7LPRA

Structural basis for broad specificity in alpha-lytic protease mutants
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
publication title Structural basis for broad specificity in alpha-lytic protease mutants.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1991-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 7lprA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 7lprA01
4KTCA 3LC5A 4U2WA 4O9VA 5JBBS 1AZ8A 2QAAA 2F9VA 4ZAEA 1OS8A 4KTUA 3Q77A 1O33A 2J92A 2FOGA 2TBSA 1P3CA 1TNHA 3TK5A 1GJAB 4X0WU 1QIXB 1JXPA 4D7FA 2A5IA 2VVUA 1EZUC 2BQ7B 1C5XB 4XOJA 2FESH 1AUTC 1GBBA 4O3UA 4BXWA 2QXIA 2ASUB 5F8ZA 1QL8A 1P57B 2VVVA 3RXQA 5DP7A 3TK9A 1GHZA 1O2GH 4UDWH 3U69H 1NRRH 2VGCB 1PQ8A 1J17T 2A31A 4JZIA 4K1TA 3OY6U 2HRVA 2H9EH 2BB4A 1YPLH 2BXUH 1H8DH 1DWCH 1P01A 2BVSH 3LGWA 2D1JA 4WJG2 3V0XA 1OWHA 5JB8S 1C2HA 1O2PA 1W10U 3P8OA 2D8WA 4J2YB 4OS7A 3QUMP 1O2HA 4MQAA 3LC3A 1O3MA 1SGDE 2FODA 3QDZB 1UVOA 1BMMH 2HPPH 3V7TA 3MI4A 1SGTA 3D23A 1XXDA 5EQRA 2CV3A 3M7QA 2Q1JA 3NWUA 1H9LB 1GHYH 3QLPH 1OOKB 1P8VC 1G9IE 3K6YA 4YO9A 3A8AA 1D6WA 1QA7A 1A5HA 3SU3A 2A2QH 3W95A 2ZHWH 5J4SA 1SOZA 1GGDB 1WU1A 3BIVH 2Z6BD 4X6OA 4JZ1A 1UJ1A 2F9UA 3B8JA 3M3SA 2BLVA 1KXCA 2C8ZB 1XVMA 4Q2KA 2BQ6B 4WH6A 2FLBH 4Q80A 3GYMA 5F8XA 4UFDH 4D76A 1HAIH 3ESTA 1ESAA 1HIAA 1IHSH 3SV2H 4I8JA 1SGIB 3SHAH 4NG9H 3STIA 2F9BH 4NIXA 1IQFA 3PTBA 1NS3A 1DANH 3OY5U 2ANWA 4X8UH 4XSKU 3A82A 4BTIB 1YPGH 3RLYH 1Z6JH 2CN0H 3RXIA 3EQ0H 4MPUA 3SORA 3RXUA 3SJIA 1KXFA 2FP7B 1THPB 2XC5A 2FOAA 1FY4A 1O2ZA 4MNWA 1GJ7B 2BOKA 1WQSA 3TPIZ 1EASA 2O8MA 1P0SH 1ZR0A 2FZZA 3ZVEA 1TRMA 1UHBB 2VNTA 1IQMA 4ZKRU 4LZ4B 3RXFA 3VXFH 1TWXB 1FLEE 1HJ8A 3RU4D 1NTPA 1G30B 2ZTXA 1AMHA 2LNCA 8GCHG 1YGCH 1F5RA 2H9TH 3ZVAA 3BTHE 4YESB 1BZXE 3V3MA 1C5UA 3HKIB 3BTDE 3A86A 1U6QA 1UK4A 2GZ9A 5EPNA 1AKSA 2HPQH 4KTSA 3T5FH 4ZH8A 2ZTYA 2PWXA 5I25A 1C1TA 1SGEE 3A7WA 2FX4A 1GL0E 5DP4A 2PSYA 4X1QU 5FHTA 4ISNA 1C9PA 5TJXA 5JB9S 2FOBA 6CHAB 3EDXB 3VXEH 1GBIA 5HMAA 1O5CB 3BV9B 3ZZ7A 2WPKS 2FO9A 2A5KA 1DUEA 1FPHH 1XX9A 4NGAH 5LPEA 1XUGA 2WPJS 1ZJKA 4Q7XA 2JH5D 2Y5FA 1K1MA 3GY4A 1TMUH 2GCHG 3RXTA 4D9RA 5FBEA 2P8OB 1O38A 1K21H 1TPAE 1A7SA 1GHWH 5C5OA 2GV7A 3GDSA 1AN1E 1INCA 1F5LA 1HYLA 1V2OT 2XXLA 1ZZZA 1SPJA 3ODFA 1TGTA 3A7YA 3LGYA 1O2WA 2FEQH 3Q3KA 1Q31A 1NN6A 5GPIB 2Y82A 1G2LA 1TPOA 2BOHB 3UNRA 2Q6DA 1N8OC 4H6TA 1QB1A 2STBE 1AVWA 2FOCA 4NFFA 3SI4H 4CRAA 1ELDE 1XUIA 3AAVA 3RXOA 1MU8B 4JMYA 4KP0A 4K1EA 2ODYB 5DP5A 5GCHG 3O8CA 2OTVA 1XUJA 2RCEA 4PROA 2VIVA 1WCZA 2QV1A 3MNBA 4ZMAH 2BY9X 3DD2H 1O0DH 4FUDA 1FNIA 2ZDLA 1IQHA 1QB6A 3M61U 1P2IA 1O3KA 2FIRH 3RP2A 1ACBE 2BY7X 4CRGA 2ZFFH 1CO7E 3K2UA 4QT8C 5CE1A 3SJOA 2R3YA 2C8WB 1QQUA 1E38B 1O2UA 3S7HB 1C5RA 4Y8ZA 1TOMH 1ETRH 1YBWA 5AHGH 1FY8E 1H9HE 1Y59T 2GP9B 2ZCHP 4X6PA 4B2CA 1FONA 3PWBA 2CMYA 3M37A 2G51A 4K8BA 3CP7A 3O8RA 1V3XA 1NO9H 2BY8X 3AVZA 3RMMH 2FX6A 1CA8B 1EJAA 3PO1B 2GMTB 1E0FD 2H2ZA 2B7DH 1BHXF 4Z6AH 1HJAC 1PQAA 1THRH 3U9AH 2AGEX 1J9CH 3SGAE 1ELVA 3Q3YA 4M7GA 1P09A 1BRUP 1HAXB 1LTOA 1QRZA 4LK4A 6GCHG 2ZU3A 3RM0H 2GV6A 1SG8B 1VGCB 4OS4A 5FBIA 3T2NA 1O3HA 2PTNA 3VB7A 2JKHA 2XCNA 1SGFA 3UNSA 2BY5X 3UWIA 1VCQA 1V6DA 1VCWA 1BTUA 2TGPZ 1Y5UT 3FP7E 2C4FH 2UUYA 4MTBA 1DSUA 3MFJA 3K65B 2ZFRH 4XBBA 1QQ4A 2A4OA 5CHAB 2VJ1A 3SHCH 3ATWA 1FZZA 4ESTE 2ZGHA 2A2XH 4AYYB 3LDXH 1A0LA 3AW0A 4B2AA 1CQQA 1AFEH 1MD7A 1KLIH 3SJKA 4CBNA 1F0TA 1TNKA 2QXGA 1TE0A 1AWFH 4GHTA 3SUDA 2PTCE 4E05H 3BEIB 1O3LA 1EZXC 1MQ5A 5FPTA 4DVAU 3QZQA 2NU3E 1K1PA 1SQOA 2VH0A 1XKBC 3MMGA 3U8TH 3DUXH 1DT2A 4DIIH 2ZQ1A 2FTMA 3IG6B 1TALA 3HGPA 1QFKH 4B76A 4X1NU 1MAXA 5HYOA 1ANDA 2G4TA 4ZROA 3V13A 1AI8H 3BIUH 2CGAA 1AE8H 1UTLM 2RA0A 3N7OA 1L1NA 1O36A 1SL3A 1ELGA 1O3FA 1GJ4H 2GCHF 1O3NA 1YPJH 1P03A 1EAXA 1P06A 1N6YA 4MPVA 1S82A 3PTNA 1WBGB 3UQOA 1FMGA 1GMDF 1SGCA 3QWCH 1GBKA 1JBUH 1CGIE 5T3HA 4BTUB 5EQQA 1EPTC 2VWOA 4Z0KA 4AB9A 1BRCE 2ZDAH 3D49H 1RIWB 3BEUA 1OPHB 2ZFPH 2ZU5A 3ZVDA 2AS9A 2GCTC 1KXEA 3UOUA 5SGAE 4WY3A 1ZSLA 2QGRA 4TWYA 3ZV8A 2R0LA 1C1WH 2FI5E 1Y3XA 4BAHB 3BEFB 3ZYEA 1UMAH 1JIMA 1O5AB 2A45B 1EP5A 1SGQE 4AFUA 1P12E 2SFAA 2OD3B 5GCHF 3VB6A 2SGAA 2B0FA 1HPGA 1WTHD 2BDGA 1IQIA 3G01A 5EQSA 4JK6A 1OP8A 1CBWC 5FCRA 1XVOA 3L33A 4UFFH 3A88A 3TH4H 1KXAA 4AYVB 2P3TB 1BTWA 2WV5A 1ZTJA 3GYLB 4AFZA 1JMOH 3GICB 1GCTC 1KLTA 2HLCA 1G3BA 3H7TA 3SNAA 4H42U 2QY0B 4LOYH 3MH4A 1EATA 1RD3B 3RXLA 1BCUH 1H8IH 3E0PB 1TLDA 3GCOA 1P9UA 1C2FA 3B9FH 2ZFSA 1UTPA 4ZHLU 3KF2A 1YF4A 1PYTD 1DM4B 4ZHAA 5DKMA 3SO3A 1GI1A 2EEKA 2J95A 4HI3A 1K1LA 4THNH 2ODQA 3SU6A 1QGFA 3BSQA 2GZ8A 3S0NA 1JIRA 1V2PT 3CS0A 1W2KH 3SZNA 1C2DA 4NA7A 1LHEH 1AVXA 3QTVH 1GMHG 1O5EH 1C5OH 2ZDMA 3SOSA 2EI8A 2Z9LA 1MTUA 3RXPA 1QB9A 7LPRA 3A81A 1FIZA 2XBWA 1SQTA 3S9BA 4ZXYH 1SFIA 1TGCA 2EI6A 2EA3A 2Y6TA 2G5NA 2ILNA 1ZJDA 1X7AC 3LPRA 3UPEA 1QJ7B 4AOQA 3F1SB 4MVNA 1WYKA 2AYWA 3GDUA 1G2MA 4INLA 4BOHA 3NUMA 2ULLA 1SOTA 2PW8H 2V3HH 1BMNH 1TBZH 5EPYA 3VGCB 3RXAA 4GHQA 3OSYA 1HAYB 2Z9JA 1E37B 1BQYA 1E36B 2A32A 1YPHE 1QHRB 1GBTA 1GHAG 2CJIA 4FVBA 2W7SA 3RXDA 