKSU 1NO9H 2ESTE 3PLBA 1PFXC 2ZIQH 1IQEA 1TIOA 1QJ6B 2AMPA 5EQSA 1UVOA 1J16A 1EAWA 2ZP0H 2ZHWH 2FMJA 1CSOE 3SU1A 1FQ3A 3FZDA 2UWPA 2AH4X 3KCGH 3Q3YA 3RXPA 1C2EA 1BRUP 1BTXA 2VVUA 2Y5FA 3AAUA 2C3SA 1ELDE 1YP9A 4NZLA 1C5PA 4YOJA 3A7YA 2BB4A 2GCTC 4ISLA 3F9EA 3PYHA 1THPB 3DHKH 1E38B 1QBNA 1P3CA 2XCNA 3RP2A 1YPEH 2OBOA 5BPEA 1MTNC 3EQ0H 3KNXA 2F9PA 2Y5HA 1GJ4H 3FZZA 1XX9A 1O3DA 1Y3XA 1MH0A 3ATMA 1EB1H 1P2JA 3HKJB 2ILNA 4WH6A 2BOHB 2SGPE 1LPGB 4RN6A 4LXBH 2DUCA 1FN8A 4SGAE 3BTWE 2P8OB 5FCKA 2A5IA 1ANEA 1OWEA 2ZDVH 5E2OA 1CA0C 1UTOA 4AG1A 1TRMA 2J94A 1GJ8B 1G32B 1C1TA 2ZGBH 1LQDB 1IQHA 2FXRA 1UK4A 3F6UH 4YLUA 2QXHA 3EAJA 2V3HH 2BQ6B 2J34A 1ZRBA 1TONA 3BG4C 1EOLA 1V2MT 2A7CA 1GHVH 1HFDA 2Y7ZA 3QWCH 1C5ZB 3LGYA 1B5GH 2B9LA 2ZCHP 3EA8A 4GAWA 4HGCA 4ASHA
chains in the Genus database with same CATH superfamily
2EC9H 4RI0A 1TWXB 1GI0A 4ZKRU 5FXLA 3SNAA 3PWCA 3UQVA 3MH6A 5K7RA 1G3DA 1MD8A 2W7SA 4Y8XA 3A8DA 4ABEA 3VB6A 3LH3A 1MTNB 1O5BB 4IC5A 3QTVH 2KZ4A 2OK5A 2L6OA 2QF5A 1O2ZA 1P57B 3FP7E 1GBDA 3SV6A 3UAIC 1MZAA 3N99A 4ISNA 2O8WA 2M5TA 1DPOA 2HLDD 1IQKA 1QQ4A 2J4IA 5E2PA 5LH8A 3E1XB 1ARCA 1HGTH 2YNBA 4NGAH 1N8OB 3L3TA 1DWBH 3SJOA 3GY2A 3ZZAA 5E8EH 3SJ9A 1YPHC 2YMSC 1LVMA 1HAXB 1L1GA 2FZZA 2QV1A 4Y8ZA 3PTNA 5EXMA 1T31A 3OE7D 3QDZB 1O3LA 4Q4LA 3NKKA 2XBWA 1BQYA 1TA2A 3SNEA 1HXFH 1OP8A 1VJAU 3GCHC 1QTFA 4R8TB 3SU5A 3RC4A 3VFEA 1F5RA 1PQAA 1VITF 2AEIH 1GVZA 1V2PT 3B9FH 1GG6C 4BANB 5A8YA 1GBAA 1GJ7B 3DSPA 5GNDA 1S0RA 3URCA 6CHAC 4Q80A 3RXQA 3PLPA 1HAZB 2CHAB 2ZPQA 2ODQA 2Y6TA 1OWHA 2AGGX 5HM2A 5T6FA 1ZPZA 1W2KH 2J38A 3CNRA 4TT3D 4JK6A 1AB9B 1BITA 2BLVA 2H6MA 1CA0B 5A0BA 5B6OA 3KEEA 3GYLB 2G81E 1TRYA 3H5CB 1AVGH 2PSYA 1UO6A 2P93A 1KLTA 4B75A 3KN2A 3MU8A 3HGPA 1TNIA 1TNJA 3R3GB 4UD9H 1SC8U 1GDNA 1E0FD 2XOKD 3SV7A 2FYRA 3E91A 4WY3A 1GHYH 1O5AB 3KHVA 2AIQA 1HAPH 1UVSH 1SLVB 3A83A 5GCHF 2ZFSA 3M3SA 1BCUH 2ZFFH 1W0JD 2ZFTA 3AAVA 3LGWA 1JRSA 2FI5E 2HWLB 1C1VH 1SHYA 3ATKA 5CE1A 2R3UA 1V2WT 3MMGA 4M7GA 4YTAA 4X1RU 4UFEH 4ZKOU 2Z6BD 4LOYH 1GJ5H 1DSTA 2ODPA 1UVPA 1MKXK 6CHAB 3C1KA 1O3NA 5FL7D 1J14A 2UWLA 1TOMH 3A80A 1Y3YA 2H5DA 3GY5A 3RXGA 3ZZ5A 3SBKA 5DP3A 3ZZ9A 1ZGVA 4HZHA 1HJAC 2P3FH 4CBOA 1C2MA 3PROA 1CE5A 1A7SA 3O8CA 3LGUA 2PP6A 4AB9A 1NU9A 2XXLA 2R2WU 3BF6H 3A87A 1CGIE 2ZHQH 3STJA 2BVSH 4JZEH 3W95A 4AFZA 4A1TA 3UNQA 1J17T 2I6QA 1O36A 5I25A 3PV5A 3RM2H 1F7ZA 4ISHH 2ANWA 1KY9A 1O3MA 9ESTA 2WV4A 1PQ8A 3AK5A 4FUIA 1H4WA 3S9CA 2Q1JA 2LELA 5JYIA 4YOIA 2BLQA 2GMTB 3RMNH 5EODA 1GHAG 3M35A 2QA9E 1FMGA 2VB0A 3WW7A 1GPZA 3RLYH 3M7UA 2HVYB 3VGCB 4CR9A 1EOJA 4BXWA 2BLOA 1TMUH 1QL9A 1BA8B 2VWMA 4TSFD 4UDWH 1PPHE 1ZTLA 1TABE 5TJXA 1TGNA 2TIOA 2VH6A 5FPSA 2VVCA 2H9HA 2NU4E 5AHGH 1OP0A 3BTFE 2ZECA 3UTUH 5G4BA 7KMEH 5A2MH 1BHXB 2ZTZA 4THNH 1BB0B 3NCLA 3TK9A 4U30A 1RGQA 3M3TA 3K9XB 4E05H 2WUCA 2KR7A 5L6NH 1A5HA 2F43B 2B8OH 2QF0A 2PKAB 1T4VH 2VIOA 5T6GA 5LPEA 1EP5A 4BTTB 4CRBA 2GZ7A 1UTLM 5FAHA 2SGAA 3A7VA 4QT8C 1BRBE 1RFNA 3MNSA 2J98B 2QF3A 3M3VA 1OWJA 1XUKA 4D76A 2P94A 5ESBA 2J97A 2XRCA 1TLDA 1ZLRA 1O2LA 5T6DA 2VVVA 1ZRKA 3VB7A 2XBYA 1CU1A 1O2WA 1W7GH 2OQ5A 1HXEH 1SGFA 3GOVB 1O5FH 1YPLH 3SU2A 1SBWA 3F0OA 