7LPRA

Structural basis for broad specificity in alpha-lytic protease mutants
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
publication title Structural basis for broad specificity in alpha-lytic protease mutants.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1991-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 7lprA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 7lprA01
1OYQA 3LONA 2PUXB 3MU5A 1ZJDA 3Q3KA 2PKSC 3TLOA 1UTOA 2OC1A 4DGJA 1O2SA 3DA9B 4I8KA 1K1NA 1TBQH 4OS4A 2BY5X 2CN0H 1K1IA 2FOEA 4K1TA 1VJAU 1ZGIA 3TJUA 2NU4E 5C20A 2P93A 3RC5A 3K65B 1ZJKA 4WVPE 2F9BH 2FDAA 1DWBH 2ZU2A 5LPEA 1LQEA 3VGCB 3ZYEA 1SPJA 1SVPA 1IHTH 4SGAE 1WU1A 2RG3A 3RXGA 3ATKA 5AVDA 1EJAA 2NU3E 2R3YA 4GSOA 4OS5A 4XBBA 1ANBA 1Z1IA 1BHXF 4MLFB 1THRH 1ZMLA 1O35A 3TGKE 1SC8U 3TGJE 1GCTB 2ZO3H 4BXSA 1WQVH 2ZI2H 4D7GA 1YBWA 1UTNA 1HJ8A 2A1DB 2EI7A 1CO7E 1GHYH 1EAUA 1HNEE 1V2NT 3ZVGA 1JOUB 1ZHPA 3B23B 1TMBH 1ARCA 2ZHEH 1AKSB 1C2FA 4Y79A 2F3CE 6ESTA 8GCHG 4U32A 1Y5AT 4X1NU 3TK9A 3M35A 3VB3A 4LOYH 3ZVAA 2FOBA 5I25A 1MQ6A 3SORA 2D26C 1ZPZA 1T8OA 4DG4A 2ZDKA 1EASA 1YF4A 1O2ZA 2WV5A 1DSUA 3SGBE 1DVAH 4AGJA 4I8JA 1SLUB 4E7NA 3RXBA 1Y3YA 1HJ9A 2SGPE 1YPLH 2VIVA 3RC4A 2GX4A 1DWCH 5TCCA 1PJPA 2YOLA 5BRRE 4Y11E 1XUHA 4X6MA 1Z6JH 3GY5A 3UTUH 2SGAA 1ZTLA 1NRPH 4Q2KA 2DE9A 3TJOA 2VJ1A 2VWLA 2QCYA 1C1PA 3V0XA 1RS0A 4DT7B 1GMCG 4KGAA 2FX6A 4NSVA 3S9CA 5EW2H 1ZSJA 2Y5FA 4NG9H 4BAOB 4DVAU 3I78A 2VWOA 3TJNA 1O2JA 1OKXA 1VITG 2R2MB 1P02A 2QXGA 5HGGA 1SGRE 1OWIA 1Y5UT 3W95A 3FP8E 1GJ7B 2G81E 1NM6A 2QGRA 2Z9KA 2ZHDA 1EPTC 1EKBB 1T8LA 5JYIA 1A2CH 1ZMJA 1LPGB 1DITH 1PPZA 1WSSH 1ZGVA 1CGIE 3U1IB 2PTCE 1P2KA 3IITA 3PWCA 1QBOA 2PGQB 3SOSA 3S7KB 1UVOA 5EQSA 1SGNE 