4DG4A 2WPHS 8LPRA 3BTQE 2VU8E 2AMQA 3KNXA 5JBAS 4X8SH 1TYNA 2ZGCA 2QF0A 4YOJA 1T8OA 1FDPA 3A8CA 2VIWA 3URCA 1NFXA 3EAJA 5LH8A 3Q3XA 1K22H 3QN7A 1DY8A 2BX3A 5EODA 4IC5A 1OWEA 1GCDA 3SGBE 5A8YA 2KAIB 3A85A 2PUQH 2A7HA 4Y0ZE 1L0ZA 2W3IA 1P10A 1QBOA 5PTPA 3HPTB 3T29A 2B5TB 2JETB 3RDZA 1O30A 2Z3EA 4HZHA 3RU4E 3QGJA 2BVRH 1ZTKA 1SVPA 1O3EA 1G32B 5HM2A 1S0QA 1EAWA 3MNSA 2B8OH 2OC0A 2SNWA 3R3GB 1OWKA 3U1IB 2VWMA 4FUFA 4JZDH 4XBCA 2HALA 1D6RA 1O2YA 1ZSKA 2YNAA 1NFYA 3FFGA 2FXRA 3LIWA 3SU1A 5F6MA 1SR5C 1JOUB 2AH4X 1TA6A 4JZEH 4X2VA 3BTTE 3GY5A 2ODPA 1P02A 2ZFTA 1BHXB 1ETSH 2G52A 2SGPE 2ESTE 3TU7H 1LPGB 2ZP0H 2BDHA 5A2MH 2VWNA 2WUBA 4RSPA 1Y5BT 1GI6A 1KDQB 2C8XB 3PB1E 1SGFG 2XCFA 1O2JA 4FU8A 1C5TA 1NFUA 2F83A 1UTKA 1QY6A 3ATMA 2PV9B 1HGTH 3BG4B 4FUIA 1EPTA 5K0HA 4A1TA 1T31A 4H4FA 2ZPRA 5A0BA 3MH6A 3SV7A 1MTNB 4Y8YA 2CHAC 1W8BH 1S84A 4I8KA 1MZAA 1LKBA 1FPCH 4NA8A 1F0UA 2BTCE 1EB2A 2TGAA 1SBWA 1LCYA 2NWNA 2Z3DA 4Y11E 2J94A 4AFQA 1ELTA 4FUBA 2BQWB 1MKWH 2NU1E 4SGAE 1O2MA 2QC2A 2H1UA 1GI0A 3PV4A 1Q3XA 1TA2A 2V0BA 1H1BA 1ZLRA 2G4UA 1C4U2 1O3AA 1PPFE 3RC6A 4GCHG 1ELBA 4BXSA 1O34A 2BDBA 3LONA 4IBLH 1EUFA 1MMJN 4GLYA 2UUFB 2IOTA 2PKAB 2LPRA 3NCLA 5DK1A 1GMHF 4I8LA 1WTGH 2BD5A 1GJ9B 1BTZA 2UWPA 3VFEA 1ARBA 1N1LA 3SGQE 1MZDA 4FU7A 1C1MA 2DE8A 2F9NA 1ETTH 1GBCA 5GWZA 1NFWA 1C5LH 3FVFB 5CMXH 2Z9KA 1NRNH 2A5AA 3SV8A 1V2RT 4LZ1H 3ODDA 1TNLA 3D62A 3ZVCA 5L2YH 1LQDB 2P3FH 3M5LA 4NFEA 4X8VH 1ZGVA 1P2OA 1DLEA 3SU5A 3ZZ3A 1HDTH 1AU8A 1QL7A 1GBFA 1K1IA 1MKXH 1SC8U 1QJ1B 1QJ6B 1O31A 3S9CA 3F68H 3BTGE 1DWDH 1SSXA 2IJOB 3ITIA 4FU9A 2P3UB 4XE4A 1EZQA 5F03A 1VITG 3HKJB 4YZUA 3C27B 2C90B 1A3BH 1EAUA 1EOLA 1FY3A 1YLCA 1LKAA 2XWBI 3A7VA 1W3CA 1A5IA 3ZZ6A 1TNJA 1P2NA 3BTWE 3HATH 3IWMA 1NRQH 4Y10E 1ANBA 3ATKA 6ESTA 4MDSA 2WPMS 1LHDH 3MO9A 4U01A 4CHAB 4XDEA 1UVPA 2ZO3H 1V2UT 1F92A 1OP2A 4ZHMU 1MKWK 2ANKH 3LGVA 4MNYA 3PMJA 1EOJA 3E1XB 3RXGA 1C1PA 1T8MA 4FUCA 1BTHH 1XM1A 1AB9B 1CHOG 3H7OA 2FTLE 1GG6C 4AZ2B 1O3JA 4BNRA 2ZHQH 3MO6A 2PKSC 4BTTB 4MG3A 3MYWA 1HCGA 2FLRH 3WY8A 3SBKA 4CR9A 4CREA 3EE0B 1J14A 2THFB 3MWIU 3TK6A 3QO6A 1KTSB 4A1XA 3QX5H 8ESTE 3KHVA 1EZSC 3U8OH 5FX6A 1OWDA 2ANYA 4MNXA 1J15A 3ELAH 1TX6A 4TWWA 2ZI2H 2BY6X 2QIQA 1O2OA 2TIOA 1G3EA 2A4QA 1GMCG 2GDDA 4OGXA 3T25A 4OS6A 3GY3A 5TCCA 2H9HA 1GI3A 3TGKE 1MKXK 2CF8H 1GHVH 1O2VA 1BT7A 2W7UA 3HGNA 3T26A 1RGQA 2AERH 1OYQA 1BJVA 1QR3E 3KN2A 5DP3A 4CBOA 1T7CA 1SLXB 1TFXA 2ZDVH 4XFQA 3ZZ5A 1G3DA 1GI8B 1HJ9A 2P94A 4A92A 4VGCB 1LMWB 3ZV9A 1C9TA 1YLDA 4SGBE 1NRSH 1DFPA 2ZKSA 3QK1A 1V2NT 4BAQB 4GCHF 4IS5A 1PPGE 4YOGA 5GDSH 5AF9H 2DE9A 1CHGA 4NIWA 2C3SA 1O32A 1UK2A 1GDQA 2GT8A 1O2IA 4ABBA 9LPRA 3SUFA 1OYTH 4X2YA 5HXFA 1RJXB 1QA0A 1KLJH 2HNTC 1BTYA 3UUZA 3EYDA 5I46H 1HIAB 2OP9A 1TMTH 3RXJA 4I32A 5GIBA 5A8ZA 1WV7H 3L6PA 1NC6A 2FS8A 4H6SB 5J4QA 1MCTA 1CA0C 7GCHG 2O9QA 5DPAA 1EX3A 1V2QT 3U1JB 1IQLA 1D9IA 1AD8H 2GKVE 2BXTH 1C2MA 4CRFA 2WPLS 4IMZA 1QNJA 1OX1A 2ZGXH 2ZHFH 4KELA 2VINA 1VITF 2BLWA 1F5KU 1AIXH 1GHBG 1BBRE 1LQEA 3STJA 1F2SE 5L6NH 2FYQA 2ZHEH 4WXVA 3KGPA 1W11U 2V6NA 5E8EH 1IHTH 2GGVB 3BTME 2JH6D 3RMNH 6LPRA 1XUHA 1GL1A 5EU8A 1FXYA 1O3PB 1IQJA 3I78A 3MU0A 1GJCB 1EJMA 1SI5H 2Z94A 4B75A 1TQ0B 2RDLA 3MU5A 5AVDA 2P93A 4I8GA 3SQEE 1HBTH 1XMNB 4AG2A 2VGCC 4B74A 4AORA 1AKSB 3SUGA 2QA9E 1AZZA 1AWHB 4JCNA 3PROA 1ZTLA 1AFQB 4X2XA 3TVJB 3TNSA 3Q76A 1VR1H 1H9IE 1DE7H 3M5NA 4UFGH 1CHOF 2BD2A 3TJUA 3UQVA 3SJ8A 4D9QA 1V2KT 3FANA 4ZKNU 8GCHF 1UCYE 1YC0A 2XRCA 5DO4H 1V2TT 1QBNA 2H6MA 5ESTE 1O3DA 1P2JA 2IPHA 3F6UH 3MNXA 2FWWA 1TOCB 2HWLB 3M7UA 1O3CA 1UVUH 2J34A 3LJOA 3JZ1B 1NT1A 4WMEA 3EA7A 2BHGA 5LGOA 3KQDA 3TNTA 1GGDC 2ZG0H 2BDIA 1V2VT 5E2OA 1CT2E 1K1NA 1UK3A 1DX5M 1HAVA 2QXJA 1A5GH 1HAZB 2O8TA 2Y81A 3F9EA 1T8NA 3MOCA 2WV4A 2FPZA 2H5CA 1CVWH 2BDAA 2FOMB 1ELCA 1MD8A 4CRBA 5EGMA 3GY8A 5E0HA 2HVXA 5H4IB 1T8LA 2ZCLP 3MU1A 4TY7A 1TQ7B 5E0JA 1EB1H 1IQEA 1ESBA 2B9LA 4MPWA 2ZTZA 3PLBA 1G3CA 1XUKA 2QF3A 1HXFH 3S7KB 1DICA 2ZDNA 1IOEA 5EXLA 4Y7AA 4ABDA 4WF8A 3LKWA 1HNEE 2BM2A 1CU1A 2Z3CA 2R0KA 5GJ4B 2XYAA 3UWJH 1C2IA 2PGQB 1SB1H 3MHWU 2FI3E 2O8UA 2P59A 1GJ5H 1C1NA 4DT7B 2BYAX 3RXEA 1C2EA 1S6HA 2SGQE 2G00A 4Y0YE 5EW1H 2VB0A 3SNBA 1TGNA 1KIGH 3ZZCA 1ZGIA 3LJJA 1KXBA 5GXPA 1C5MD 2GT7A 2XTTB 2F3CE 2J38A 2VIOA 3AW1A 1T4UH 5EW2H 1M9UA 1TNIA 3LGTA 1DOJA 4OS1A 3VB3A 1O5GH 1TGBA 3F9HA 1J8AA 1VZQH 1V2MT 2XNIA 1CT4E 3NZIA 1GBDA 3SUEA 1FI8A 1HXEH 3M3VA 4K1SA 1E34B 1S81A 4UFEH 1SLWB 1HUTH 2BMGB 3P92A 1PQ5A 2K1QA 1GVKB 3EGKH 1C2JA 1TGSZ 4X8TH 3A7XA 5DJ7A 1DPOA 2G5VA 5A0CA 2OBOA 4ABEA 3V12A 1C1QA 3A87A 1Y5AT 1RRKA 1Y3WA 1NPMA 3KEEA 2ZHDA 3W94A 3TITA 1A0HB 4AN7A 3MO3A 4DCDA 3KQBA 1UVSH 2P8OC 3RXHA 3RUOA 1Y3UA 2OCVB 1GJDB 3UTUH 2WYGA 1F0SA 4ZUHA 1V2ST 3OTJE 3U98H 3AASA 1GI2A 6GCHF 1P2MA 4I31A 3FZZA 3RC4A 1AQ7A 2UWLA 3H5CB 1P04A 1QRXA 3GY2A 2A4GA 3M7TA 1ORFA 3SU0A 2TRMA 3ZYDA 2XBYA 2WINI 3GDVA 2R9PA 4CRDA 1MU6B 4JZFH 1C5QA 1JRTA 3RXBA 2FS9A 3E6PH 1FUJA 4OGYA 4FUHA 1C1VH 3RLWH 1C1SA 1THSH 2JH0D 2PLXA 3ATLA 3URDA 2W5EA 1YPMH 5C1UA 2A4RA 3BTFE 3ATIA 2EC9H 