5FHTA 2P3TB 4X8SH 4GUXA 1W11U 5FPTA 2GX4A 2ZI2H 3QLPH 3SNDA 2XC5A 3M7TA 3HK3B 2BY7X 4B6EA 3M36A 2Y82A 2OC0A 2OC1A 2JDID 2QIQA 2VINA 1UJ1A 2CF9H 2AFQB 5A0CA 4FUDA 3S9BA 1S81A 3S7HB 5IK2D 3M37A 3TJNA 1O3OA 4FVDA 1NC6A 5DSFA 3O8RA 5GDSH 1CVWH 1NY22 2VWOA 2OCVB 1QB9A 4OGXA 1EAIA 4K2YA 4JZIA 4MNWA 1F0RA 4YO9A 5DP7A 3RXKA 1ZMJA 2VIVA 1Z1JA 3A7WA 5JBBS 1J15A 2Z9KA 1IQIA 2EQNA 3E16B 5EU8A 2A2XH 2RA0A 3U8TH 2GGVB 4ABDA 2WPKS 5KEDA 4ZROA 3GS9A 3KQDA 3UPEA 1XVMA 1DUEA 1EASA 1NRPH 2ZG0H 4ABGA 3MNCA 3K6ZA 1YLCA 2ZZUH 4NWKA 3RXCA 3QO6A 1CHOG 2VIQA 1K22H 1K1OA 1MTSA 3TH4H 5F6MA 6LPRA 1DOJA 4ISIH 1SGTA 2ZU4A 1ABJH 2SGDE 1LHGH 4IN2A 5A8ZA 1THSH 2VIDA 1P01A 4ZXXH 1O3BA 1BTZA 4NFEA 2GKVE 1A3EH 1PJPA 2A32A 1DT2A 1QCPA 3GISB 3UWIA 5L2YH 2Z9GA 3TLOA 1DWEH 1P04A 1GMHF 1DWDH 2VU8E 3F1SB 1SVPA 2OP9A 5FPYA 1KYNA 1H1BA 4MTBA 4XSKU 1ACBE 3RXAA 3PO1C 3EA7A 1HIAA 1BMNH 4KTCA 4DCDA 2JETC 5C94A 1HB0B 5ETXA 4AFUA 1GBEA 1JBUH 1BUIA 3BEIB 3P70B 1BMAA 1DANH 3ZV8A 2GDEH 3UREA 3ZIAD 1PPGE 2ALPA 5DP5A 2CF8H 4WMDA 2FEQH 1HIAB 1P06A 1H9LB 3H09A 2ANYA 2ZPRA 3HGNA 2CXVA 4RSPA 3F2HA 1SHHB 4WWYA 1S83A 2LPRA 1C1WH 2BD2A 2TGDA 3U1JB 4ESTE 1RJXB 1ZGIA 3MH4A 1QRXA 1V2UT 2FOFA 1X7AC 1MKXH 1O3FA 4E7NA 1P2KA 4YESB 3NPSA 2GT7A 2H9TH 4GCHG 4VGCC 2F9BH 1LVOA 3OTJE 1EZUC 1YBWA 1V2QT 1AZ8A 4CHAC 3MQKC 2SGFE 3ZZ6A 3K2UA 3AASA 1UTJA 3RC6A 1O31A 1DSUA 1HNEE 1QHRB 1UK3A 1ZSJA 5KGOA 2FOHA 2F9NA 4Z6AH 1ZYOA 2H1UA 2F83A 1AUTC 1F92A 1K28D 4Y0YE 2O8UA 3PV2A 3RXUA 3SHCH 1C9PA 3Q3KA 4O97A 2JETB 4NA7A 1ANBA 5F53A 3TJUA 3V0XA 4X6PA 2WV9A 1G36A 3TNTA 1T8LA 1C2HA 4LZ1H 1NRNH 2G51A 3EYDA 3DCLA 1P09A 3KF2A 1C1PA 3O8BA 1SGIB 2XBXA 3SV8A 1WAYB 3VPKA 3KGPA 5C5OA 1DDJA 2HRVA 2WV5A 2R2MB 1C1RA 5HIZA 1SGFG 3LKWA 4JYTA 3GCNA 2XC0A 1ZMLA 1O5CB 3RXIA 3NWUA 1YPGH 1HJ8A 1YM0A 2FYQA 4I8GA 2C8WB 1BTPA 1NROH 3TGJE 1MUEB 2V6NA 4VGCB 3MO9A 2PKSC 2W7UA 3SU3A 1CGJE 3DSGA 2CHAC 1SR5C 3OTPA 1DVAH 1S6FA 5DG6A 5SGAE 3ZYEA 2KM0A 3ATLA 4INLA 5EJLA 5EIYA 1GCTB 2BD9A 2D2DA 1C1QA 1IQGA 2WPMS 1UVUH 4JMYA 1YPJH 5FBIA 4X8VH 4NFFA 3SUGA 4SGBE 2EI7A 2WSSD 2BD4A 1AE8H 3MWIU 1GI7B 4OS7A 2THFB 3DD2H 4DJZB 3RXTA 3OSYA 4ISOA 3BTHE 2WPJS 2VH0A 1TNLA 1YY3A 2FLBH 3H7OA 5TCAA 1ETRH 3SJKA 1DXPA 2C90B 1P3EA 4IGDA 3KQ5A 1F2SE 4LZ4B 1GJ6A 4I8HA 1JIRA 3LGVA 4X2WA 1E37B 1AVWA 3W1EA 1P03A 1YWUA 2BDYA 1NRSH 2PTNA 1SQRA 1O39A 1P9SA 1QFKH 1XMNB 3MOCA 1RTKA 1Q3XA 4JCNA 3I77A 1KDQA 1FAXA 1O2PA 1ZJDA 1ESTA 3RM0H 3SGBE 1S82A 1NN6A 5TCCA 1HV7A 3NXPA 1NRQH 2RDEA 3ZVDA 5JB9S 3R0FA 5GWZA 4OS2A 1TNKA 4UONA 2OC7A 5F8XA 2VBCA 1GBIA 2GCHG 4I31A 1GL1A 1TPPA 2JJ1D 2NU1E 2VIWA 1FN6A 4D8NA 4F49A 4B74A 4FVBA 1A5GH 3F2GA 2CN0H 1MKWH 2PR3A 2ZO3H 1IQJA 2B7DH 3TGKE 1C5VA 1BTUA 4KELA 1W13U 4K1EA 1SKYE 1XUHA 2G52A 3E6PH 2ZDMA 2C8YB 2P59A 4FXGH 4Z0KA 1KXAA 3M5LA 4Y71A 3T28A 1O5GH 1MCTA 3MYWA 1SQTA 3KYFA 3P8FA 3D49H 1YLNA 4INKA 4E7RG 4TWYA 2JJ2D 2ANKH 1GBTA 1TB6H 2ALVA 3Q3XA 4NIYA 4DT7B 4R0IA 4I7YH 2ZQ2A 2QCYA 4RKOB 2FOAA 1ELBA 2F9UA 4K8BA 1UMAH 3SI4H 1T32A 3I78A 3U98H 1SGRE 1W0KD 1DXWA 1C5TA 2GZ8A 3PRDA 1C5YB 1L1JA 1WQVH 1Z8IB 5GJ4B 1FJSA 2TBSA 1SGQE 3BG8A 3MU0A 4IBLH 3BTKE 3A7XA 4ZKNU 3F9HA 1DLKB 1WTHD 