3L33A 1ZPBA 3CENA 2FP7B 5ABWA 1T7CA 1TNJA 2VINA 2XCNA 3S69A 3SJKA 1C5RA 2AFQB 1AE5A 1OOKB 2ZCLP 3MNXA 2W3KA 1FZZA 4X1RU 2BXUH 4RSPA 2PFEA 1IQEA 1BBRK 1Z7KA 4CRDA 2LNCA 1O3DA 1GDQA 2P8OB 5F8TA 1DWEH 4NA9H 5DKMA 1VZQH 2QAAA 3O8BA 1GHAF 1TPOA 2Q6DA 2XNIA 4YOGA 1L4ZA 2BY9X 2XWBI 1W0ZU 1K2I1 1O3LA 4MNWA 1RXPA 5C5NA 1D6RA 1C4V2 1IQLA 1L0ZA 1LKBA 3BTTE 1BITA 5GCHG 1GI2A 1XUIA 4X8VH 1S0QA 1FV9A 3P6ZB 3PTNA 2Y5HA 1AVXA 4XSKU 4ZHLU 1NU7B 4INKA 3A7ZA 1AVWA 2O9QA 2Q6GA 3RXMA 4H6TA 3U8OH 1IQFA 1QJ7B 2V3OH 1AKSA 1V2QT 1SQAA 4A6LA 1LHCH 1LHFH 1O5DH 1GG6C 3NXPA 1GBCA 4BAKB 2VWNA 3UNSA 4CRFA 4ISOA 1MBQA 2P95A 4B2BA 1AD8H 3GY2A 2AGEX 1BRUP 5DGJA 3RLYH 1ESAA 1MD8A 3O8DA 3W94A 1O30A 2BDAA 1P10A 1O5GH 5EU8A 1O5CB 4JYUH 1AVGH 2ZZUH 5A0AE 1IQNA 2GCHF 1BRBE 2VNTA 1Q3XA 4D9QA 5EQQA 2SGEE 3E0PB 5LPFA 5EG4A 3VXFH 2ZWLH 2Z94A 2HLCA 5HXFA 4UFGH 4NZLA 3N7OA 1Y3UA 3RMMH 1KIGH 1UO6A 1V6DA 2R0KA 3K6YA 5E2OA 3RC6A 1XUKA 3SUFA 1SGYE 1YPHE 3LH3A 1S83A 1C5XB 1JWTA 4ABEA 1XMNB 1Q2WA 1IQKA 2O8UA 1NRQH 2BD3A 1GI5A 3BEUA 3PYHA 1YKTA 2D8WA 1A0LA 1INCA 1KTTB 3M3VA 2H9HA 3MNCA 1J15A 2Z6BD 1YPGH 4MPVA 2OP9A 3VB5A 1FDPA 5JB9S 2YNBA 1SGFG 1ETSH 4KTSA 1O36A 2BDYA 2SNWA 4NGAH 1SBWA 4YM9A 1RD3B 3D65E 3GCOA 1AIXH 3T29A 1UTLM 2WV4A 5LPRA 1E35B 1P05A 3LIWA 1SLVB 3A8BA 3VFEA 3QGNB 2KAIB 2FTMA 2DE8A 1S6HA 1SLWB 2JH5D 2A4GA 2ZDMA 3MU1A 3M3SA 2WUBA 4UE7H 2HPQH 3BV9B 4AYYB 2GT8A 1OS8A 3LGIA 1OWJA 3P8GA 3RXPA 2CXVA 3SZNA 1FAXA 2ZECA 1UTQA 1BMNH 1S82A 4OS1A 3TIUA 2Y81A 2J2UA 3PTBA 4U30A 5A2MH 1S85A 4ZKNU 2RDLA 3IWMA 2WPJS 3LPRA 3SNAA 3RMNH 1WTGH 2SFAA 2HVXA 2Y80A 4WMDA 2A5AA 3M7QA 1BOQA 1BTYA 2F91A 2XBXA 4HI3A 1V3XA 2LPRA 1WAYB 3M5OA 1QRWA 3KCGH 1DXPA 1QA0A 1NPMA 4ABDA 1A3BH 1QRZA 2FS9A 4LK4A 