1T4VH 4X1PU 2Q6GA 3A89A 1Z1IA 1L2EA 2GD4B 3GCNA 1KTTB 2BDCA 2VWLA 3A8DA 2ALVA 1WSSH 4TY6A 3T27A 3KQEA 4GAWA 1KY9A 1O2SA 3M35A 3CENA 3RXMA 1ZRBA 2J2UA 1L4DA 1NM6A 2GDEH 1C5ZB 1HV7A 5BRRE 1BIOA 3RXSA 2STAE 5AFYH 1PPHE 5FPSA 2HNTE 1OWIA 1SGPE 4CH8B 1S83A 2PHBA 2FYRA 4WMFA 4GVUA 1S6FA 2H5DA 2OXSA 1D3QB 1DITH 5FAHA 1O2XA 1BOQA 1PFXC 3UOPA 1ID5H 1DY9A 4GUXA 4RKJB 1H4WA 2FOHA 5FCKA 4IN1A 4BAMB 1OXGA 1P2KA 4ABIA 1GJ6A 4HGCA 3LGUA 3JZ2B 1Y3VA 1P9SA 1TONA 3PO1C 2GMTC 2ZDKA 3P17H 4X2WA 3RMLH 1N8OB 4ASHA 5EXNA 2VVCA 4ZXXH 3GY6A 1Y8TA 3B23B 4Y7BA 1GPZA 4AFSA 1VGCC 1C4V2 3TH3H 1A0JA 1WUNH 1TRYA 2ZU1A 4JK5A 1CA0B 1BUIA 2C8YB 1GDNA 3ZZDA 1GBEA 1GBLA 3TIUA 4D7GA 4CRCA 2BD9A 1PPZA 2D2DA 2FMJA 5CHAC 1MAYA 3ZVFA 1NU9A 5K7RA 4ABGA 1SHYA 4ABJA 3OU0A 4A5TS 3GOVB 3IITA 3KIDU 1FJSA 3ZZBA 1ARCA 1QBVH 1K9OE 1FIWA 2Y7ZA 2HOBA 1ZHRA 2UUJB 1ZRKA 4ISIH 4FXGH 3QGNB 1JWTA 3VB5A 1UTNA 1C5VA 4F49A 2G8TA 1EQ9A 1UHBA 1GI9B 1Z8GA 2QXHA 2Z7FE 3GY7A 1CT0E 3C1KA 1AUJA 3PLPA 5JYIA 2VIPA 2AMDA 5F8TA 1AE5A 1HFDA 2BD3A 3FP8E 2UWOA 1C2LA 1C5NH 2W26A 4DW2U 1A4WH 3TGIE 1K28D 2IN2A 1DLKB 2ZGJA 5A09A 1HJAB 3SV6A 5C1XA 2J4IA 1ZPZA 3MH7A 1VJ9U 1OSSA 1TNGA 1K1JA 1PPCE 3QZRA 1ABJH 1SQAA 4A7IB 2O8LA 1L1GA 1O3GA 1YCPH 1K1OA 1VITH 2QCYA 1TBRH 3E8LA 3ZZ4A 2R2WU 3SQHE 2FOFA 4DJZB 1RIWC 2AGGX 3S9AA 2FOEA 2ZWLH 2A0QB 1DWEH 5C20A 3NXPA 1VJAU 1ELFA 1YKTA 1YPEH 5T6DA 4NSYA 5EG4A 4DURA 5C3NA 4JYUH 2OUAA 4NIVA 3SU4A 1G37A 1TBQH 2ALPA 1LDTT 1PPBH 1CGHA 1P11E 3GCHC 4ABHA 1GHAF 3CS7A 1DDJA 1NRPH 1C4Y2 1TIOA 4B1TA 3P8GA 4O3TA 1CGJE 3LGIA 3O8DA 1ZPBA 1HAGE 2OC1A 1PQ7A 3NK8A 1EXFA 1TRNA 4IW4E 7ESTE 2RG3A 1UTOA 2VH6A 5JBTA 1EJNA 2AMPA 4JYTA 1LVMA 3Q00A 1CE5A 3VEQB 2UUKB 1GDUA 1YCPM 1O3BA 3SNDA 5FPYA 3SNCA 4E06H 5E2PA 2I6QA 3PLKA 2R2MB 2D26C 1ANCA 2G55A 1V2JT 5T6GA 4A1VA 4B2BA 1YM0A 1D4PB 4CR5A 1O2LA 3TJNA 1O2TA 2Z9IA 2BLQA 5HGGA 5A0AE 2DUCA 1YP9A 1BB0B 2ANMH 2C93B 3SN8A 5C2ZA 3E3TA 2SGEE 4FUGA 4ZKSU 1EPTB 4A6LA 1W14U 2SGFE 1ANEA 4UE7H 2QN5T 3QTOH 1O37A 4NZQA 4FUJA 1GBJA 5L30H 3GISB 1DS2E 1P05A 2GCTB 1SGNE 4BAOB 3MU8A 3K9XB 1FAKH 3UR9A 2BVXH 5IYTA 1RTFB 4RN6A 1F0RA 1AVGH 4FUEA 2CF9H 1A46H 2ZQ2A 1J16A 1Z71A 4HFPB 3KQCA 1B5GH 1WOFA 1YCPK 3M5MA 1GVZA 1PPEE 2OLGA 1O2RA 2OC7A 1CBWB 4YLQH 1OKXA 3OYPA 2ZA5A 3LT3A 1Z6EA 3U8RH 2A1DB 4Y79A 1RFNA 3VGCC 4IMQA 4NSVA 4YT6H 1N6XA 1GCTB 3RXKA 1AY6H 7KMEH 3DHKH 1W0ZU 1ELAA 2NU4E 1KYNA 1BJUA 5DGJA 5G4BA 1XKAC 4GSOA 1C2KA 4YTAA 1TMBH 3ZZ9A 3SV9A 2ZC9H 4LXBH 1V2LT 3K6ZA 1W0YH 3RU4T 1W7GH 1MQ6A 1Z8IB 4FVDA 1O2QA 4MPXA 2XC0A 1A1RA 4X1RU 2XBVA 2AFQB 4NA9H 2OQUA 2ZZUH 3E16B 5TCAA 1LHCH 2RA3A 2WPIS 1WQVH 3SI3H 1UVTH 5HM9A 3A8BA 5JBCS 1FAXA 2JETC 3TGJE 4TPIZ 1GMDG 1YPHC 2GZ7A 1GI4A 2P95A 3RM2H 1D3DB 1G36A 3E0NB 2ZU2A 4TYDA 1ZHMA 3RXCA 3RC5A 4MLFB 2BD7A 1IQKA 1UTMA 3EA8A 3T28A 2NU2E 1W7XH 4Q7YA 4ISLA 1GBAA 4BAKB 1NU7B 4AGKA 1FN8A 4B73A 1SFQB 2Z9GA 2SGDE 3RXVA 1Z7KA 1ZMJA 3SW2B 2Q6FA 4DGJA 4K60A 4TPYA 2XWAA 4UONA 3ENSB 4YOIA 1YYY1 4GPGA 3LU9B 1P3EA 2TGDA 3OX7U 5B6OA 4JYVH 3R0FA 3HK3B 3EA9A 5A8XA 2O8WA 3BG4C 1BMLA 2BLOA 3E90B 1C5SA 1MTNC 2YNBA 1SGYE 1O5FH 1SGRE 2ZGBH 1ZYOA 1ESTA 4MNVA 3PM3A 2FM2A 2EI7A 3PYHA 3P8FA 1Y3YA 3PMHB 4NIYA 3FP6E 4IN2A 5EOKA 4ISOA 5T6FA 2ZIQH 1ZPCA 2AEIH 2HNTF 3KL6A 1C1RA 1TX7A 2XW9A 1C2GA 1TB6H 3P8NA 5IDKA 1O3OA 1O39A 1QURH 1DXPA 1XUFA 1ABIH 3PWCA 1HLTH 1TPSA 3DFLA 1A61H 4AG1A 4YM9A 1CSOE 1L1JA 1UO6A 2Y5GA 4O03A 1QTFA 4K2YA 2F9OA 1LPKB 1IQNA 5ABWA 1C5WB 5JDUB 1EAIA 2I6SA 1S85A 2ZPQA 2VIDA 4X1SU 1FV9A 3SU2A 1S0RA 5AFZH 3LOXA 3M3TA 3T62A 1PJPA 1SLVB 1QL9A 1D3TB 1T32A 4IGDA 1Z8RA 1O5BB 1Q2WA 3MTYA 3VPKA 2G81E 2GTBA 1AO5A 1HB0B 2PSXA 2TGTA 3ZZ8A 4WXIA 2OBQA 4NZLA 1XXFA 1HAOH 1LHGH 3A7TA 2NU0E 4CH2B 4KKDA 3NKKA 2CHAB 2P16A 4Q7ZA 3UR6A 3BTEE 2BD8A 2PUXB 1GMCF 3LH3A 5C5NA 4I8HA 1ZSJA 3O8BA 4AX9H 4BANB 1S5SA 4ZKOU 2V35A 3MH5A 2OQ5A 4R0IA 1MBQA 2PR3A 2AIQA 1HAHH 4AB8A 4OS5A 3TH2H 4OS2A 1MTSA 1O3IA 1TX8A 1GJ8B 1O2NA 1LVYA 5C1YA 3P70B 1C1UH 2BX4A 1NY22 2HGTH 2ZFQH 5C67A 3RXRA 5BPEA 1GVLA 4I33A 4XBDA 3M36A 2WYJA 4E7NA 4CHAC 1SHHB 1V2WT 2Y7XA 5FX5A 3DA9B 1K2I1 3DFJA 2FI4E 2WUCA 1LO6A 3F9FA 1SMFE 1EKBB 2M5TA 4WH8A 3GCTG 4IC6A 4K5ZA 2FDAA 2BD4A 3BTKE 1UTQA 1AGJA 2ZCKP 1AB9C 1A3EH 3A83A 1QCPA 5DP6A 7GCHF 2Y80A 1KXDA 1VCPA 4NWLA 2BZAA 1IAUA 3P95A 3I29A 3PMBB 1BBRH 1BITA 2KAIA 4KGAA 3TJOA 3UIRA 4WMDA 1GWAA 4NWKA 3GCHB 3M5OA 3BF6H 1DSTA 2Y5HA 4RKOB 1TPPA 1W12U 1A2CH 5ESBA 1GBHA 4E7RG 1E35B 1B0FA 2ZNKH 3UFAA 2V3OH 5L2ZH 5E0GA 2PFEA 1JRSA 4DY7B 4DOQA 1GHBF 1B0EA 8KME2 1MTVA 2VIQA 3I77A 1KSNA 4K69A 3VB4A 3MNCA 6CHAC 4F4OC 1C5YB 4X6MA 1TAWA 2J9NA 4WWYA 5EXMA 1GI7B 2R3UA 4U32A 4NCYA 5DG6A 1DVAH 3KCGH 3BG8A 3P6ZB 1OP0A 1C5PA 3A80A 4I7YH 1Z8JB 1ZHPA 2PGBB 3E91A 3UY9A 5ETXA 4Y76A 1MTWA 1KDQA 2F91A 1W13U 4VGCC 1HRTH 5DP8A 1LHFH 4X6NA 2ZEBA 2ZF0H 1UCYH 4HTCH 1ELEE 2GX4A 2W3KA 9ESTA 3BN9A 1RXPA 1GG6B 5LPFA 1BDAA 1DUAA 4J1YA 3A7ZA 3FZDA 4R8TB 2PKSB 4YLUA 1MCVA 1FN6A 3L3TA 4B71A 1UTJA 1GJBB 2YOLA 1HAVB 2SNVA 4WVPE 4INHA 1P2QA 3F9GA 2AGIX 4K3JA 1C1OA 3A84A 2AIPA 3SNEA 4AGJA 1HAPH 3TJVA 5FXLA 1BTPA 1QRWA 1YPKH 1LVBA 1Z1JA 1MBMA 4Y6DA 2A7CA 1BMAA 2BDYA 3HK6B 3AAUA 3TLOA 3DT0H 1BBRK 2PKAA 1RTLA 2QYIA 2ZECA 1BRAA 1O5DH 5LPRA 1D3PB 1O35A 5JPMH 5DP9A 3MU4A 2CXVA 1O2KA 2A7JA 1LPZB 2OC8A 3RMOH 1OWJA 2OINA 1NESE 1NROH 4ABAA 1BTXA 1FY1A 1RTKA 2XBXA 4DIHH 1GHXH 3UREA 1RS0A 1B7XB 1BRBE 1EP6A 4UEHH 4ABFA 3NPSA 3PMAB 1LVOA 3UNQA 4Y8XA 1F7ZA 1MH0A 4O97A 3ZVGA 1ZOMA 3FAOA 4UD9H 1DXWA 3GCTF 1PYTC 2ZPSA 4INKA 1L4ZA 2TPIZ 3D65E 4YT7H 2XC4A 1UCYK 1AHTH 2ZU4A 3SJ9A 1AFQC 4Y71A 3ZZAA 1TABE 1FY5A 1ZMLA 1BA8B 1IQGA 1NZQH 1SLUB 2F9PA 1DWBH 3S69A 1WAYB 4ISHH 2BZ6H 1GI5A 4U30A 1FQ3A 1GBMA 3LH1A 1MUEB 3ZVBA 4D8NA 1ZMNA 2GVFA 4K8YA