3BTEE 2GVFA 2WYJA 1O2YA 1BHXF 1OPHB 1SLUB 1A46H 1UHBB 1FY8E 3WWFA 2BXTH 2Z9JA 1GDQA 2ZNKH 3C27B 2CJIA 4NA8A 1NM6A 5DPAA 4TPYA 1YC0A 1HJ9A 1C5SA 1N8OC 5F8ZA 3OEED 4GPGA 5EW1H 4X1SU 2SFAA 2GT8A 1VCQA 1F0TA 2ZCLP 5EPYA 2PGBB 1E34B 2CV3A 1UHBA 4Y7AA 1C2KA 2XC4A 1G30B 3QUMP 1GDUA 5ESTE 3MU4A 2K8IA 2P3UB 4CRAA 2GP9B 1TPSA 1W3CA 4MNXA 1FPHH 4ZHLU 2HVXA 1YPHE 2WHXA 1OWIA 2UWOA 2ZC9H 4NSVA 2EY4C 1AKSB 1KXDA 3M5MA 1SGDE 3RXMA 1GMCF 1AE5A 1C5OH 1IQLA 1RRKA 3GYMA 4CR5A 1GHBG 1HYLA 3CP7A 3V3MA 4BXSA 2C8XB 3BTGE 3FN8A 5HXFA 1MU6B 3O8DA 1O5EH 2R0KA 1ZJKA 1NFXA 2TGTA 3FOAA 2EI8A 4B2CA 4XRNA 1GI8B 4UFFH 2W6JD 1UTPA 5ABWA 4TPIZ 4H6SB 1BBRE 3TGIE 1Y3VA 2BX3A 3SN8A 1EJAA 1BT7A 5FBEA 4PROA 4NA9H 4X6NA 2AIPA 1ZSKA 2F91A 2BY8X 4IMQA 4KGAA 3LONA 1D3DB 2ZDAH 1C5XB 1FI8A 5GPIB 1FY5A 1CHGA 1E1QD 1LHCH 2H2ZA 3UWJH 4FU8A 2ZHFH 2IPHA 5A8XA 2A0QB 2ASUB 4U01A 1O3PB 1ANCA 2BD5A 1V2LT 3ZVGA 3TK5A 5C1UA 3TITA 4AC9A 3MFJA 1V2VT 2VGCC 1TPOA 2OINA 1QRWA 3ATIA 3BTME 4I8KA 1E35B 4UE7H 2JH6D 1O2JA 3A89A 2EA3A 1NFUA 4OS4A 1Q31A 2A4RA 2DE8A 1AKSA 3ESTA 3IG6B 2AERH 1CBWB 2G4TA 1UCYE 1O2UA 3P92A 4B73A 4BTIB 1C1NA 4AGKA 1K1PA 2UUKB 3H7TA 2J5UA 1D6RA 1O37A 3E0PB 4MLFB 4ZH8A 2HPPH 2Y80A 1G37A 3RMMH 2PKAA 2Z3EA 4I8JA 2PHBA 5L2ZH 1HJAB 1DICA 1HUTH 1EATA 4F55A 4AYYB 5DJ7A 5DK1A 2NU3E 1UTNA 1SGEE 3F2FA 1LPZB 1TBRH 3ODFA 4U32A 1ID5H 1GHZA 3RXFA 5JBAS 3SU0A 3TH3H 1CO7E 2PV9B 1WTGH 3UY9A 4Q63A 2BQ7B 4P00A 3T2NA 2RDLA 2PSXA 6ESTA 4D9QA 1AN1E 5C2ZA 1HAOH 3BEFB 3T5FH 4JZDH 2BMGB 1SQAA 2ZU2A 2NWNA 1TFXA 4WXIA 1P0SH 5L30H 1EPTA 2Y81A 1JWTA 1FPCH 1S6HA 1OP2A 3Q76A 1OKXA 3OAAD 1O3KA 3PMJA 7GCHF 3SW2B 4B71A 3GY3A 3SGAE 1TAWA 1P2IA 1PPEE 3GCHB 4WXVA 5EXNA 1MTUA 3TH2H 4E06H 4X2XA 1EZXC 4FUBA 5C0TA 1WYKA 2PTCE 4TY6A 5C0UA 4D9RA 1C5UA 2QY0B 3SV9A 1ARBA 3A8AA 1OHHD 2WYGA 3FP8E 1GI5A 3BTQE 5CHBA 1IHSH 1C5MD 1W0ZU 1AY6H 3GDVA 4A92A 4GLYA 1O2KA 1V2JT 8LPRA 5GCHG 3PLKA 2QN5T 4TY7A 1UCYK 1PPZA 1PPFE 3OX7U 3QZRA 3TNSA 3Q77A 2A7JA 1AQ7A 1PYTC 2AMDA 2WPDD 3U8RH 3PMHB 2G00A 1SGCA 1V2KT 1W8BH 3DT0H 9LPRA 1SB1H 5DP6A 5GXPA 3GICB 4HG6A 1V2ST 1P2OA 3S69A 3SUDA 4D7FA 2D26C 3UQOA 2QF4A 2XCFA 5F8TA 1C5LH 1AD8H 1KXCA 2EI6A 2XNDD 2ZQ1A 3PB1E 1Z1IA 3SNBA 3RDZA 5IYTA 1TYNA 3MNBA 3SOSA 1UTQA 2LNCA 4DT4A 2CGAA 1MQ6A 1YCPH 1VCWA 2ZTXA 2QYIA 3I29A 1BZXE 2OQUA 4ZAEA 1TMTH 3GY4A 5JBCS 2KCYA 4B2BA 1SGYE 1EZSC 3HATH 3MH5A 5AFZH 5FCRA 4I33A 4DVAU 4F4OC 3RMOH 1P2NA 2QAAA 2P8OC 4RT0A 1XVOA 2YNAA 1MBQA 2STBE 4CRDA 1YCPM 2OBQA 2AGEX 6GCHF 4DGJA 5J4QA 3QGJA 1C2LA 1GMHG 1RXPA 5FX6A 4UFDH 5LGOA 4HTCH 1DLEA 2DE9A 1MKWK 3LPRA 3QZQA 1TNHA 1J8AA 1UTMA 2A5AA 3A84A 3SQHE 3MHWU 4H4FA 3RLWH 4AGJA 1K1LA 2AMQA 1C5QA 1GMDG 1SFIA 1UW7A 1UTKA 2JKHA 1JMOH 4X6MA 1TBZH 1B0FA 4IW4E 2CMYA 2V35A 3DFLA 1C1MA 1GJAB 2ANMH 4K5ZA 1P2QA 2FDAA 1YGCH 1OYQA 1JIMA 7ESTE 5LPFA 3L33A 3LGTA 1FY4A 1GI1A 1QR3E 1Q2WA 1S0QA 3KL6A 1FIWA 1F0SA 2F9VA 2GDDA 1SOZA 3F0PA 1F0UA 5GIBA 5AVDA 2IOTA 3N7OA 4OGYA 3ZVFA 1VITH 4DIIH 1QJ7B 4FUGA 1SLWB 1FAKH 1GMCG 3FVFB 1QZ8A 4GSOA 2R0LA 2G8TA 1EXFA 5B6LA 4K60A 3A88A 2BY6X 1O2VA 1MABB 2FTLE 1TGSZ 1MTWA 1SOTA 3E8LA 5K0HA 3TU7H 5I46H 1Z8JB 2FS8A 4JZ1A 3ZVEA 3PO1B 5A0AE 