1GGDB 2G5NA 3T62A 4ZROA 4NIXA 3TU7H 3RXOA 3H7OA 1GL0E 1QL9A 3RXAA 4A1XA 4BTIB 3HATH 1BT7A 3ESTA 1QNJA 1DY8A 1U6QA 2I6SA 3MWIU 1BTXA 4ZKOU 5A8YA 1GMDF 1XKBC 3VXEH 5TJXA 5C1XA 1FI8A 2XYAA 3RXEA 1AO5A 1WYKA 1FONA 2OD3B 2TGTA 4FUGA 4F49A 1GJ6A 1CGHA 1MTUA 3ZZDA 1O2UA 1ZRBA 2ZGBH 1SB1H 2P59A 5A8XA 4SGBE 1OWEA 1KLJH 1K1MA 3TK5A 1O5FH 1C5QA 3A87A 4Y0ZE 1CHGA 2Z3EA 3DT0H 2GTBA 1ZRKA 3FVFB 2OQ5A 1RIWC 4O3TA 2FI5E 4IMZA 1GHBF 2BZ6H 3SGAE 1V2WT 2TRMA 5AFZH 2EEKA 1YLCA 1QJ6B 3EAJA 1KXEA 1FY5A 3P8NA 1C5OH 2CJIA 5FCKA 1C1NA 2GZ7A 4OS6A 5T3HA 2A7JA 1GI4A 1PFXC 1CU1A 4TPYA 1G32B 1EOJA 1HJAB 4KKDA 3PB1E 4MPXA 3SV2H 3UWJH 1PQ8A 4XBDA 3PMHB 1DANH 4KTUA 1O0DH 1NN6A 3GYLB 3M5LA 4JZFH 3BTWE 1QB9A 1YGCH 1NS3A 1CHOF 1BBRE 1Z8IB 3GICB 3HKJB 4GAWA 3V3MA 1O3BA 3OY6U 1O2WA 2H9TH 1G3EA 3KEEA 2BDHA 1NT1A 2BDIA 3RXJA 3U9AH 1LHEH 2ZGXH 5FBIA 1G3CA 1MZAA 4NWLA 1Y8TA 3TITA 4ABHA 1AU8A 2HOBA 1MBMA 1O2RA 4Q7YA 1SQTA 3EGKH 3UPEA 5EGMA 1SSXA 3TPIZ 3ZZ8A 2AYWA 3A83A 5CHAB 1BJUA 2BM2A 1V2UT 3MNSA 3R0FA 1AUTC 3MH6A 3RXKA 1ANEA 1DE7H 1T31A 4GHQA 1T32A 3SJIA 2F9VA 2FM2A 1CBWB 1XUGA 3EA9A 1DLEA 1K1OA 4NZQA 1AE8H 2BXTH 1UVUH 3DFJA 2FIRH 1TIOA 3JZ1B 1PPHE 1SOTA 1TGCA 3LOXA 2PSYA 4D7FA 3RMOH 3L6PA 2PHBA 3LGVA 3UQVA 1PPCE 3P17H 1TPPA 2VGCB 1GBTA 1GBFA 1YM0A 4WF8A 2BX3A 4ABJA 3UOPA 3S9BA 1H9IE 1FMGA 3BF6H 2OINA 2ZPQA 3M36A 2ZHFH 2BZAA 4A7IB 3PO1B 4BNRA 3QZQA 4WWYA 2EI8A 1EX3A 1P8VC 2R3UA 1O2XA 3SJ9A 1V2OT 1WBGB 2TPIZ 2PW8H 2VH6A 1C5NH 3SJOA 3BIVH 4I33A 2CF8H 4JZ1A 3SV7A 1D3TB 3AASA 3AVZA 1DWDH 1ZLRA 1AY6H 2Z9GA 3PWBA 2PUQH 2OCVB 1BMAA 4IMQA 2BX4A 1KXBA 4MPUA 1O3OA 2AEIH 2BDGA 1V2TT 3GCTF 1O2VA 3MI4A 4WMEA 5TCAA 1FN6A 4B74A 2GMTB 4Y7AA 1O2TA 1GBEA 5F03A 2CHAB 2RCEA 2ZHWH 1W0YH 3GDSA 