chains in the Genus database with same CATH superfamily
4KTCA 3LC5A 4U2WA 4O9VA 5JBBS 1AZ8A 2QAAA 2F9VA 4ZAEA 1OS8A 4KTUA 3Q77A 1O33A 2J92A 2FOGA 2TBSA 1P3CA 1TNHA 3TK5A 1GJAB 3F3BA 4X0WU 1QIXB 1JXPA 4D7FA 2A5IA 2VVUA 1EZUC 2BQ7B 2HLDD 1C5XB 4XOJA 2FESH 1AUTC 1GBBA 4O3UA 2M2AA 4BXWA 2QXIA 2ASUB 5F8ZA 1QL8A 1P57B 2VVVA 3RXQA 5DP7A 3TK9A 1GHZA 1O2GH 4UDWH 3U69H 1NRRH 2VGCB 1PQ8A 1J17T 2A31A 2LELA 4JZIA 4K1TA 3OY6U 2HRVA 2H9EH 2BB4A 1YPLH 2BXUH 2WHXA 1H8DH 1DWCH 1P01A 2BVSH 3LGWA 2D1JA 4WJG2 3V0XA 1OWHA 5JB8S 1C2HA 1O2PA 1W10U 3P8OA 2D8WA 4J2YB 4OS7A 3QUMP 1O2HA 3CNRA 4MQAA 2WPDD 3LC3A 1O3MA 1SGDE 2FODA 3QDZB 1UVOA 1BMMH 2HPPH 3VG8A 1W0KD 3V7TA 3MI4A 4HG6A 1SGTA 3D23A 1XXDA 5EQRA 2CV3A 3M7QA 2Q1JA 3NWUA 3ZIAD 1H9LB 1GHYH 3QLPH 1W0JD 1OOKB 1P8VC 1G9IE 3K6YA 4YO9A 3A8AA 1D6WA 1QA7A 1A5HA 3SU3A 2A2QH 1OHHD 3W95A 2ZHWH 5J4SA 1SOZA 1GGDB 1WU1A 3BIVH 5EIYA 2Z6BD 4X6OA 4JZ1A 1UJ1A 2F9UA 3B8JA 3M3SA 2BLVA 1KXCA 2C8ZB 1XVMA 4Q2KA 2BQ6B 4WH6A 2FLBH 4Q80A 3GYMA 5F8XA 2HVYB 4UFDH 4D76A 1HAIH 3ESTA 1ESAA 1HIAA 1IHSH 3SV2H 4I8JA 1SGIB 3SHAH 4NG9H 3STIA 2F9BH 4NIXA 1IQFA 3PTBA 1NS3A 1DANH 3OY5U 2ANWA 4X8UH 4XSKU 3A82A 4BTIB 1YPGH 3RLYH 1Z6JH 2CN0H 3RXIA 3EQ0H 4MPUA 3SORA 3RXUA 3SJIA 1KXFA 2FP7B 1THPB 2XC5A 2FOAA 1FY4A 1O2ZA 4MNWA 1GJ7B 2BOKA 1WQSA 3TPIZ 1EASA 2O8MA 1P0SH 1ZR0A 2FZZA 3ZVEA 1TRMA 1UHBB 2VNTA 1IQMA 4ZKRU 4LZ4B 3RXFA 3VXFH 3GS9A 1TWXB 1FLEE 1HJ8A 3RU4D 1NTPA 1G30B 2ZTXA 1AMHA 2LNCA 8GCHG 1YGCH 1F5RA 2H9TH 4AC9A 3ZVAA 3BTHE 4YESB 3F2FA 1BZXE 3V3MA 1C5UA 3KYFA 3HKIB 3BTDE 3A86A 1U6QA 1UK4A 2GZ9A 5EPNA 1AKSA 2HPQH 4KTSA 3T5FH 4ZH8A 2ZTYA 2PWXA 5I25A 1C1TA 1SGEE 3A7WA 2FX4A 1GL0E 5DP4A 2PSYA 4X1QU 5FHTA 4ISNA 1C9PA 1FX0B 5TJXA 5JB9S 2FOBA 6CHAB 3EDXB 3VXEH 1GBIA 5HMAA 1O5CB 3BV9B 3ZZ7A 2WPKS 2FO9A 2A5KA 1DUEA 1FPHH 1XX9A 4NGAH 5LPEA 1XUGA 2WPJS 1ZJKA 4Q7XA 2JH5D 2Y5FA 1K1MA 3GY4A 1TMUH 2GCHG 3RXTA 4D9RA 5FBEA 2P8OB 1O38A 1K21H 1TPAE 1A7SA 1GHWH 5C5OA 2GV7A 3GDSA 1AN1E 3SZEA 1INCA 1F5LA 1HYLA 1V2OT 2XXLA 1ZZZA 1SPJA 3ODFA 1TGTA 3A7YA 3LGYA 1O2WA 2FEQH 3Q3KA 1Q31A 1NN6A 5GPIB 2Y82A 1G2LA 1TPOA 2BOHB 3UNRA 2Q6DA 1N8OC 4H6TA 1QB1A 2STBE 1AVWA 2FOCA 4NFFA 3SI4H 4CRAA 1ELDE 1XUIA 3AAVA 3RXOA 1MU8B 4JMYA 4KP0A 4K1EA 2ODYB 5DP5A 5GCHG 3O8CA 2OTVA 1XUJA 2RCEA 4PROA 2VIVA 1WCZA 2QV1A 3MNBA 4ZMAH 2BY9X 3DD2H 1O0DH 4FUDA 1FNIA 2ZDLA 2WZQA 1IQHA 1QB6A 3M61U 1P2IA 1O3KA 2FIRH 3RP2A 1ACBE 2BY7X 4CRGA 2ZFFH 1CO7E 3K2UA 4QT8C 5CE1A 3SJOA 2KZ4A 2R3YA 2C8WB 1QQUA 1E38B 1O2UA 3S7HB 1C5RA 4Y8ZA 1TOMH 1ETRH 1YBWA 5AHGH 1FY8E 1H9HE 1Y59T 2GP9B 2ZCHP 4X6PA 4B2CA 1FONA 3F2GA 3PWBA 2CMYA 3M37A 2G51A 2W6JD 4K8BA 3CP7A 3O8RA 1V3XA 1NO9H 2BY8X 3AVZA 3RMMH 2FX6A 1CA8B 1EJAA 3PO1B 3MQKC 2GMTB 1E0FD 2H2ZA 2B7DH 1BHXF 4Z6AH 5FL7D 1HJAC 1PQAA 1THRH 3U9AH 2L6OA 2AGEX 2OK5A 1J9CH 3SGAE 1ELVA 3Q3YA 4M7GA 1P09A 1BRUP 1HAXB 1LTOA 1QRZA 4LK4A 6GCHG 2ZU3A 3RM0H 2GV6A 1SG8B 1VGCB 4OS4A 5FBIA 3T2NA 1O3HA 2PTNA 3VB7A 2JKHA 1SQRA 2XCNA 1SGFA 3UNSA 2BY5X 3UWIA 1VCQA 1V6DA 1VCWA 1BTUA 2TGPZ 1Y5UT 3FP7E 2C4FH 2UUYA 3PRBA 1DSUA 4MTBA 3MFJA 3K65B 2ZFRH 4XBBA 1QQ4A 2A4OA 5CHAB 2VJ1A 3SHCH 3ATWA 1FZZA 4ESTE 2ZGHA 2A2XH 4AYYB 3LDXH 1A0LA 3AW0A 4B2AA 1CQQA 1AFEH 5KECA 1MD7A 1KLIH 3SJKA 4CBNA 1F0TA 1TNKA 2QXGA 1TE0A 1AWFH 4GHTA 3SUDA 2PTCE 4E05H 3BEIB 1O3LA 5IK2D 1EZXC 1MQ5A 5FPTA 4DVAU 3QZQA 2NU3E 1K1PA 1SQOA 2VH0A 1XKBC 3MMGA 3U8TH 3DUXH 1DT2A 4DIIH 2ZQ1A 2FTMA 3IG6B 1TALA 3HGPA 1QFKH 4B76A 4ZCNA 4X1NU 1MAXA 5HYOA 3DSOA 1ANDA 2G4TA 4ZROA 3V13A 1AI8H 3BIUH 2CGAA 3WW7A 1AE8H 1UTLM 2RA0A 3N7OA 3U28C 1L1NA 1O36A 1SL3A 1ELGA 1O3FA 1GJ4H 2GCHF 1O3NA 1YPJH 1P03A 1EAXA 1P06A 1N6YA 4MPVA 1S82A 3PTNA 1WBGB 3UQOA 1FMGA 1GMDF 1SGCA 3QWCH 1GBKA 1JBUH 1CGIE 5T3HA 4BTUB 5EQQA 1EPTC 2VWOA 4Z0KA 4AB9A 1BRCE 2ZDAH 3D49H 3FOAA 1RIWB 3BEUA 1OPHB 2ZFPH 2ZU5A 3ZVDA 2AS9A 2GCTC 1KXEA 3UOUA 5SGAE 4WY3A 1ZSLA 5EJZA 2QGRA 4TWYA 4TSFD 3ZV8A 2R0LA 1C1WH 2CK3D 2FI5E 1Y3XA 4BAHB 3BEFB 3ZYEA 1UMAH 1JIMA 1O5AB 2A45B 1EP5A 1SGQE 4AFUA 1P12E 3F2HA 2SFAA 2OD3B 5GCHF 3VB6A 2SGAA 2B0FA 1HPGA 1WTHD 2BDGA 1IQIA 3G01A 5EQSA 4JK6A 1OP8A 1CBWC 5FCRA 1XVOA 3L33A 4UFFH 3A88A 3TH4H 1KXAA 4AYVB 2P3TB 1BTWA 2WV5A 1ZTJA 3GYLB 4AFZA 1WDIA 1JMOH 3GICB 1GCTC 1KLTA 2HLCA 5CHBA 1G3BA 3H7TA 3SNAA 4H42U 2QY0B 4LOYH 3MH4A 1EATA 1MABB 1RD3B 3RXLA 1BCUH 1H8IH 3E0PB 1TLDA 3GCOA 1P9UA 1C2FA 3B9FH 2ZFSA 