1KDQB 1MMJN 1FY3A 1RTLA 1EZQA 2QGRA 1YCPK 5T3HA 1BMMH 5F03A 5C3NA 3LU9B 2BDCA 4M9FA 1MCVA 2G5VA 2ZGCA 1LKBA 5AF9H 3T27A 2SNWA 1S5SA 1LTOA 2B5TB 2ZU5A 3LT3A 4H6TA 3QX5H 4X0WU 3T62A 1A4WH 2BY9X 4KKDA 5H4IB 1Y59T 1BTHH 1GHAF 1MQ5A 1NRRH 4RKJB 2FX6A 3WWBA 2UUYA 3FAOA 4NWLA 3DFJA 1FXYA 1P8VC 1JOUB 2YMSB 2Q6FA 4ZMAH 3D65E 2KCAA 4I8LA 3LH1A 2D8WA 3UR6A 1UCYH 4JYVH 1GGDC 1GL0E 1B7XB 2ZFRH 3V7TA 2WUBA 4KP0A 1D3TB 2K0QA 2D1JA 2W3IA 4CRFA 3UOUA 2RG3A 3LIWA 1K9OE 1AFEH 2H9EH 1HDTH 4CHAB 1O2HA 1Z6JH 1PYTD 1ESAA 2PUQH 2BD3A 2OC8A 1AWHB 1GBJA 2FM2A 1UK2A 1FZZA 3BEUA 1O32A 1QGFA 1GVLA 2Q6DA 1A1RA 4B6FA 1V2RT 5C1XA 2J92A 2BOKA 2A31A 2FOGA 1EB2A 1ZHPA 4MPWA 1L4DA 4YLQH 4CRGA 1L4ZA 3VXFH 5C5NA 5JDUB 1PPBH 4B2AA 1HPGA 1O3GA 1U6QA 1L1NA 1W14U 5EOKA 3OYPA 5PTPA 2SGQE 3T26A 1DFPA 3SU4A 1ZSLA 1KIGH 1C1SA 1C2GA 1C4V2 2ODYB 1H8DH 1WUNH 3U9AH 1TQ7B 2UUJB 1QB1A 5E0GA 1Z8GA 1S85A 4A7IB 3SI3H 1SGPE 1QBOA 3UIRA 1G2LA 1O2IA 4WJG2 5C17A 4JK5A 4Y10E 1C2FA 1JRTA 3L6PA 2LP6A 1FNIA 3SGQE 3SUFA 4ABFA 3ZVAA 1XUJA 1NS3A 2PW8H 1DWCH 2QXJA 4FU7A 1V2OT 3T25A 3N7DA 1LHDH 3A7TA 2PKSB 4FU9A 8GCHF 2O9QA 3E0NB 1WSSH 2XTTB 2BYAX 3CS7A 4CBNA 1QQUA 2FP7B 1ABIH 1SPJA 4ZCNA 1AHTH 1NFYA 4MNVA 1IAUA 3DA9B 1SI5H 2Q6GA 1WXRA 1MU8B 1FIZA 3QTOH 3U28C 2BDAA 2GMTC 3URDA 3WY8A 2GZ9A 1P12E 4BAMB 2WPIS 1EAXA 1QNJA 2KAIA 1XUGA 2A4OA 3EGKH 1FX0B 2KCPA 3FFGA 2BDGA 1LQEA 4YZUA 3BG4B 1TX8A 1V6DA 1EUFA 1K1MA 2OTVA 2FO9A 1S84A 5EPNA 4AN7A 3A86A 3A8BA 2RFKC 1BTYA 3P17H 3PTBA 5BRRE 1NTPA 2TGPZ 2FX4A 1ELTA 3GCTG 2Z3DA 3M7QA 2CK3D 1MTVA 2TPIZ 4K3JA 2BDBA 3JZ1B 2O8LA 1QRZA 1N6XA 1BMFD 1ZOMA 7LPRA 2BLWA 4Q7YA 3VGCC 1XXFA 4HI3A 1O3JA 2W3KA 1O3IA 1ZR0A 4GHQA 4ZXYH 5DP4A 1QY6A 1P05A 1P2MA 3ENSB 4K1SA 1O2QA 4ABJA 1XM1A 1F5LA 2KFWA 4NG9H 4KTUA 5J4SA 3ZYDA 3D23A 2BY5X 2P16A 1CBWC 2V3MA 3PMBB 4ASUD 3SV2H 1ETTH 3PM3A 4XBCA 3AW0A 3KQEA 1EPTC 5C1YA 2VJ1A 4A5TS 2SGEE 2GTBA 4UEHH 5HKKD 4MPVA 1D3PB 4WH8A 3AW1A 3EE0B 1TNGA 1QA0A 3IWMA 3MO3A 4AYVB 1AGJA 1EAUA 3PMAB 2B0FA 5KECA 1KLJH 2BXUH 1TBQH 3ZZDA 1HRTH 2WPLS 2ZCKP 2ZFQH 2A7HA 1BJUA 3NRLA 3RUOA 1XKAC 1C5WB 2ZDNA 3FKSD 4Y8YA 4YOGA 3TK6A 1WU1A 2PWXA 1DITH 3SYJA 2FTMA 3MU1A 5DP8A 2XWAA 1GCDA 3Q00A 1QB6A 4IS5A 3RXEA 2A45B 4WVPE 1LHFH 1EFRD 2JH5D 2XNIA 1V2TT 3UR9A 2A4GA 1V3XA 4OS1A 3FANA 3F9GA 3FO8D 1FDPA 1C2IA 2G5NA 5DGJA 4A6LA 3ZVBA 1O2TA 1B0EA 3PV4A 5HM9A 3UNSA 1O38A 3M61U 4OM9A 1FLEE 3ITIA 1GBCA 1JXPA 3LDXH 1TPAE 1Y3UA 5HGGA 2TRMA 2BD7A 2F4LA 1CT0E 1LMWB 1YYY1 4X1PU 4DIHH 2KX4A 1ZHMA 3BIUH 3ODDA 4H42U 1EPTB 1GI2A 3GY8A 1KTTB 1OSSA 4DURA 4XD7D 1WV7H 1Y5AT 8GCHG 2FIRH 2HNTE 3LC5A 2GV6A 3GY6A 4ABHA 1O2XA 3SJ8A 1GI9B 3OU0A 3S9AA 4P02A 2G4UA 4AOQA 3RXHA 4TYDA 1GCTC 4HFPB 3NUMA 1GGDB 2WPHS 3RXDA 3RU4E 1J9CH 1O2SA 5EQRA 1RIWB 1GI6A 3VB5A 1YPMH 1G3EA 2WZQA 1Y8TA 4XDEA 4LK4A 1H8HD 3ZZ3A 1M9UA 3BN9A 1K2I1 1D3QB 1W0YH 3RU4T 2M2AA 1N1LA 1T8MA 1SGNE 4J2YB 4A1VA 1Y3WA 1S6LA 1AO5A 3B23B 1GBLA 4B76A 2IPQX 1VJ9U 1AMHA 1HAIH 1G9IE 1NFWA 5EW2H 1AUJA 3GCOA 1WOFA 1TALA 4INHA 4Q7XA 2PLXA 3ELAH 2GV7A 4I86A 1W10U 1CQQA 1K1JA 1O0DH 2JIZD 4FUCA 1GBFA 1TA6A 1AU8A 1OOKB 3AVZA 4XBDA 1MZDA 2ZFPH 1VITG 4FOUC 1HAHH 3SUEA 1YLDA 4ACAA 