2W26A 4DIHH 3ZVFA 1GI0A 3O8CA 1K21H 1LHGH 3T26A 3TH2H 1TBRH 4A1VA 2AMQA 1ZSLA 3ZYDA 1BB0B 1V2ST 2P94A 3BTGE 1DM4B 1GJCB 3RXSA 3LU9B 1OP8A 3BTFE 4BAHB 1E0FD 1AMHA 3CS0A 3BEIB 3F9HA 4NWKA 2QXIA 1NU9A 1SG8B 2TGPZ 4A1TA 3S7HB 2ZU5A 2ZU1A 1CA8B 4MNXA 1NFUA 2VVVA 2ZFSA 3K2UA 1O39A 2Y82A 2BB4A 1YLDA 2ZDLA 1SGPE 3NWUA 6GCHF 4CR5A 2HWLB 4YTAA 1AZ8A 1UVSH 5ETXA 1L1GA 1G37A 3LT3A 2QY0B 3NUMA 1EUFA 4K5ZA 3KIDU 2Z3CA 3LGYA 1XVMA 2QC2A 1CVWH 1SGFA 5JPMH 4BOHA 1V2LT 1JIMA 1OP0A 1KSNA 3T2NA 3V7TA 1HDTH 4YESB 2AERH 1HAZB 3F6UH 1LQDB 2AGGX 2BVSH 4FUDA 1RRKA 1UCYH 3B9FH 1NFXA 1P2NA 1FLEE 2AS9A 1TNIA 2QA9E 1J9CH 1IQHA 1L1NA 1MU8B 2W3IA 1N1LA 4NIVA 1ESTA 1V2RT 1ANDA 1GBJA 2CGAA 1OWHA 4TY7A 5ESTE 3FP6E 1ZZZA 2EA3A 4ISLA 1ZYOA 1MTVA 2A45B 2ZKSA 4DW2U 4WH8A 3UQOA 1HAVA 3HGNA 2W5EA 4X8SH 3U1JB 1A1RA 1XUJA 1GI6A 3VB6A 1P11E 1O2GH 1GJ9B 2EC9H 1EZQA 1KDQB 3BG4B 3KN2A 2Q6FA 1O3MA 5C1YA 1D4PB 2GDEH 5DK1A 1Y3VA 3RLWH 1HAYB 2CF9H 1MMJN 1LPKB 2A31A 5EW1H 1TRNA 4AB9A 1HPGA 1FXYA 3BTME 4CRAA 4JZEH 1QRXA 1ZOMA 4NFFA 2J92A 4ZUHA 4BAQB 1S6FA 2GZ9A 1S5SA 1W7XH 1MTWA 2BDCA 3QTOH 4Z0KA 1TONA 4JMYA 1V2JT 1AHTH 1QTFA 1SHHB 1IQGA 3CP7A 1O2LA 1O33A 3SNCA 4YOJA 8GCHF 2ZPRA 1ETTH 7GCHG 1AB9C 4VGCB 1C5VA 2F83A 2BD2A 2SGQE 3A88A 4WXIA 2GV6A 1O5EH 2ZIQH 2SGFE 2GCTB 1IQMA 1P9SA 3SGQE 1ABJH 1KXDA 1TALA 2ZU4A 5IDKA 2BY8X 2A5IA 2FOHA 4AN7A 5FXLA 4CBOA 1GI7B 3URDA 3A7YA 5F8ZA 1UVPA 1E34B 4TWWA 4H42U 1KXCA 1MKXK 4AFQA 1BMLA 2V0BA 4B1TA 2XCFA 1O5BB 2AH4X 3A8DA 1KTSB 2XW9A 1HIAB 5C1UA 3M3TA 1AI8H 2ZDNA 3GCHB 4BTUB 1LVYA 1J16A 1CGJE 3QZRA 3EE0B 3ITIA 3SO3A 3MH4A 3KGPA 2UUJB 5T6DA 2B5TB 4U2WA 3ZVBA 4CHAC 5FPYA 3EQ0H 4B71A 1KLIH 1GMCF 4FU9A 1Q31A 2OLGA 1A0HB 1LPZB 3GYMA 2CV3A 1G2MA 1VITF 3RM0H 