1UTPA 4ZHLU 3KF2A 1YF4A 1PYTD 1DM4B 4ZHAA 5DKMA 3SO3A 1GI1A 2EEKA 4P00A 2J95A 4HI3A 1K1LA 4THNH 2ODQA 5DSFA 3SU6A 1QGFA 3BSQA 2GZ8A 3S0NA 1JIRA 1V2PT 3CS0A 1W2KH 2VBCA 3SZNA 1C2DA 4NA7A 1LHEH 1AVXA 3QTVH 1GMHG 1O5EH 1C5OH 2ZDMA 3SOSA 2EI8A 2Z9LA 1MTUA 3RXPA 1QB9A 7LPRA 3A81A 1FIZA 2XBWA 1SQTA 3S9BA 4ZXYH 1SFIA 1TGCA 2EI6A 2EA3A 2Y6TA 2G5NA 2ILNA 4Q63A 1ZJDA 5C17A 1X7AC 3LPRA 3UPEA 1QJ7B 4AOQA 3F1SB 4MVNA 1WYKA 2AYWA 3GDUA 1G2MA 4INLA 4BOHA 3NUMA 2ULLA 1SOTA 2PW8H 2V3HH 1BMNH 1TBZH 4RT0A 5EPYA 3VGCB 3RXAA 4GHQA 3OSYA 1HAYB 2Z9JA 1E37B 1BQYA 1E36B 2A32A 1YPHE 1QHRB 1GBTA 1GHAG 2CJIA 4FVBA 2W7SA 3RXDA 4DG4A 2WPHS 8LPRA 3BTQE 3KYGA 2VU8E 2AMQA 3KNXA 5JBAS 4X8SH 1TYNA 2ZGCA 2QF0A 4YOJA 1T8OA 1FDPA 3A8CA 2VIWA 3URCA 1NFXA 2EQNA 3EAJA 5LH8A 3OAAD 3Q3XA 5EJ1A 1K22H 3QN7A 1DY8A 2BX3A 2YMSC 2J5UA 5EODA 4IC5A 1OWEA 1GCDA 3SGBE 5A8YA 2KAIB 3A85A 2XOKD 2PUQH 2A7HA 4Y0ZE 1L0ZA 2W3IA 1P10A 1QBOA 5PTPA 3HPTB 3T29A 2B5TB 2JETB 3RDZA 1O30A 2Z3EA 3FO8D 4HZHA 3RU4E 3QGJA 2BVRH 1ZTKA 1SVPA 1O3EA 1G32B 5HM2A 1S0QA 1EAWA 3MNSA 2B8OH 2OC0A 2SNWA 3R3GB 1OWKA 3U1IB 2VWMA 4FUFA 4JZDH 4XBCA 2HALA 1D6RA 1O2YA 1ZSKA 2YNAA 1NFYA 3FFGA 2FXRA 5C0UA 3LIWA 3SU1A 5F6MA 1SR5C 1JOUB 2AH4X 1TA6A 4JZEH 4Q4LA 3BTTE 3GY5A 4X2VA 2ODPA 1P02A 2ZFTA 1BHXB 1ETSH 2G52A 2SGPE 2ESTE 3TU7H 1LPGB 2ZP0H 2BDHA 5A2MH 2VWNA 2WUBA 4RSPA 1Y5BT 1GI6A 1KDQB 2C8XB 3OE7D 3PB1E 1SGFG 2XCFA 1O2JA 4FU8A 1C5TA 1NFUA 2F83A 1UTKA 1QY6A 3ATMA 2PV9B 1HGTH 3BG4B 4FUIA 1EPTA 5K0HA 4A1TA 1T31A 4H4FA 2ZPRA 5A0BA 3MH6A 3SV7A 1MTNB 3UAIC 4Y8YA 2CHAC 1W8BH 1S84A 5T1VA 4I8KA 1MZAA 1LKBA 1FPCH 4NA8A 2IJD1 1F0UA 2BTCE 1EB2A 2TGAA 1SBWA 1LCYA 2NWNA 2Z3DA 4Y11E 2J94A 2WV9A 4AFQA 1ELTA 4FUBA 2BQWB 1MKWH 2NU1E 4SGAE 1O2MA 2QC2A 2H1UA 1GI0A 3PV4A 1Q3XA 1TA2A 2V0BA 1H1BA 1ZLRA 2G4UA 1C4U2 1O3AA 1PPFE 3RC6A 4GCHG 1ELBA 4BXSA 1O34A 2BDBA 3LONA 4IBLH 1EUFA 1MMJN 4GLYA 2UUFB 2IOTA 2PKAB 2LPRA 3NCLA 5DK1A 1GMHF 4I8LA 1WTGH 2BD5A 1GJ9B 1BTZA 2UWPA 3VFEA 1ARBA 1N1LA 3SGQE 1MZDA 4FU7A 1C1MA 2DE8A 2F9NA 1ETTH 1GBCA 5GWZA 1NFWA 2L74A 1C5LH 3FVFB 5CMXH 2Z9KA 1NRNH 2A5AA 3SV8A 1V2RT 4LZ1H 3ODDA 1TNLA 3D62A 3ZVCA 5L2YH 1LQDB 2P3FH 3M5LA 4NFEA 4X8VH 1ZGVA 1P2OA 1DLEA 3SU5A 4ACAA 1VKYA 4FETA 3ZZ3A 1HDTH 1AU8A 1QL7A 1GBFA 1K1IA 1MKXH 1SC8U 1QJ1B 1QJ6B 1O31A 3S9CA 5C94A 3F68H 3BTGE 1DWDH 1SSXA 2IJOB 3ITIA 4FU9A 2P3UB 4XE4A 1EZQA 5F03A 1VITG 3HKJB 4YZUA 3C27B 2C90B 1A3BH 1EAUA 1EOLA 1FY3A 1YLCA 1LKAA 2XWBI 3A7VA 1W3CA 1A5IA 3ZZ6A 1TNJA 4RT1A 1P2NA 3BTWE 3HATH 3IWMA 1NRQH 4Y10E 1ANBA 1EFRD 3ATKA 2PP6A 6ESTA 4MDSA 5KGOA 4P02A 2WPMS 1LHDH 3MO9A 4U01A 1YY3A 4CHAB 4XDEA 1UVPA 2ZO3H 1V2UT 1F92A 1OP2A 4ZHMU 1MKWK 2ANKH 3LGVA 4MNYA 3F0PA 3PMJA 1EOJA 3E1XB 3RXGA 1C1PA 1T8MA 4FUCA 1BTHH 1XM1A 1AB9B 1CHOG 3H7OA 2FTLE 1GG6C 4AZ2B 1O3JA 4BNRA 2ZHQH 3MO6A 2PKSC 4BTTB 4MG3A 3MYWA 1HCGA 2FLRH 3WY8A 3SBKA 4CR9A 4CREA 3EE0B 1J14A 2THFB 3MWIU 3TK6A 3QO6A 4F48B 1KTSB 4A1XA 3QX5H 2J98A 8ESTE 3KHVA 1EZSC 3U8OH 5FX6A 1OWDA 2ANYA 1UW7A 4MNXA 1J15A 3ELAH 1TX6A 4TWWA 2ZI2H 2BY6X 2QIQA 1O2OA 2TIOA 1G3EA 2A4QA 1GMCG 2GDDA 4OGXA 3T25A 4OS6A 3GY3A 5TCCA 1E79D 2H9HA 1GI3A 3TGKE 1MKXK 2CF8H 1GHVH 1O2VA 1BT7A 2W7UA 3HGNA 3T26A 1RGQA 2AERH 1OYQA 1BJVA 1QR3E 3FN8A 3KN2A 5DP3A 4CBOA 1T7CA 1SLXB 1TFXA 2ZDVH 4XFQA 3ZZ5A 1G3DA 1GI8B 1HJ9A 2P94A 3OEHD 4A92A 4VGCB 1LMWB 3ZV9A 1C9TA 1YLDA 4SGBE 1NRSH 1DFPA 4XD7D 2ZKSA 3QK1A 1V2NT 4BAQB 4GCHF 4IS5A 1PPGE 4YOGA 5GDSH 5AF9H 2DE9A 1CHGA 4NIWA 2C3SA 1O32A 1UK2A 1GDQA 2GT8A 1O2IA 4ABBA 9LPRA 3SUFA 1OYTH 4X2YA 5HXFA 1RJXB 1QA0A 1KLJH 2HNTC 1BTYA 3UUZA 3EYDA 5I46H 1HIAB 2OP9A 1TMTH 3RXJA 5B6LA 4I32A 5GIBA 5A8ZA 1WV7H 3L6PA 4ACBA 1NC6A 2FS8A 4H6SB 5J4QA 1MCTA 1CA0C 7GCHG 2O9QA 5DPAA 1EX3A 1V2QT 3U1JB 1IQLA 1D9IA 1AD8H 2GKVE 2BXTH 1C2MA 3H09A 3PRDA 4CRFA 2WPLS 4IMZA 1QNJA 1OX1A 2ZGXH 2ZHFH 2JIZD 4KELA 2VINA 1VITF 2BLWA 1F5KU 1AIXH 1GHBG 1BBRE 2KX4A 1LQEA 3STJA 1F2SE 5L6NH 5GNDA 2FYQA 2ZHEH 2GJGA 4WXVA 3KGPA 1W11U 2V6NA 5E8EH 1IHTH 2GGVB 3BTME 2JH6D 3RMNH 6LPRA 1XUHA 1GL1A 5EU8A 1FXYA 1O3PB 1IQJA 3I78A 4F55A 3MU0A 1GJCB 1EJMA 1SI5H 2Z94A 4B75A 1TQ0B 1BMFD 2RDLA 3MU5A 5AVDA 2P93A 4I8GA 3SQEE 1HBTH 1XMNB 4AG2A 2VGCC 4B74A 4AORA 1AKSB 3SUGA 2QA9E 1AZZA 1AWHB 4JCNA 3PROA 1ZTLA 1AFQB 4X2XA 3TVJB 3TNSA 3Q76A 1VR1H 1H9IE 1DE7H 3M5NA 4UFGH 1CHOF 2BD2A 3TJUA 3UQVA 3SJ8A 4D9QA 1V2KT 3FANA 4ZKNU 8GCHF 1UCYE 1YC0A 2XRCA 5DO4H 2KFWA 1V2TT 1QBNA 2H6MA 5ESTE 1O3DA 1P2JA 2IPHA 3F6UH 3MNXA 2FWWA 1TOCB 2HWLB 1WXRA 3OTPA 3M7UA 1O3CA 1UVUH 2J34A 3W1EA 3LJOA 3JZ1B 1NT1A 4WMEA 3EA7A 2BHGA 5LGOA 3KQDA 3TNTA 1GGDC 2ZG0H 2BDIA 1V2VT 5E2OA 1CT2E 1K1NA 1UK3A 1DX5M 1HAVA 2QXJA 1A5GH 1HAZB 2O8TA 2Y81A 3F9EA 1T8NA 3MOCA 2WV4A 2FPZA 2H5CA 1CVWH 2BDAA 2FOMB 1ELCA 1MD8A 4CRBA 5EGMA 3GY8A 2KCYA 5E0HA 2HVXA 5H4IB 1T8LA 2ZCLP 3MU1A 4TY7A 1TQ7B 3OEED 5E0JA 1EB1H 1IQEA 1ESBA 2B9LA 4MPWA 2ZTZA 3PLBA 1G3CA 1XUKA 2QF3A 1HXFH 3S7KB 1DICA 2ZDNA 1IOEA 5EXLA 4Y7AA 5CDFE 4ABDA 4WF8A 3LKWA 1HNEE 2BM2A 1CU1A 2Z3CA 2R0KA 5GJ4B 2XYAA 3UWJH 1C2IA 2PGQB 4B6FA 1SB1H 3MHWU 