3SU6A 4X8UH 1OYTH 5DKMA 1T8OA 1ELAA 1AFQC 3BV9B 3P6ZB 1IOEA 1HCGA 4I32A 4Q2KA 3D62A 5E0HA 3M5NA 4GCHF 1BBRK 1BIOA 1XUIA 1RS0A 2HNTC 1P02A 1O3AA 3PWBA 3LJOA 2UUFB 1GG6B 1GBMA 3BTDE 4K1TA 3TJVA 1ZTJA 3V13A 4XE4A 1LPKB 1T4UH 1GBKA 3F68H 2K1QA 1P9UA 2GCHF 3ZZ8A 4KTSA 1H8ED 1MAXA 3K65B 4ABBA 2Z9IA 1NPMA 2BDHA 1ZMNA 1AB9C 1TGTA 3RU4D 3MTYA 4JZFH 4FETA 1GMDF 2PUXB 1YF4A 4O3TA 2FODA 3QGNB 1FY1A 1COWD 1RIWC 3TPIZ 1OS8A 2BVRH 2BD8A 1AWFH 1RD3B 1TQ0B 5DN6D 4X1QU 3ZZCA 4XBBA 3E90B 1OWDA 4BAKB 1C2JA 3M5OA 2QC2A 3UFAA 1KLIH 3VXEH 4O9VA 1VGCB 1XUFA 1AVXA 4OS5A 2GD4B 4D7GA 1CA8B 1Y5UT 4NIXA 3ZZ4A 3TJOA 2HOBA 2FOCA 1V2NT 1O2GH 4DG4A 3T29A 3SJIA 1TX6A 1Z7KA 2EEKA 2C4FH 3RC5A 1ZPBA 4K8YA 5C67A 5HYOA 2KCOA 3B8JA 1IQMA 1GWAA 1EQ9A 2VNTA 2IJOB 1EJNA 2Z3CA 2FOMB 1D6WA 1C2DA 4IC6A 1H9IE 1HAYB 2XWBI 4FUFA 2Z9LA 4BAQB 1INCA 3ZV9A 1SG8B 2BHGA 3A7ZA 1LCYA 2OXSA 5HMAA 1O2MA 5E0JA 3UNRA 3NZIA 3RMLH 2YOLA 2QE7D 1KXFA 1O33A 1K1IA 3SHAH 2V3OH 3QN7A 1ELFA 4Y6DA 5FX5A 2ZDKA 2HNTF 1KXBA 1MD7A 1HBTH 5EGMA 1FV9A 1E1RD 3RXBA 1ELEE 1O30A 3RXJA 1ZTKA 3HK6B 1LHEH 2A2QH 8KME2 1NZQH 5DP9A 1TE0A 4NCYA 4BNRA 1A2CH 1CT4E 1QBVH 1DY8A 1QJ1B 1ELGA 3UOPA 1BDAA 2Z94A 1HLTH 2BTCE 3MI4A 4X2YA 1N6YA 1HAVB 1GJDB 2ZPSA 4CH8B 1AZZA 1EP6A 2P95A 1GBBA 1E79D 2J95A 4JYUH 1MAYA 1SL3A 2FI4E 2AS9A 1TX7A 1K1NA 2Z7FE 3CS0A 1CGHA 3ZZ7A 3DUXH 3GDUA 3MH7A 1WBGB 4AB8A 3ATWA 2VIPA 4Y79A 4DOQA 1O3CA 1GHBF 3ZZBA 2ZGXH 1OWKA 1A3BH 8ESTE 3JZ2B 3EDXB 1KMHB 4XOJA 2PGQB 1L2EA 2OUAA 3A82A 4X8TH 2AGIX 3ZVCA 1O3HA 1PQ5A 4RT1A 6GCHG 1H8IH 3VG8A 2VGCB 2HPQH 5A09A 2BX4A 1C1OA 1C5NH 1IHTH 1K21H 3LOXA 1BRAA 2W6ID 2QXIA 2W5EA 2O8MA 4NIVA 2J98A 2QXGA 1G2MA 2FOEA 4X1NU 4YT7H 4DW2U 4CREA 4FUJA 4BTUB 1LDTT 4WMFA 3W94A 2STAE 3OY6U 4ZHMU 3KQBA 4X6OA 1D9IA 2VWNA 2FS9A 1Z71A 1LVBA 1GI4A 4Y11E 1GJBB 4NIWA 4IMZA 1QL7A 3OEHD 1CHOF 4WF8A 3P8NA 1A0JA 1HAGE 2AHME 2ZHEH 1MBMA 3MU5A 4GVUA 1OXGA 2BM2A 2XW9A 1ZHRA 4UFGH 4YXWD 4ACBA 1GHXH 3STIA 3RXOA 2OLGA 3BIVH 4TWWA 1DX5M 4Y76A 2C93B 1VKYA 4Y7BA 3U1IB 1TOCB 5EXLA 2BZAA 3RXVA 4O03A 1G3CA 1RTFB 1LO6A 4MDSA 3RXRA 3SZNA 2ZA5A 1C9TA 3BSQA 2AYWA 3F9FA 4YT6H 5JB8S 1SSXA 3K6YA 4IN1A 1BOQA 2G55A 3KQCA 2V7QD 1C4U2 1SMFE 2VWLA 1ESBA 1XKBC 1KSNA 3SO3A 3LC3A 1EX3A 3A8CA 3F3BA 4GHTA 4MNYA 2ZKSA 3S0NA 2R9PA 3LGIA 3E3TA 2ZU3A 1DS2E 1BBRH 2W26A 4Q7ZA 1TMBH 4AX9H 4ABAA 1NBMD 2ZGHA 1EJMA 5AFYH 2V0BA 3U8OH 2RCEA 4BOHA 1GHWH 3UB0A 1BRCE 3P95A 2HALA 3UUZA 3SQEE 3GDSA 3MO6A 7GCHG 3RXLA 5EG4A 1GI3A 3LJJA 2ZTYA 2BDIA 2ZU1A 3SORA 1FONA 1YKTA 1SFQB 1ZPCA 4OS6A 2Y7XA 2F3CE 1E36B 1AI8H 1ELCA 1P11E 1TGBA 1YPKH 4MQAA 2FLRH 4CRCA 2F9OA 1QA7A 2FI3E 4K69A 2JH0D 4AFSA 3RXSA 4ZUHA 4MVNA 2BZ6H 1QURH 4YM9A 2ULLA 1VGCC 1T7CA 1PPCE 1GBHA 1XXDA 2PFEA 1NU7B 5IDKA 1DE7H 1BTWA 5EJZA 3A81A 4U2WA 5CDFE 4CH2B 2A1DB 2HGTH 1ETSH 1ZZZA 1KXEA 1L0ZA 4MPUA 4ZHAA 2FWWA 3VB3A 2FPZA 3P8OA 1THRH 3TVJB 1P10A 4FUEA 2IN2A 1GJ9B 3GY7A 3TIUA 3KIDU 2FESH 1T8NA 2TGAA 1C1UH 4B1TA 1EKBB 1BJVA 5CHAC 1A61H 1A0HB 1C5RA 1PQ7A 2WINI 3DSOA 3FP6E 1NESE 3EA9A 4AFQA 3A85A 5EQQA 1A0LA 3IITA 3S7KB 2XBVA 1IQFA 1TRNA 5EJ1A 2A5KA 3MNXA 1ELVA 5JBTA 4MPXA 1GVKB 3G01A 1AIXH 4Y0ZE 2ZEBA 1SQOA 2NU0E 