4CBNA 3PLBA 1VGCB 3MO9A 1GGDC 2BD8A 1N8OB 1PPFE 4O3UA 1W13U 2GZ8A 3KQBA 3ODDA 4FUBA 5FX5A 1O3NA 4GVUA 1TBZH 1QA7A 1O2QA 4ASHA 2PKSB 1MQ5A 3RXFA 1W3CA 1RJXB 4MPWA 1DT2A 3GOVB 2ZFRH 4ABAA 2FOGA 5DP3A 4XE4A 1G2LA 1GJ4H 1C1WH 1PPGE 2FOCA 2QF0A 2ZA5A 4DJZB 4E06H 5I46H 9LPRA 1ACBE 2R9PA 4B75A 4YT6H 1UJ1A 4IW4E 1KDQA 1BHXB 2ZNKH 1GL1A 1UHBB 1Y3WA 3A82A 4WMFA 1Z71A 3AW0A 3MHWU 1NRRH 4IN1A 1KXFA 3LGUA 4IC5A 4K8BA 2XBYA 1T8MA 4K1SA 1HXEH 4DOQA 3BSQA 1RTLA 3A7WA 1GVZA 3LDXH 4GCHG 3PV4A 1ELVA 1O38A 1UCYK 1MCTA 2XWAA 5F8XA 3QWCH 5GCHF 3BTKE 1SGIB 1BTZA 3SUGA 2EI6A 3FANA 2H5CA 1O5AB 1WV7H 1TB6H 4FUEA 5FBEA 3TNSA 1C2EA 3QN7A 1CT0E 4U01A 1H9HE 5FHTA 2ODYB 2ZG0H 3ZZ7A 4UDWH 3FFGA 4CRCA 5C67A 5HYOA 4FUJA 4JK5A 4FUIA 2OUAA 1PYTD 2Y5GA 1TA6A 2QYIA 2VH0A 3SQHE 5HM2A 3S9AA 1W14U 5AHGH 4I7YH 3MFJA 4AZ2B 3OYPA 3P70B 2JH0D 2FLBH 1G30B 3RXIA 5H4IB 3SJ8A 2STAE 4JCNA 1C5MD 1ELDE 3RXLA 1XKAC 1TPAE 1IQJA 1MZDA 3ZZ5A 2VIDA 1TMTH 3U8RH 4B76A 1L4DA 4O9VA 2BQ7B 3GY7A 2ZFFH 1D3QB 3NPSA 4XFQA 1YCPH 4GPGA 2FX4A 1LTOA 1P0SH 1WUNH 1C5YB 1CQQA 1FJSA 3KHVA 1C1MA 2FPZA 3RXQA 3DHKH 2A0QB 3RU4E 3UR9A 3UR6A 5CHAC 3SI4H 3A8AA 4K1EA 3LH1A 1FQ3A 3BTQE 1TQ7B 3GISB 3RXDA 1TGNA 1P04A 2K1QA 3GDUA 1O2PA 4KP0A 3QX5H 1V2PT 2BD5A 2VIQA 3E16B 5DJ7A 1YPEH 1O37A 1ELGA 2UUFB 3ATMA 2ZF0H 3A81A 4MVNA 5E0HA 1E38B 1GMHG 1SGEE 4UEHH 1P12E 1CSOE 3R3GB 1EPTB 2TBSA 1C2HA 2BQ6B 1YYY1 4MQAA 4WY3A 5FCRA 2ALVA 1KLTA 4TY6A 2QXJA 2ZTXA 1PQ5A 2OQUA 2UWLA 7ESTE 1O3KA 2FZZA 4X6NA 1EZXC 1P3EA 1Z8GA 1GJ5H 1GVLA 1EP6A 1SFQB 2VWMA 1SR5C 5E0GA 4YOIA 5DG6A 5AFYH 2OXSA 1G3BA 2P3TB 3LC3A 1DXWA 1NRNH 3PO1C 5HM9A 2HPPH 3QO6A 1H8DH 1BMMH 4D76A 2XC4A 1FY1A 5DP9A 1P06A 1UHBA 2FOFA 5IYTA 4MNYA 1C2GA 1H1BA 1O3CA 2THFB 1YPJH 