2FI3E 2O8UA 2P59A 1GJ5H 1C1NA 4DT7B 2BYAX 3RXEA 1QZ8A 1C2EA 1S6HA 2SGQE 2G00A 4Y0YE 5EW1H 2VB0A 3SNBA 1TGNA 1KIGH 3ZZCA 1ZGIA 3LJJA 1KXBA 5GXPA 2QE7D 1C5MD 2GT7A 2XTTB 2F3CE 2J38A 2VIOA 2YMSD 3AW1A 1T4UH 5EW2H 1M9UA 1TNIA 4FOUC 4XRNA 3LGTA 1DOJA 4OS1A 3VB3A 1O5GH 1TGBA 3F9HA 1J8AA 1VZQH 1V2MT 2XNIA 1CT4E 3NZIA 1GBDA 3SUEA 1FI8A 1HXEH 3M3VA 4K1SA 1E34B 1S81A 4UFEH 1SLWB 1HUTH 2BMGB 3P92A 1PQ5A 2K1QA 5C0TA 1GVKB 3EGKH 1C2JA 1TGSZ 4X8TH 3A7XA 5DJ7A 1DPOA 2G5VA 5A0CA 2OBOA 4ABEA 3V12A 1C1QA 3A87A 1Y5AT 1RRKA 2F4LA 1Y3WA 1NPMA 3KEEA 2ZHDA 3W94A 3TITA 1A0HB 4AN7A 2JDID 3MO3A 4DCDA 3KQBA 1UVSH 2P8OC 3RXHA 3RUOA 1Y3UA 2OCVB 2W6ID 1GJDB 3UTUH 2WYGA 1F0SA 4ZUHA 1V2ST 3OTJE 3U98H 3AASA 1GI2A 6GCHF 1P2MA 4I31A 3FZZA 3RC4A 1AQ7A 2UWLA 3H5CB 1P04A 1QRXA 3GY2A 2A4GA 3M7TA 1ORFA 3SU0A 2TRMA 3ZYDA 2XBYA 2WINI 3GDVA 2R9PA 4CRDA 1MU6B 4JZFH 1C5QA 1JRTA 3RXBA 2FS9A 3E6PH 1FUJA 4OGYA 4FUHA 1C1VH 3RLWH 1C1SA 1THSH 2JH0D 2PLXA 3ATLA 3URDA 5HIYA 1E1QD 2W5EA 1YPMH 5C1UA 2A4RA 3BTFE 3ATIA 2EC9H 1T4VH 4X1PU 2Q6GA 2RFKC 3A89A 1Z1IA 1L2EA 3DCLA 2GD4B 3GCNA 1KTTB 2BDCA 2VWLA 3A8DA 2ALVA 1WSSH 4TY6A 3T27A 3KQEA 4GAWA 1KY9A 4RI0A 5EJLA 1O2SA 3M35A 3CENA 3RXMA 1ZRBA 2J2UA 1L4DA 1NM6A 2GDEH 1C5ZB 1HV7A 5BRRE 1BIOA 2KM0A 3RXSA 2STAE 5AFYH 1PPHE 5FPSA 2HNTE 1OWIA 1SGPE 1K0HA 5DN6D 3OFND 4CH8B 1S83A 2PHBA 2FYRA 4WMFA 4GVUA 1S6FA 2H5DA 2OXSA 1D3QB 1DITH 5FAHA 4ASUD 1O2XA 1BOQA 1PFXC 3UOPA 1ID5H 1DY9A 4GUXA 4RKJB 1H4WA 2FOHA 5FCKA 4IN1A 4BAMB 1OXGA 1P2KA 4ABIA 1GJ6A 4HGCA 3LGUA 3JZ2B 1Y3VA 2WSSD 2JJ2D 1P9SA 1TONA 3PO1C 2GMTC 2ZDKA 3P17H 4X2WA 3RMLH 1N8OB 4ASHA 5EXNA 2VVCA 4ZXXH 3GY6A 1Y8TA 3B23B 4Y7BA 1GPZA 4AFSA 1VGCC 1C4V2 3TH3H 1A0JA 1WUNH 1TRYA 2ZU1A 4JK5A 1CA0B 1BUIA 2C8YB 1GDNA 3ZZDA 1GBEA 1GBLA 3TIUA 4D7GA 4CRCA 2BD9A 1PPZA 2D2DA 2FMJA 5CHAC 1MAYA 3ZVFA 1NU9A 5K7RA 4ABGA 1SHYA 4ABJA 3OU0A 4A5TS 3GOVB 3IITA 3KIDU 1FJSA 3ZZBA 1ARCA 1QBVH 4YXWD 1K9OE 1FIWA 2Y7ZA 2HOBA 1ZHRA 2UUJB 1ZRKA 4ISIH 4FXGH 3QGNB 1JWTA 3VB5A 1UTNA 1C5VA 4F49A 2G8TA 1EQ9A 1UHBA 1GI9B 2JJ1D 1Z8GA 2QXHA 2Z7FE 3GY7A 1CT0E 3C1KA 1AUJA 3PLPA 5JYIA 2VIPA 2AMDA 5F8TA 1AE5A 1HFDA 2BD3A 3FP8E 2UWOA 1C2LA 1C5NH 2W26A 4DW2U 1A4WH 3TGIE 1K28D 2IN2A 1DLKB 2ZGJA 5A09A 1HJAB 3SV6A 2XNDD 5C1XA 2J4IA 1ZPZA 3MH7A 2IPQX 1VJ9U 1OSSA 1TNGA 1K1JA 1PPCE 3QZRA 1ABJH 1SQAA 4A7IB 2O8LA 1L1GA 1O3GA 1YCPH 3NRLA 1K1OA 1VITH 2QCYA 1TBRH 3E8LA 3ZZ4A 2R2WU 3SQHE 2FOFA 4DJZB 1RIWC 2AGGX 3S9AA 3DSPA 4M9FA 4TT3D 2FOEA 2ZWLH 2A0QB 1DWEH 5C20A 3NXPA 1VJAU 1ELFA 1YKTA 1YPEH 5T6DA 4NSYA 5EG4A 4DURA 5C3NA 4JYUH 2OUAA 4NIVA 3SU4A 1G37A 1TBQH 2ALPA 1LDTT 1PPBH 1CGHA 1P11E 3GCHC 4ABHA 1GHAF 3CS7A 1DDJA 1NRPH 1C4Y2 1TIOA 4B1TA 3P8GA 4O3TA 1CGJE 3LGIA 3O8DA 1ZPBA 1HAGE 2OC1A 1PQ7A 3NK8A 1EXFA 1TRNA 4IW4E 7ESTE 2RG3A 1UTOA 2VH6A 5JBTA 1EJNA 2AMPA 4JYTA 4B6EA 1LVMA 3Q00A 1CE5A 3VEQB 2UUKB 1GDUA 1YCPM 1O3BA 3SNDA 5FPYA 3SNCA 4E06H 5E2PA 2I6QA 3PLKA 2R2MB 2D26C 1ANCA 2G55A 1V2JT 3N7DA 5T6GA 4A1VA 4B2BA 1YM0A 1D4PB 4CR5A 1O2LA 3TJNA 1O2TA 2Z9IA 2BLQA 5HGGA 5A0AE 2DUCA 1YP9A 1BB0B 2ANMH 2C93B 3SN8A 5C2ZA 3UB0A 3E3TA 2SGEE 4FUGA 4ZKSU 1EPTB 4A6LA 1W14U 2SGFE 1ANEA 4UE7H 2QN5T 3QTOH 1O37A 4NZQA 4FUJA 1GBJA 5L30H 3GISB 1DS2E 1P05A 2GCTB 1SGNE 4BAOB 3MU8A 3K9XB 1FAKH 3UR9A 2BVXH 5IYTA 1RTFB 4RN6A 1F0RA 1AVGH 4FUEA 2CF9H 1A46H 2ZQ2A 1J16A 1Z71A 4HFPB 3KQCA 1B5GH 1WOFA 1YCPK 3M5MA 1GVZA 1PPEE 2OLGA 1O2RA 2OC7A 1CBWB 4YLQH 1OKXA 3OYPA 2ZA5A 3LT3A 1Z6EA 3U8RH 2A1DB 4Y79A 1RFNA 3VGCC 4IMQA 4NSVA 4YT6H 1N6XA 1GCTB 3RXKA 1AY6H 7KMEH 3DHKH 1W0ZU 1ELAA 2NU4E 1KYNA 1BJUA 5DGJA 5G4BA 1XKAC 4GSOA 1C2KA 4YTAA 1TMBH 3ZZ9A 3SV9A 2ZC9H 4LXBH 1V2LT 3K6ZA 1W0YH 3RU4T 1W7GH 1MQ6A 1Z8IB 4FVDA 1O2QA 4MPXA 2XC0A 1NBME 1A1RA 2AHME 4X1RU 2XBVA 2AFQB 4NA9H 2OQUA 2ZZUH 3E16B 5TCAA 2KCAA 1LHCH 2RA3A 2WPIS 1WQVH 3SI3H 1UVTH 5HM9A 3A8BA 5JBCS 1COWD 1FAXA 2JETC 3TGJE 3EE7A 1GMDG 4TPIZ 1YPHC 2GZ7A 1GI4A 2P95A 3RM2H 1D3DB 1G36A 3E0NB 2ZU2A 4TYDA 1ZHMA 3RXCA 3RC5A 4MLFB 2BD7A 1IQKA 1UTMA 3EA8A 3T28A 2RDEA 2NU2E 1W7XH 4Q7YA 4ISLA 1GBAA 4BAKB 1NU7B 4AGKA 1FN8A 4B73A 1SFQB 2Z9GA 2SGDE 3RXVA 1Z7KA 2KCPA 1ZMJA 3SW2B 2Q6FA 4DGJA 4K60A 4TPYA 2XWAA 4UONA 3ENSB 4YOIA 1YYY1 4GPGA 3LU9B 1P3EA 2TGDA 3OX7U 1H8HD 5B6OA 4JYVH 3R0FA 3HK3B 3EA9A 5A8XA 2O8WA 3BG4C 1BMLA 2BLOA 3E90B 1C5SA 1MTNC 2YNBA 1SGYE 1O5FH 1SGRE 2ZGBH 1ZYOA 2YMSB 1ESTA 4MNVA 3PM3A 2FM2A 2EI7A 3PYHA 3P8FA 1Y3YA 3PMHB 4NIYA 3FP6E 4IN2A 5EOKA 4ISOA 5T6FA 2ZIQH 1ZPCA 2AEIH 2HNTF 3KL6A 1C1RA 2J98B 1TX7A 2XW9A 1C2GA 1TB6H 2K8IA 3P8NA 5IDKA 1O3OA 1O39A 1QURH 3SYJA 1DXPA 1XUFA 1ABIH 2QF4A 3PWCA 1HLTH 1TPSA 3DFLA 1A61H 4AG1A 4YM9A 1CSOE 1L1JA 1UO6A 2Y5GA 4O03A 2V3MA 1QTFA 4K2YA 2F9OA 1LPKB 1IQNA 5ABWA 1C5WB 5JDUB 1EAIA 2I6SA 1S85A 3AK5A 2ZPQA 3KQ5A 2VIDA 4X1SU 1FV9A 3SU2A 1S0RA 5AFZH 3LOXA 3M3TA 3T62A 1PJPA 1SLVB 1QL9A 1D3TB 1T32A 4IGDA 1Z8RA 1O5BB 1Q2WA 3MTYA 3VPKA 2G81E 2GTBA 1AO5A 1HB0B 2PSXA 2TGTA 3ZZ8A 4WXIA 2OBQA 4NZLA 3FKSD 1XXFA 1HAOH 1LHGH 3A7TA 2NU0E 4CH2B 4KKDA 3NKKA 2CHAB 2P16A 4Q7ZA 3UR6A 3BTEE 2BD8A 