1WDIA 4ABIA 1NT1A 1W7XH 2KAIB 2J2UA 1VCPA 4FUHA 3NK8A 1H9HE 1ORFA 4NZQA 4BAOB 1GJCB 4O3UA 1IQNA 2XYAA 2GCTB 1O2RA 1O35A 2SNVA 3P8GA 4MG3A 2J9NA 4X2VA 1Z8RA 5T1VA 2HLCA 3VEQB 3GCTF 1G3BA 1WQSA 1Z6EA 1QIXB 2BVXH 3BTTE 3VB4A 4Z1MD 5DO4H 1LKAA 2A4QA 2ZGJA 1CT2E 1O5DH 1Y5BT 4DY7B 5C20A 5LPRA 1FUJA 5JPMH 1UVTH 3SNCA 1C4Y2 3U69H 4J1YA 2IJD1 3HPTB 1BMLA 3CENA 1OX1A 3V12A 4NSYA 1ANDA 1DUAA 2ZHDA 2ZWLH 1O2NA 2C8ZB 2NU2E 1D4PB 3HKIB 1HAVA 4XFQA 4BAHB 1O3EA 1W12U 3OY5U 1LVYA 4WMEA 1AFQB 2YMSD 2H5CA 2OD3B 1WCZA 4AZ2B 2BQWB 3QK1A 3PRBA 1SLXB 1O2OA 1DM4B 1F5KU 4AORA 1O34A 4AG2A 2ZDLA 2I6SA 2O8TA 2RA3A 1VR1H 1VZQH 2FOBA 2Y5GA 2ZF0H 5CHAB 5CMXH 1DY9A 1QL8A 1TGCA 4A1XA 1A5IA 1KTSB 2R3YA 4ZKSU 1NO9H 2ESTE 3KYGA 3PLBA 1PFXC 2ZIQH 1IQEA 1TIOA 1QJ6B 2AMPA 5EQSA 1UVOA 1J16A 1EAWA 2ZP0H 2ZHWH 2FMJA 1CSOE 3SU1A 1FQ3A 3FZDA 3OFND 2UWPA 2AH4X 3KCGH 3Q3YA 3RXPA 1C2EA 1BRUP 1BTXA 2VVUA 2Y5FA 3AAUA 2C3SA 1ELDE 1YP9A 4NZLA 1C5PA 4YOJA 3A7YA 2BB4A 2GCTC 4ISLA 3F9EA 3PYHA 1THPB 2GJGA 3DHKH 1E38B 3N7EA 1QBNA 1K0HA 1P3CA 2XCNA 3RP2A 2L74A 1YPEH 2OBOA 5BPEA 1MTNC 3EQ0H 3KNXA 5HIYA 2F9PA 2Y5HA 1GJ4H 3FZZA 1XX9A 3SZEA 1O3DA 1Y3XA 1MH0A 3ATMA 1EB1H 1P2JA 3HKJB 2ILNA 4WH6A 2BOHB 4F48B 2SGPE 1LPGB 4RN6A 4LXBH 2DUCA 1FN8A 3EE7A 4SGAE 3BTWE 2P8OB 5FCKA 2A5IA 1ANEA 1OWEA 2ZDVH 5E2OA 1CA0C 1UTOA 4AG1A 1TRMA 2J94A 1GJ8B 1G32B 1C1TA 1NBME 2ZGBH 1LQDB 1IQHA 2FXRA 1UK4A 3F6UH 4YLUA 2QXHA 3EAJA 2V3HH 2BQ6B 2J34A 1ZRBA 1TONA 3BG4C 1EOLA 1V2MT 2A7CA 1GHVH 1HFDA 2Y7ZA 3QWCH 1C5ZB 3LGYA 1B5GH 2B9LA 2ZCHP 3EA8A 4GAWA 4HGCA 4ASHA
chains in the Genus database with same CATH topology
2EC9H 1TWXB 1GI0A 4ZKRU 5FXLA 3SNAA 3PWCA 3UQVA 3MH6A 5K7RA 1G3DA 1MD8A 2W7SA 4Y8XA 3A8DA 4ABEA 3VB6A 3LH3A 1MTNB 1O5BB 4IC5A 3QTVH 1O2ZA 1P57B 3FP7E 1GBDA 3SV6A 1MZAA 4ISNA 2O8WA 2M5TA 1DPOA 1IQKA 1QQ4A 2J4IA 5E2PA 5LH8A 3E1XB 1ARCA 1HGTH 2YNBA 4NGAH 1N8OB 3L3TA 1DWBH 3SJOA 3GY2A 3ZZAA 5E8EH 3SJ9A 1YPHC 1LVMA 1HAXB 1L1GA 2FZZA 2QV1A 4Y8ZA 3PTNA 5EXMA 1T31A 3QDZB 1O3LA 3NKKA 2XBWA 1BQYA 1TA2A 3SNEA 1HXFH 1OP8A 1VJAU 3GCHC 1QTFA 4R8TB 3SU5A 3RC4A 3VFEA 1F5RA 1PQAA 1VITF 2AEIH 1GVZA 1V2PT 3B9FH 1GG6C 4BANB 5A8YA 1GBAA 1GJ7B 3URCA 6CHAC 1S0RA 4Q80A 3RXQA 3PLPA 1HAZB 2CHAB 2ZPQA 2ODQA 2Y6TA 1OWHA 2AGGX 5HM2A 5T6FA 1ZPZA 1W2KH 2J38A 4JK6A 1AB9B 1BITA 2BLVA 2H6MA 1CA0B 5A0BA 5B6OA 3KEEA 3GYLB 2G81E 1TRYA 3H5CB 1AVGH 2PSYA 1UO6A 2P93A 1KLTA 4B75A 3KN2A 3MU8A 3HGPA 1TNIA 1TNJA 3R3GB 4UD9H 1SC8U 1GDNA 1E0FD 3SV7A 2FYRA 3E91A 4WY3A 1GHYH 1O5AB 3KHVA 2AIQA 1HAPH 1UVSH 1SLVB 3A83A 5GCHF 2ZFSA 3M3SA 1BCUH 2ZFFH 2ZFTA 3AAVA 3LGWA 1JRSA 2FI5E 2HWLB 1C1VH 1SHYA 3ATKA 5CE1A 2R3UA 1V2WT 3MMGA 4M7GA 4YTAA 4X1RU 4UFEH 4ZKOU 2Z6BD 4LOYH 1GJ5H 1DSTA 2ODPA 1UVPA 1MKXK 6CHAB 3C1KA 1O3NA 1J14A 2UWLA 1TOMH 3A80A 1Y3YA 2H5DA 3GY5A 3RXGA 3ZZ5A 3SBKA 5DP3A 3ZZ9A 1ZGVA 4HZHA 1HJAC 2P3FH 4CBOA 1C2MA 3PROA 1CE5A 1A7SA 3O8CA 3LGUA 4AB9A 1NU9A 2XXLA 2R2WU 3BF6H 3A87A 1CGIE 2ZHQH 3STJA 2BVSH 4JZEH 3W95A 4AFZA 4A1TA 3UNQA 1J17T 2I6QA 1O36A 5I25A 3RM2H 1F7ZA 4ISHH 2ANWA 1KY9A 1O3MA 9ESTA 2WV4A 1PQ8A 4FUIA 1H4WA 3S9CA 2Q1JA 5JYIA 4YOIA 2BLQA 2GMTB 3RMNH 5EODA 1GHAG 3M35A 