2ANMH 4FVBA 4X8TH 1QBNA 4Y8ZA 2C8WB 1OWDA 5DP7A 2XC5A 1GJAB 2PKAB 1C5SA 3M5NA 2O8MA 5GPIB 1E37B 4Y6DA 2FI3E 1MU6B 1TWXB 2A32A 5E8EH 2BOKA 1FAKH 4MG3A 2H6MA 4NSYA 1H4WA 1GBLA 4UFDH 4O97A 2A7CA 2G5VA 1DY9A 2BHGA 2IOTA 3GY6A 5EPNA 1NRSH 1P2JA 3OU0A 1XX9A 2AGIX 5DP6A 2NU2E 2GMTC 2QIQA 1CT2E 4QT8C 2CHAC 2QN5T 2BD4A 4TWYA 2BMGB 4YLUA 1EATA 2NU1E 1F92A 1SGQE 4FUCA 1X7AC 2BY6X 3OX7U 2ZEBA 5DO4H 1IHSH 1VITH 1TNKA 2AIQA 4I8LA 2ZQ2A 1TGSZ 3D62A 1DOJA 4HZHA 1B0EA 3V13A 3LGTA 4BAMB 1HGTH 1AGJA 1ZHRA 3RXUA 3E0NB 4Y10E 1ID5H 2JKHA 1PQAA 2FODA 4WH6A 3MU8A 2WPHS 1C9PA 4RKOB 1P2OA 7LPRA 2ESTE 4KTCA 1UTKA 2QXHA 2G8TA 1B5GH 2WINI 1UTMA 2KAIA 2D1JA 4D8NA 4X8UH 5EQRA 3A86A 2J34A 3SNBA 2GDDA 2ILNA 1SGCA 3VGCC 1Y59T 5SGAE 3RDZA 3AW1A 4K60A 1F5LA 3CS7A 2ANKH 2Z7FE 1GBBA 1FY3A 3MMGA 2VIOA 1VCPA 4ZXXH 1MD7A 4B2AA 1T8NA 2CMYA 1E36B 4DY7B 3L3TA 4YT7H 2GP9B 4X1PU 1SLXB 2FWWA 1GCTC 2WPIS 4AG2A 1YP9A 3EA8A 1A7SA 1EPTA 2ZGHA 4F4OC 3MU4A 1AUJA 2GVFA 1AQ7A 1DLKB 1HCGA 3STJA 1C5PA 1FUJA 1GHXH 1XVOA 2Q1JA 3FP7E 3MH5A 4E05H 4PROA 2Z9LA 1B0FA 4X6PA 1EAWA 1QL8A 2BLQA 1JRSA 3P8OA 1YCPK 1FIZA 1O3FA 5E2PA 3RMLH 5LGOA 3SV6A 3SBKA 1G36A 1Y3XA 1DFPA 2J94A 1DUAA 1NTPA 2PSXA 5CE1A 4ZMAH 1Z6EA 5EXNA 1TX7A 5JBCS 2VB0A 1XUFA 1W11U 1W8BH 3RU4D 2G55A 1LCYA 2Y7ZA 1A0JA 3TJVA 1AFQB 1EJMA 2WUCA 1C2IA 4THNH 1C1OA 1EZSC 2FI4E 5FX6A 1C5WB 1VCQA 1GI9B 5E0JA 1UCYE 4AOQA 2PKAA 3Q3YA 5AF9H 2SNVA 1LVOA 2ZC9H 3ZZCA 3QTVH 2A4OA 1C2DA 5G4BA 4E7RG 1NESE 3P92A 4JK6A 1DICA 1UTJA 1RFNA 2ZFPH 2W7UA 2PTNA 2FTLE 4CH2B 1D3DB 1MKXH 2QV1A 3BTEE 2PV9B 4VGCC 4AYVB 1T4VH 5K0HA 3I77A 1ZTKA 1ABIH 3SV8A 1JIRA 3F9FA 1BTUA 4J1YA 1C1VH 3UREA 1VJ9U 3UIRA 4XBCA 1QQ4A 1DS2E 2ZTYA 2W7SA 1CA0B 2BY7X 2C93B 1ELFA 1TGBA 1YCPM 