2PUXB 1GMCF 3LH3A 5C5NA 4I8HA 1ZSJA 3N99A 3O8BA 4AX9H 4BANB 1S5SA 4ZKOU 2V35A 3MH5A 4OM9A 4DT4A 2OQ5A 2LP6A 4R0IA 1MBQA 2PR3A 2AIQA 1HAHH 4AB8A 4OS5A 3TH2H 4OS2A 3PV5A 1MTSA 1O3IA 1TX8A 1GJ8B 1O2NA 1LVYA 2V7QD 5C1YA 3P70B 1C1UH 2BX4A 1NY22 2HGTH 3N7EA 2ZFQH 4Z1MD 5C67A 3RXRA 5BPEA 1GVLA 4I33A 4XBDA 3M36A 2WYJA 4E7NA 4CHAC 1SHHB 1V2WT 2Y7XA 5FX5A 1NBMD 3DA9B 1K2I1 3DFJA 2FI4E 2WUCA 1LO6A 3F9FA 1SMFE 1EKBB 2M5TA 4WH8A 3GCTG 4IC6A 4K5ZA 3WWFA 2FDAA 2BD4A 3BTKE 1UTQA 1AGJA 2ZCKP 1AB9C 1A3EH 3A83A 1QCPA 5DP6A 7GCHF 2Y80A 1KXDA 1VCPA 4NWLA 2BZAA 1IAUA 3P95A 3I29A 3PMBB 1BBRH 1BITA 2KAIA 4KGAA 3TJOA 3UIRA 4WMDA 1GWAA 4NWKA 3GCHB 3M5OA 3BF6H 1DSTA 2Y5HA 4RKOB 1TPPA 4I86A 1W12U 1A2CH 5ESBA 1GBHA 4E7RG 1KMHB 1E35B 2K0QA 3F0OA 1B0FA 2ZNKH 3UFAA 2V3OH 5L2ZH 5E0GA 2PFEA 1JRSA 4DY7B 4DOQA 1GHBF 1B0EA 8KME2 1MTVA 2VIQA 3I77A 1KSNA 3PV2A 4K69A 5HKKD 3VB4A 1YWUA 3MNCA 6CHAC 4F4OC 1C5YB 4X6MA 1TAWA 2J9NA 4WWYA 5EXMA 1GI7B 2R3UA 4U32A 4NCYA 5DG6A 1DVAH 3KCGH 5KEDA 3BG8A 3P6ZB 1OP0A 1C5PA 1E1RD 3A80A 4I7YH 1Z8JB 1ZHPA 2PGBB 3E91A 3UY9A 5ETXA 4Y76A 1MTWA 1KDQA 2F91A 1W13U 4VGCC 1HRTH 5DP8A 1LHFH 4X6NA 2J97A 2ZEBA 2ZF0H 1UCYH 4HTCH 1ELEE 2GX4A 2W3KA 9ESTA 3BN9A 1RXPA 1GG6B 5LPFA 1BDAA 1DUAA 4J1YA 3A7ZA 3FZDA 4R8TB 5HIZA 2PKSB 4YLUA 1MCVA 1FN6A 3L3TA 4B71A 1UTJA 1GJBB 2YOLA 1HAVB 2SNVA 4WVPE 4INHA 1P2QA 3F9GA 2AGIX 4K3JA 1C1OA 3A84A 1S6LA 2AIPA 3SNEA 4AGJA 1H8ED 1YLNA 1HAPH 3TJVA 5FXLA 1BTPA 1QRWA 1YPKH 1LVBA 1Z1JA 1MBMA 4Y6DA 2A7CA 1BMAA 2BDYA 3HK6B 3AAUA 3TLOA 3DT0H 1BBRK 2PKAA 1RTLA 2QYIA 2ZECA 1BRAA 1O5DH 5LPRA 1D3PB 1O35A 5JPMH 2F43B 5DP9A 3MU4A 2CXVA 1O2KA 2A7JA 1LPZB 2OC8A 3DSGA 3RMOH 1OWJA 2OINA 1NESE 1NROH 2QF5A 4ABAA 1BTXA 1FY1A 1RTKA 2XBXA 4DIHH 1GHXH 3UREA 1RS0A 1B7XB 1BRBE 1EP6A 4UEHH 4ABFA 3NPSA 3PMAB 1LVOA 2KCOA 3UNQA 4Y8XA 1F7ZA 1MH0A 4O97A 3ZVGA 1ZOMA 3FAOA 4UD9H 1DXWA 3GCTF 1PYTC 2ZPSA 4INKA 1L4ZA 2TPIZ 3D65E 1SKYE 4YT7H 2XC4A 1UCYK 1AHTH 2ZU4A 3SJ9A 1AFQC 4Y71A 3ZZAA 5F53A 3WWBA 1TABE 1FY5A 1ZMLA 1BA8B 1IQGA 1NZQH 1SLUB 2F9PA 1DWBH 3S69A 1WAYB 4ISHH 2KR7A 2BZ6H 1GI5A 4U30A 1FQ3A 1GBMA 3LH1A 1MUEB 3ZVBA 2EY4C 4D8NA 1ZMNA 2GVFA 4K8YA
chains in the Genus database with same CATH topology
4KTCA 3LC5A 4U2WA 4O9VA 5JBBS 1AZ8A 2QAAA 2F9VA 4ZAEA 1OS8A 4KTUA 3Q77A 1O33A 2J92A 2FOGA 2TBSA 1P3CA 1TNHA 3TK5A 1GJAB 4X0WU 1QIXB 1JXPA 4D7FA 2A5IA 2VVUA 1EZUC 2BQ7B 1C5XB 4XOJA 2FESH 1AUTC 1GBBA 4O3UA 4BXWA 2QXIA 2ASUB 5F8ZA 1QL8A 1P57B 2VVVA 3RXQA 5DP7A 3TK9A 1GHZA 1O2GH 4UDWH 3U69H 1NRRH 2VGCB 1PQ8A 1J17T 2A31A 4JZIA 4K1TA 3OY6U 2HRVA 2H9EH 2BB4A 1YPLH 2BXUH 1H8DH 1DWCH 1P01A 2BVSH 3LGWA 2D1JA 4WJG2 3V0XA 1OWHA 5JB8S 1C2HA 1O2PA 1W10U 3P8OA 2D8WA 4J2YB 4OS7A 3QUMP 1O2HA 4MQAA 3LC3A 1O3MA 1SGDE 2FODA 3QDZB 1UVOA 1BMMH 2HPPH 3V7TA 3MI4A 1SGTA 3D23A 1XXDA 5EQRA 2CV3A 3M7QA 2Q1JA 3NWUA 1H9LB 1GHYH 3QLPH 1OOKB 1P8VC 1G9IE 3K6YA 4YO9A 3A8AA 1D6WA 1QA7A 1A5HA 3SU3A 2A2QH 3W95A 2ZHWH 5J4SA 1SOZA 1GGDB 1WU1A 3BIVH 2Z6BD 4X6OA 4JZ1A 1UJ1A 2F9UA 3B8JA 3M3SA 2BLVA 1KXCA 2C8ZB 1XVMA 4Q2KA 2BQ6B 4WH6A 2FLBH 4Q80A 3GYMA 5F8XA 4UFDH 4D76A 1HAIH 3ESTA 1ESAA 1HIAA 1IHSH 3SV2H 4I8JA 1SGIB 3SHAH 4NG9H 3STIA 2F9BH 4NIXA 1IQFA 3PTBA 1NS3A 1DANH 3OY5U 2ANWA 4X8UH 4XSKU 3A82A 4BTIB 1YPGH 3RLYH 1Z6JH 2CN0H 3RXIA 3EQ0H 4MPUA 3SORA 3RXUA 3SJIA 1KXFA 2FP7B 1THPB 2XC5A 2FOAA 1FY4A 1O2ZA 4MNWA 1GJ7B 2BOKA 1WQSA 3TPIZ 1EASA 2O8MA 1P0SH 1ZR0A 2FZZA 3ZVEA 1TRMA 1UHBB 2VNTA 1IQMA 4ZKRU 4LZ4B 3RXFA 3VXFH 1TWXB 1FLEE 1HJ8A 3RU4D 1NTPA 1G30B 2ZTXA 1AMHA 2LNCA 8GCHG 1YGCH 1F5RA 2H9TH 3ZVAA 3BTHE 4YESB 1BZXE 3V3MA 1C5UA 3HKIB 3BTDE 3A86A 1U6QA 1UK4A 2GZ9A 5EPNA 1AKSA 2HPQH 4KTSA 3T5FH 4ZH8A 2ZTYA 2PWXA 5I25A 1C1TA 1SGEE 3A7WA 2FX4A 1GL0E 5DP4A 2PSYA 4X1QU 5FHTA 4ISNA 1C9PA 5TJXA 5JB9S 2FOBA 6CHAB 3EDXB 3VXEH 1GBIA 5HMAA 1O5CB 3BV9B 3ZZ7A 2WPKS 2FO9A 2A5KA 1DUEA 1FPHH 1XX9A 4NGAH 5LPEA 1XUGA 2WPJS 1ZJKA 4Q7XA 2JH5D 2Y5FA 1K1MA 3GY4A 1TMUH 2GCHG 3RXTA 4D9RA 5FBEA 2P8OB 1O38A 1K21H 1TPAE 1A7SA 1GHWH 5C5OA 2GV7A 3GDSA 1AN1E 1INCA 1F5LA 1HYLA 1V2OT 2XXLA 1ZZZA 1SPJA 3ODFA 1TGTA 3A7YA 3LGYA 1O2WA 2FEQH 3Q3KA 1Q31A 1NN6A 5GPIB 2Y82A 1G2LA 1TPOA 2BOHB 3UNRA 2Q6DA 1N8OC 4H6TA 1QB1A 2STBE 1AVWA 2FOCA 4NFFA 3SI4H 4CRAA 1ELDE 1XUIA 3AAVA 3RXOA 1MU8B 4JMYA 4KP0A 4K1EA 2ODYB 5DP5A 5GCHG 3O8CA 2OTVA 1XUJA 2RCEA 4PROA 2VIVA 1WCZA 2QV1A 3MNBA 4ZMAH 2BY9X 3DD2H 1O0DH 4FUDA 1FNIA 2ZDLA 1IQHA 1QB6A 3M61U 1P2IA 1O3KA 2FIRH 3RP2A 1ACBE 2BY7X 4CRGA 2ZFFH 1CO7E 3K2UA 4QT8C 5CE1A 3SJOA 2R3YA 2C8WB 1QQUA 1E38B 1O2UA 3S7HB 1C5RA 4Y8ZA 1TOMH 1ETRH 1YBWA 5AHGH 1FY8E 1H9HE 1Y59T 2GP9B 2ZCHP 4X6PA 4B2CA 1FONA 3PWBA 2CMYA 3M37A 2G51A 4K8BA 3CP7A 3O8RA 1V3XA 1NO9H 2BY8X 3AVZA 3RMMH 2FX6A 1CA8B 1EJAA 3PO1B 2GMTB 1E0FD 2H2ZA 2B7DH 1BHXF 4Z6AH 1HJAC 1PQAA 1THRH 3U9AH 2AGEX 1J9CH 3SGAE 1ELVA 3Q3YA 4M7GA 1P09A 1BRUP 1HAXB 1LTOA 1QRZA 4LK4A 6GCHG 2ZU3A 3RM0H 2GV6A 1SG8B 1VGCB 4OS4A 5FBIA 3T2NA 1O3HA 2PTNA 3VB7A 2JKHA 2XCNA 1SGFA 3UNSA 2BY5X 3UWIA 1VCQA 1V6DA 1VCWA 1BTUA 2TGPZ 1Y5UT 3FP7E 2C4FH 2UUYA 4MTBA 1DSUA 