2QA9E 1FMGA 2VB0A 1GPZA 3RLYH 3M7UA 3VGCB 4CR9A 1EOJA 4BXWA 2BLOA 1TMUH 1QL9A 1BA8B 2VWMA 4UDWH 1PPHE 1ZTLA 1TABE 5TJXA 1TGNA 2TIOA 2VH6A 5FPSA 2VVCA 2H9HA 2NU4E 5AHGH 1OP0A 3BTFE 2ZECA 3UTUH 5G4BA 7KMEH 5A2MH 1BHXB 2ZTZA 4THNH 1BB0B 3NCLA 3TK9A 4U30A 1RGQA 3M3TA 3K9XB 4E05H 2WUCA 5L6NH 1A5HA 2B8OH 2QF0A 2PKAB 1T4VH 2VIOA 5T6GA 5LPEA 1EP5A 4BTTB 4CRBA 2GZ7A 1UTLM 5FAHA 2SGAA 3A7VA 4QT8C 1BRBE 1RFNA 3MNSA 2QF3A 3M3VA 1OWJA 1XUKA 4D76A 2P94A 5ESBA 2XRCA 1TLDA 1ZLRA 1O2LA 5T6DA 2VVVA 1ZRKA 3VB7A 2XBYA 1CU1A 1O2WA 1W7GH 2OQ5A 1HXEH 1SGFA 3GOVB 1O5FH 1YPLH 3SU2A 1SBWA 5FHTA 2P3TB 4X8SH 4GUXA 1W11U 5FPTA 2GX4A 2ZI2H 3QLPH 3SNDA 2XC5A 3M7TA 3HK3B 2BY7X 3M36A 2Y82A 2OC0A 2OC1A 2QIQA 2VINA 1UJ1A 2CF9H 2AFQB 5A0CA 4FUDA 3S9BA 1S81A 3S7HB 3M37A 3TJNA 1O3OA 4FVDA 1NC6A 3O8RA 5GDSH 1CVWH 1NY22 2VWOA 2OCVB 1QB9A 4OGXA 1EAIA 4K2YA 4JZIA 4MNWA 1F0RA 4YO9A 5DP7A 3RXKA 2VIVA 1ZMJA 1Z1JA 3A7WA 5JBBS 1J15A 2Z9KA 1IQIA 3E16B 5EU8A 2A2XH 2RA0A 3U8TH 2GGVB 4ABDA 2WPKS 4ZROA 3KQDA 3UPEA 1XVMA 1DUEA 1EASA 1NRPH 2ZG0H 4ABGA 3MNCA 3K6ZA 1YLCA 2ZZUH 4NWKA 3RXCA 3QO6A 1CHOG 2VIQA 1K22H 1K1OA 1MTSA 3TH4H 5F6MA 6LPRA 1DOJA 4ISIH 1SGTA 2ZU4A 1ABJH 2SGDE 1LHGH 4IN2A 5A8ZA 1THSH 2VIDA 1P01A 4ZXXH 1O3BA 1BTZA 4NFEA 2GKVE 1A3EH 1PJPA 2A32A 1DT2A 1QCPA 3GISB 3UWIA 5L2YH 2Z9GA 3TLOA 1DWEH 1P04A 1GMHF 1DWDH 2VU8E 3F1SB 1SVPA 2OP9A 5FPYA 1KYNA 1H1BA 4MTBA 4XSKU 1ACBE 3RXAA 3PO1C 3EA7A 1HIAA 1BMNH 4KTCA 4DCDA 2JETC 1HB0B 5ETXA 4AFUA 1GBEA 1JBUH 1BUIA 3BEIB 3P70B 1BMAA 1DANH 3ZV8A 2GDEH 3UREA 1PPGE 2ALPA 5DP5A 2CF8H 4WMDA 2FEQH 1HIAB 1P06A 1H9LB 2ANYA 2ZPRA 3HGNA 2CXVA 4RSPA 1SHHB 4WWYA 1S83A 2LPRA 1C1WH 2BD2A 2TGDA 3U1JB 4ESTE 1RJXB 1ZGIA 3MH4A 1QRXA 1V2UT 2FOFA 1X7AC 1MKXH 1O3FA 4E7NA 1P2KA 4YESB 3NPSA 2GT7A 2H9TH 4GCHG 4VGCC 2F9BH 1LVOA 3OTJE 1EZUC 1YBWA 1V2QT 1AZ8A 4CHAC 2SGFE 3ZZ6A 3K2UA 3AASA 1UTJA 3RC6A 1O31A 1DSUA 1HNEE 1QHRB 1UK3A 1ZSJA 2FOHA 2F9NA 4Z6AH 1ZYOA 2H1UA 2F83A 1AUTC 1F92A 1K28D 4Y0YE 2O8UA 3RXUA 3SHCH 1C9PA 3Q3KA 4O97A 2JETB 4NA7A 1ANBA 3TJUA 3V0XA 4X6PA 1G36A 3TNTA 1T8LA 1C2HA 4LZ1H 1NRNH 2G51A 3EYDA 1P09A 3KF2A 1C1PA 3O8BA 2XBXA 1SGIB 3SV8A 1WAYB 3VPKA 3KGPA 5C5OA 1DDJA 2HRVA 2WV5A 2R2MB 1C1RA 1SGFG 3LKWA 4JYTA 3GCNA 2XC0A 1ZMLA 1O5CB 3RXIA 3NWUA 1YPGH 1HJ8A 1YM0A 2FYQA 4I8GA 2C8WB 1BTPA 1NROH 3TGJE 1MUEB 2V6NA 4VGCB 3MO9A 2PKSC 2W7UA 3SU3A 1CGJE 2CHAC 1SR5C 1DVAH 1S6FA 5DG6A 5SGAE 3ZYEA 3ATLA 4INLA 1GCTB 2BD9A 2D2DA 1C1QA 1IQGA 2WPMS 1UVUH 4JMYA 1YPJH 5FBIA 4X8VH 4NFFA 3SUGA 4SGBE 2EI7A 2BD4A 1AE8H 3MWIU 1GI7B 4OS7A 2THFB 3DD2H 4DJZB 3RXTA 3OSYA 4ISOA 3BTHE 2WPJS 2VH0A 1TNLA 2FLBH 3H7OA 5TCAA 1ETRH 3SJKA 1DXPA 2C90B 1P3EA 4IGDA 1F2SE 4LZ4B 1GJ6A 4I8HA 1JIRA 3LGVA 4X2WA 1E37B 1AVWA 1P03A 2BDYA 1NRSH 2PTNA 1O39A 1P9SA 1QFKH 1XMNB 3MOCA 1RTKA 1Q3XA 4JCNA 3I77A 1KDQA 1FAXA 1O2PA 1ZJDA 1ESTA 3RM0H 3SGBE 1S82A 1NN6A 5TCCA 1HV7A 3NXPA 1NRQH 3ZVDA 5JB9S 3R0FA 5GWZA 4OS2A 1TNKA 4UONA 2OC7A 5F8XA 1GBIA 2GCHG 4I31A 1GL1A 1TPPA 2NU1E 2VIWA 1FN6A 4D8NA 4F49A 4B74A 4FVBA 1A5GH 2CN0H 1MKWH 2PR3A 2ZO3H 1IQJA 2B7DH 3TGKE 1C5VA 1BTUA 4KELA 1W13U 4K1EA 1XUHA 2G52A 3E6PH 2ZDMA 2C8YB 2P59A 4FXGH 4Z0KA 