2ZDAH 4FXGH 1ZR0A 3SNDA 3RXVA 1C2KA 1HXFH 1QFKH 1J14A 3B8JA 2J38A 1ZTJA 2PWXA 1BA8B 2JH6D 2FYQA 2JETB 3MO6A 3ZVDA 3T25A 1ARBA 4HTCH 3ATIA 4ZXYH 4Y76A 3SW2B 6LPRA 3HGPA 2HRVA 3KQCA 1O32A 4X2WA 1O34A 6CHAB 4Y8YA 1F7ZA 2B9LA 1K22H 1DUEA 1PQ7A 3MOCA 4ZKSU 1OP2A 2ZFQH 2OC0A 1A5IA 1ETRH 1BCUH 1DSTA 2P8OC 2WYJA 4X2YA 1P3CA 1F0SA 3QGJA 3T28A 4BANB 1J17T 1Y5BT 2OBQA 1TFXA 1P2IA 1LKAA 1RGQA 1VGCC 1BDAA 1C4U2 2ANWA 1N8OC 1TNLA 1HAHH 1RIWB 1C2JA 1O2NA 1BQYA 1V2MT 2XRCA 1ANCA 1D3PB 1P9UA 3RXRA 3SU1A 5L2YH 1SHYA 4UD9H 3PMJA 3A85A 1MAYA 3QUMP 1F0RA 2PR3A 3SUEA 4ABBA 2G4TA 1UK2A 3PMAB 4RN6A 5JB8S 2P3FH 3RP2A 3PROA 2A7HA 3MO3A 3NK8A 2UUKB 2A5KA 1LDTT 4X2VA 1GDNA 1EQ9A 2FLRH 2H2ZA 1HAOH 2XC0A 1GI8B 1MAXA 4MDSA 1EB2A 4ISIH 4UFFH 5EOKA 3M61U 1LVBA 1HAXB 3E6PH 3TH4H 3PM3A 1SL3A 4A92A 2P3UB 2ZGCA 1GBMA 3MH7A 1C1QA 3UFAA 2FOAA 3H7TA 2BYAX 2H5DA 4JYTA 8LPRA 1XM1A 1W2KH 1AN1E 2XTTB 4Q7XA 3SU5A 1QB1A 4Y71A 1G9IE 1KXAA 5HMAA 4CH8B 1GDUA 4NFEA 1O3EA 1W12U 4CREA 2ZP0H 5C5OA 2FESH 1A5GH 1QCPA 3G01A 1GPZA 2BOHB 2BVXH 2NU0E 2ASUB 1HUTH 1C5ZB 1O31A 4YZUA 3SU4A 4A5TS 2HALA 1OXGA 4JYVH 4GUXA 1GVKB 3M37A 1CT4E 4NCYA 1JXPA 2M5TA 1BZXE 1NFYA 1VR1H 1GBHA 1ZPCA 1TX6A 3VEQB 2RA3A 1GI1A 5A0CA 4ABIA 1C5LH 1C1SA 1P09A 1QJ1B 2IPHA 3BN9A 1Z8RA 1HAIH 4RKJB 1RTFB 2AIPA 1P57B 5JBTA 2VU8E 3RM2H 1NFWA 3TK6A 2WPMS 2TGAA 3LC5A 3Q3XA 1SGTA 4XDEA 3TNTA 5DP5A 4IN2A 1OYTH 2Y7XA 1F0TA 1MCVA 1MTNB 3BTHE 1HBTH 4FVDA 1YPHC 3T27A 1XXDA 1ZHMA 3A89A 3LJJA 2ZHQH 3HK3B 1O2HA 1EAIA 4B73A 3H5CB 1O2OA 3JZ2B 1GHAG 4ZKRU 2XXLA 2GD4B 1A3EH 1J8AA 3PMBB 2WPKS 1F0UA 2A4RA 1LO6A 2O8WA 3WY8A 3Q76A 3GY3A 3ZVEA 4B2CA 1K1LA 4DIIH 1BTHH 2ULLA 2ZGJA 1KYNA 2OC7A 3UNQA 2NWNA 3VB7A 1A5HA 1K28D 7GCHF 1TABE 1QQUA 2G51A 