3MFJA 3K65B 2ZFRH 4XBBA 1QQ4A 2A4OA 5CHAB 2VJ1A 3SHCH 3ATWA 1FZZA 4ESTE 2ZGHA 2A2XH 4AYYB 3LDXH 1A0LA 3AW0A 4B2AA 1CQQA 1AFEH 1MD7A 1KLIH 3SJKA 4CBNA 1F0TA 1TNKA 2QXGA 1TE0A 1AWFH 4GHTA 3SUDA 2PTCE 4E05H 3BEIB 1O3LA 1EZXC 1MQ5A 5FPTA 4DVAU 3QZQA 2NU3E 1K1PA 1SQOA 2VH0A 1XKBC 3MMGA 3U8TH 3DUXH 1DT2A 4DIIH 2ZQ1A 2FTMA 3IG6B 1TALA 3HGPA 1QFKH 4B76A 4X1NU 1MAXA 5HYOA 1ANDA 2G4TA 4ZROA 3V13A 1AI8H 3BIUH 2CGAA 1AE8H 1UTLM 2RA0A 3N7OA 1L1NA 1O36A 1SL3A 1ELGA 1O3FA 1GJ4H 2GCHF 1O3NA 1YPJH 1P03A 1EAXA 1P06A 1N6YA 4MPVA 1S82A 3PTNA 1WBGB 3UQOA 1FMGA 1GMDF 1SGCA 3QWCH 1GBKA 1JBUH 1CGIE 5T3HA 4BTUB 5EQQA 1EPTC 2VWOA 4Z0KA 4AB9A 1BRCE 2ZDAH 3D49H 1RIWB 3BEUA 1OPHB 2ZFPH 2ZU5A 3ZVDA 2AS9A 2GCTC 1KXEA 3UOUA 5SGAE 4WY3A 1ZSLA 2QGRA 4TWYA 3ZV8A 2R0LA 1C1WH 2FI5E 1Y3XA 4BAHB 3BEFB 3ZYEA 1UMAH 1JIMA 1O5AB 2A45B 1EP5A 1SGQE 4AFUA 1P12E 2SFAA 2OD3B 5GCHF 3VB6A 2SGAA 2B0FA 1HPGA 1WTHD 2BDGA 1IQIA 3G01A 5EQSA 4JK6A 1OP8A 1CBWC 5FCRA 1XVOA 3L33A 4UFFH 3A88A 3TH4H 1KXAA 4AYVB 2P3TB 1BTWA 2WV5A 1ZTJA 3GYLB 4AFZA 1JMOH 3GICB 1GCTC 1KLTA 2HLCA 1G3BA 3H7TA 3SNAA 4H42U 2QY0B 4LOYH 3MH4A 1EATA 1RD3B 3RXLA 1BCUH 1H8IH 3E0PB 1TLDA 3GCOA 1P9UA 1C2FA 3B9FH 2ZFSA 1UTPA 4ZHLU 3KF2A 1YF4A 1PYTD 1DM4B 4ZHAA 5DKMA 3SO3A 1GI1A 2EEKA 2J95A 4HI3A 1K1LA 4THNH 2ODQA 3SU6A 1QGFA 3BSQA 2GZ8A 3S0NA 1JIRA 1V2PT 3CS0A 1W2KH 3SZNA 1C2DA 4NA7A 1LHEH 1AVXA 3QTVH 1GMHG 1O5EH 1C5OH 2ZDMA 3SOSA 2EI8A 2Z9LA 1MTUA 3RXPA 1QB9A 7LPRA 3A81A 1FIZA 2XBWA 1SQTA 3S9BA 4ZXYH 1SFIA 1TGCA 2EI6A 2EA3A 2Y6TA 2G5NA 2ILNA 1ZJDA 1X7AC 3LPRA 3UPEA 1QJ7B 4AOQA 3F1SB 4MVNA 1WYKA 2AYWA 3GDUA 1G2MA 4INLA 4BOHA 3NUMA 2ULLA 1SOTA 2PW8H 2V3HH 1BMNH 1TBZH 5EPYA 3VGCB 3RXAA 4GHQA 3OSYA 1HAYB 2Z9JA 1E37B 1BQYA 1E36B 2A32A 1YPHE 1QHRB 1GBTA 1GHAG 2CJIA 4FVBA 2W7SA 3RXDA 4DG4A 2WPHS 8LPRA 3BTQE 2VU8E 2AMQA 3KNXA 5JBAS 4X8SH 1TYNA 2ZGCA 2QF0A 4YOJA 1T8OA 1FDPA 3A8CA 2VIWA 3URCA 1NFXA 3EAJA 5LH8A 3Q3XA 1K22H 3QN7A 1DY8A 2BX3A 5EODA 4IC5A 1OWEA 1GCDA 3SGBE 5A8YA 2KAIB 3A85A 2PUQH 2A7HA 4Y0ZE 1L0ZA 2W3IA 1P10A 1QBOA 5PTPA 3HPTB 3T29A 2B5TB 2JETB 3RDZA 1O30A 2Z3EA 4HZHA 3RU4E 3QGJA 2BVRH 1ZTKA 1SVPA 1O3EA 1G32B 5HM2A 1S0QA 1EAWA 3MNSA 2B8OH 2OC0A 2SNWA 3R3GB 1OWKA 3U1IB 2VWMA 4FUFA 4JZDH 4XBCA 2HALA 1D6RA 1O2YA 1ZSKA 2YNAA 1NFYA 3FFGA 2FXRA 3LIWA 3SU1A 5F6MA 1SR5C 1JOUB 2AH4X 1TA6A 4JZEH 4X2VA 3BTTE 3GY5A 2ODPA 1P02A 2ZFTA 1BHXB 1ETSH 2G52A 2SGPE 2ESTE 3TU7H 1LPGB 2ZP0H 2BDHA 5A2MH 2VWNA 2WUBA 4RSPA 1Y5BT 1GI6A 1KDQB 2C8XB 3PB1E 1SGFG 2XCFA 1O2JA 4FU8A 1C5TA 1NFUA 2F83A 1UTKA 1QY6A 3ATMA 2PV9B 1HGTH 3BG4B 4FUIA 1EPTA 5K0HA 4A1TA 1T31A 4H4FA 2ZPRA 5A0BA 3MH6A 3SV7A 1MTNB 4Y8YA 2CHAC 1W8BH 1S84A 4I8KA 1MZAA 1LKBA 1FPCH 4NA8A 1F0UA 2BTCE 1EB2A 2TGAA 1SBWA 1LCYA 2NWNA 2Z3DA 4Y11E 2J94A 4AFQA 1ELTA 4FUBA 2BQWB 1MKWH 2NU1E 4SGAE 1O2MA 2QC2A 2H1UA 1GI0A 3PV4A 1Q3XA 1TA2A 2V0BA 1H1BA 1ZLRA 2G4UA 1C4U2 1O3AA 1PPFE 3RC6A 4GCHG 1ELBA 4BXSA 1O34A 2BDBA 3LONA 4IBLH 1EUFA 1MMJN 4GLYA 2UUFB 2IOTA 2PKAB 2LPRA 3NCLA 5DK1A 1GMHF 4I8LA 1WTGH 2BD5A 1GJ9B 1BTZA 2UWPA 3VFEA 1ARBA 1N1LA 3SGQE 1MZDA 4FU7A 1C1MA 2DE8A 2F9NA 1ETTH 1GBCA 5GWZA 1NFWA 1C5LH 3FVFB 5CMXH 2Z9KA 1NRNH 2A5AA 3SV8A 1V2RT 4LZ1H 3ODDA 1TNLA 3D62A 3ZVCA 5L2YH 1LQDB 2P3FH 3M5LA 4NFEA 4X8VH 1ZGVA 1P2OA 1DLEA 3SU5A 3ZZ3A 1HDTH 1AU8A 1QL7A 1GBFA 1K1IA 1MKXH 1SC8U 1QJ1B 1QJ6B 1O31A 3S9CA 3F68H 3BTGE 1DWDH 1SSXA 2IJOB 3ITIA 4FU9A 2P3UB 4XE4A 1EZQA 5F03A 1VITG 3HKJB 4YZUA 3C27B 2C90B 1A3BH 1EAUA 1EOLA 1FY3A 1YLCA 1LKAA 2XWBI 3A7VA 1W3CA 1A5IA 3ZZ6A 1TNJA 1P2NA 3BTWE 3HATH 3IWMA 1NRQH 4Y10E 1ANBA 3ATKA 6ESTA 4MDSA 2WPMS 1LHDH 3MO9A 4U01A 4CHAB 4XDEA 1UVPA 2ZO3H 1V2UT 1F92A 1OP2A 4ZHMU 1MKWK 2ANKH 3LGVA 4MNYA 3PMJA 1EOJA 3E1XB 3RXGA 1C1PA 1T8MA 4FUCA 1BTHH 1XM1A 1AB9B 1CHOG 3H7OA 2FTLE 1GG6C 4AZ2B 1O3JA 4BNRA 2ZHQH 3MO6A 2PKSC 4BTTB 4MG3A 3MYWA 1HCGA 2FLRH 3WY8A 3SBKA 4CR9A 4CREA 3EE0B 1J14A 2THFB 3MWIU 3TK6A 3QO6A 1KTSB 4A1XA 3QX5H 8ESTE 3KHVA 1EZSC 3U8OH 5FX6A 1OWDA 2ANYA 4MNXA 1J15A 3ELAH 1TX6A 4TWWA 2ZI2H 2BY6X 2QIQA 1O2OA 2TIOA 1G3EA 2A4QA 1GMCG 2GDDA 4OGXA 3T25A 4OS6A 3GY3A 5TCCA 2H9HA 1GI3A 3TGKE 1MKXK 2CF8H 1GHVH 1O2VA 1BT7A 2W7UA 3HGNA 3T26A 1RGQA 2AERH 1OYQA 1BJVA 1QR3E 3KN2A 5DP3A 4CBOA 1T7CA 1SLXB 1TFXA 2ZDVH 4XFQA 3ZZ5A 1G3DA 1GI8B 1HJ9A 2P94A 4A92A 4VGCB 1LMWB 3ZV9A 1C9TA 1YLDA 4SGBE 1NRSH 1DFPA 2ZKSA 3QK1A 1V2NT 4BAQB 4GCHF 4IS5A 1PPGE 4YOGA 5GDSH 5AF9H 2DE9A 1CHGA 4NIWA 2C3SA 1O32A 1UK2A 1GDQA 2GT8A 1O2IA 4ABBA 9LPRA 3SUFA 1OYTH 4X2YA 5HXFA 1RJXB 1QA0A 1KLJH 2HNTC 1BTYA 3UUZA 3EYDA 5I46H 1HIAB 2OP9A 1TMTH 3RXJA 4I32A 5GIBA 5A8ZA 1WV7H 3L6PA 1NC6A 2FS8A 4H6SB 5J4QA 1MCTA 1CA0C 7GCHG 2O9QA 5DPAA 1EX3A 1V2QT 3U1JB 1IQLA 1D9IA 1AD8H 2GKVE 2BXTH 1C2MA 4CRFA 2WPLS 4IMZA 1QNJA 1OX1A 2ZGXH 2ZHFH 4KELA 2VINA 1VITF 2BLWA 1F5KU 1AIXH 1GHBG 1BBRE 1LQEA 3STJA 1F2SE 5L6NH 2FYQA 2ZHEH 4WXVA 3KGPA 1W11U 2V6NA 5E8EH 1IHTH 2GGVB 3BTME 2JH6D 3RMNH 6LPRA 1XUHA 1GL1A 5EU8A 1FXYA 1O3PB 1IQJA 3I78A 3MU0A 1GJCB 1EJMA 1SI5H 2Z94A 4B75A 1TQ0B 2RDLA 3MU5A 5AVDA 2P93A 4I8GA 3SQEE