1KXAA 3M5LA 4Y71A 3T28A 1O5GH 1MCTA 3MYWA 1SQTA 3P8FA 3D49H 4INKA 4E7RG 4TWYA 2ANKH 1GBTA 1TB6H 2ALVA 3Q3XA 4NIYA 4DT7B 4R0IA 4I7YH 2ZQ2A 2QCYA 4RKOB 2FOAA 1ELBA 2F9UA 4K8BA 1UMAH 3SI4H 1T32A 3I78A 3U98H 1SGRE 1DXWA 1C5TA 2GZ8A 1C5YB 1L1JA 1WQVH 1Z8IB 5GJ4B 1FJSA 2TBSA 1SGQE 3BG8A 3MU0A 4IBLH 3BTKE 3A7XA 4ZKNU 3F9HA 1DLKB 1WTHD 3BTEE 2GVFA 2WYJA 1O2YA 1BHXF 1OPHB 1SLUB 1A46H 1UHBB 1FY8E 2BXTH 2Z9JA 1GDQA 2ZNKH 3C27B 2CJIA 4NA8A 1NM6A 5DPAA 4TPYA 1YC0A 1HJ9A 1C5SA 1N8OC 5F8ZA 4GPGA 5EW1H 4X1SU 2SFAA 2GT8A 1VCQA 1F0TA 2ZCLP 5EPYA 2PGBB 1E34B 2CV3A 1UHBA 4Y7AA 1C2KA 2XC4A 1G30B 3QUMP 1GDUA 5ESTE 3MU4A 2P3UB 4CRAA 2GP9B 1TPSA 1W3CA 4MNXA 1FPHH 4ZHLU 2HVXA 1YPHE 1OWIA 2UWOA 2ZC9H 4NSVA 1AKSB 1KXDA 3M5MA 1SGDE 3RXMA 1GMCF 1AE5A 1C5OH 1IQLA 1RRKA 3GYMA 4CR5A 1GHBG 1HYLA 3CP7A 3V3MA 4BXSA 2C8XB 3BTGE 5HXFA 1MU6B 3O8DA 1O5EH 2R0KA 1ZJKA 1NFXA 2TGTA 2EI8A 4B2CA 1GI8B 4UFFH 1UTPA 5ABWA 4TPIZ 4H6SB 1BBRE 3TGIE 1Y3VA 2BX3A 3SN8A 1EJAA 1BT7A 5FBEA 4PROA 4NA9H 4X6NA 2AIPA 1ZSKA 2F91A 2BY8X 4IMQA 4KGAA 3LONA 1D3DB 2ZDAH 1C5XB 1FI8A 5GPIB 1FY5A 1CHGA 1LHCH 2H2ZA 3UWJH 4FU8A 2ZHFH 2IPHA 5A8XA 2A0QB 2ASUB 4U01A 1O3PB 1ANCA 2BD5A 1V2LT 3ZVGA 3TK5A 5C1UA 3TITA 3MFJA 1V2VT 2VGCC 1TPOA 2OINA 1QRWA 3ATIA 3BTME 4I8KA 1E35B 4UE7H 2JH6D 1O2JA 3A89A 2EA3A 1NFUA 4OS4A 1Q31A 2A4RA 2DE8A 1AKSA 3ESTA 3IG6B 2AERH 1CBWB 2G4TA 1UCYE 1O2UA 3P92A 4B73A 4BTIB 1C1NA 4AGKA 1K1PA 2UUKB 3H7TA 1D6RA 1O37A 3E0PB 4MLFB 4ZH8A 2HPPH 2Y80A 1G37A 3RMMH 2PKAA 2Z3EA 4I8JA 2PHBA 5L2ZH 1HJAB 1DICA 1HUTH 1EATA 4AYYB 5DJ7A 5DK1A 2NU3E 1UTNA 1SGEE 1LPZB 1TBRH 3ODFA 4U32A 1ID5H 1GHZA 3RXFA 5JBAS 3SU0A 3TH3H 1CO7E 2PV9B 1WTGH 3UY9A 2BQ7B 3T2NA 2RDLA 2PSXA 6ESTA 4D9QA 1AN1E 5C2ZA 1HAOH 3BEFB 3T5FH 4JZDH 2BMGB 1SQAA 2ZU2A 2NWNA 1TFXA 4WXIA 1P0SH 5L30H 1EPTA 2Y81A 1FPCH 1JWTA 1S6HA 1OP2A 3Q76A 1OKXA 1O3KA 3PMJA 7GCHF 3SW2B 4B71A 3GY3A 3SGAE 1TAWA 1P2IA 1PPEE 3GCHB 4WXVA 5EXNA 1MTUA 3TH2H 4E06H 4X2XA 1EZXC 4FUBA 1WYKA 2PTCE 4TY6A 4D9RA 1C5UA 2QY0B 3SV9A 1ARBA 3A8AA 2WYGA 3FP8E 1GI5A 3BTQE 1IHSH 1C5MD 1W0ZU 1AY6H 3GDVA 4A92A 4GLYA 1O2KA 1V2JT 8LPRA 5GCHG 3PLKA 2QN5T 4TY7A 1UCYK 1PPZA 1PPFE 3OX7U 3QZRA 3TNSA 3Q77A 2A7JA 1AQ7A 1PYTC 2AMDA 3U8RH 3PMHB 2G00A 1SGCA 1V2KT 1W8BH 3DT0H 9LPRA 1SB1H 5DP6A 5GXPA 3GICB 1V2ST 1P2OA 3S69A 3SUDA 4D7FA 2D26C 3UQOA 2XCFA 5F8TA 1C5LH 1AD8H 1KXCA 2EI6A 2ZQ1A 3PB1E 1Z1IA 3SNBA 3RDZA 5IYTA 1TYNA 3MNBA 3SOSA 1UTQA 2LNCA 2CGAA 1MQ6A 1YCPH 1VCWA 2ZTXA 2QYIA 3I29A 1BZXE 2OQUA 4ZAEA 1TMTH 3GY4A 5JBCS 4B2BA 1SGYE 1EZSC 3HATH 3MH5A 5AFZH 5FCRA 4I33A 4DVAU 4F4OC 3RMOH 1P2NA 2QAAA 2P8OC 1XVOA 2YNAA 1MBQA 2STBE 4CRDA 1YCPM 2OBQA 2AGEX 6GCHF 4DGJA 5J4QA 3QGJA 1C2LA 1GMHG 1RXPA 5FX6A 4UFDH 5LGOA 4HTCH 1DLEA 2DE9A 1MKWK 3LPRA 3QZQA 1TNHA 1J8AA 1UTMA 2A5AA 3A84A 3SQHE 3MHWU 4H4FA 3RLWH 4AGJA 1K1LA 2AMQA 1C5QA 1GMDG 1SFIA 1UTKA 2JKHA 1JMOH 4X6MA 1TBZH 1B0FA 4IW4E 2CMYA 2V35A 3DFLA 1C1MA 1GJAB 2ANMH 4K5ZA 1P2QA 2FDAA 1YGCH 1OYQA 1JIMA 7ESTE 5LPFA 3L33A 3LGTA 1FY4A 1GI1A 1QR3E 1Q2WA 1S0QA 3KL6A 1FIWA 1F0SA 2F9VA 2GDDA 1SOZA 1F0UA 5GIBA 5AVDA 2IOTA 3N7OA 4OGYA 3ZVFA 1VITH 4DIIH 1QJ7B 4FUGA 1SLWB 1FAKH 1GMCG 3FVFB