3EA7A 1PPEE 1DX5M 2FEQH 2ZQ1A 3KQDA 4H6SB 2J9NA 1DPOA 1TOMH 3C1KA 5GWZA 1FY4A 1TRMA 4TYDA 1SGDE 1GCDA 3VB4A 2ODQA 4K69A 3FZZA 1MUEB 1O3GA 2PLXA 2QF3A 2P16A 3RU4T 5DPAA 1F2SE 1Z1JA 3LJOA 1NC6A 1AZZA 3NZIA 4JZDH 3OY5U 2BVRH 1TMUH 3SQEE 4TPIZ 3S0NA 1D6WA 3Q77A 4MNVA 1O2YA 3TH3H 4NA7A 1P2MA 1ELTA 2BLOA 1P2QA 2GCHG 3RXCA 3C27B 3V12A 1L2EA 1YPMH 4ZHAA 1BRCE 1WCZA 5GDSH 2OTVA 4YO9A 1LMWB 4FUFA 3EYDA 1HYLA 1GJBB 3EDXB 2GT7A 3SI3H 3E3TA 3SU6A 4IS5A 4Y7BA 3ZZ6A 2IN2A 1GJDB 1V2VT 3UY9A 1EJNA 2BLWA 1GI3A 4FU8A 2ODPA 3ZVCA 1PPBH 1GBKA 1EAXA 4X1SU 2A2XH 1ELBA 3TGIE 1A61H 3RUOA 1MH0A 5PTPA 2GKVE 1C1UH 3A7TA 2BDBA 1OWKA 1V2KT 3BIUH 5FPTA 3DFLA 3ZZBA 1K1PA 1HJAC 4NIYA 1AWFH 2ANYA 3D23A 1YC0A 5GJ4B 1O2KA 1HB0B 1BJVA 1GBAA 3I29A 4AX9H 3BG8A 1P03A 1LHDH 1O3JA 2FOMB 1HAPH 5T6GA 3QDZB 4NA8A 1UK3A 1S84A 4H4FA 2FO9A 3KL6A 4OS2A 3QLPH 3BEFB 4HGCA 1HV7A 1QBVH 1TA2A 4GCHF 4J2YB 4K3JA 1HIAA 3AAVA 1O3IA 3F1SB 1OX1A 1BUIA 4KELA 2V35A 3SU0A 1O3AA 5EPYA 3ZV8A 3ZZ3A 4LZ4B 3PLKA 3MNBA 3SHAH 2FXRA 3M5MA 3GDVA 1ELEE 5FAHA 1JRTA 1C1RA 4GHTA 2D2DA 2J95A 3IG6B 1TX8A 1P01A 1TRYA 1GHZA 3DD2H 1AB9B 1TE0A 4AFUA 1SI5H 3K6ZA 1HFDA 5K7RA 2G52A 1CBWC 1SFIA 2VIWA 3MU0A 3UWIA 4INLA 2Z9JA 3F9GA 4OS7A 1H9LB 1C5TA 1ESBA 5ESBA 1AFQC 2H1UA 4WJG2 1O3PB 1TLDA 3F68H 3Q00A 3SUDA 1UTPA 3OTJE 3ZZ4A 1IOEA 4Y8XA 2ZU3A 2VGCC 1HAGE 1MKWH 1F5KU 4R0IA 5GXPA 5DP8A 2F9OA 2ALPA 2ZCHP 5FPSA 1GMDG 2F9NA 3ATWA 1C1TA 3GCNA 2HGTH 1UVTH 2C3SA 2ZDVH 5BPEA 1JMOH 1W7GH 4CHAB 2G4UA 1NO9H 1FY8E 2C90B 3SU3A 5J4SA 3SV9A 1ZSKA 1AWHB 3HK6B 1YPKH 1S81A 1T4UH 2VVUA 1ELCA 2XBWA 1QURH 3KNXA 4ISHH 3FAOA 4UONA 3MYWA 1GJ8B 4INHA 1GBIA 1QHRB 1TAWA 2R2WU 2Z9IA 2WYGA 1GMHF 3F9EA 1NZQH 5JBBS 2V6NA 4AB8A 1O2IA 4X1QU 1W10U 2OC8A 3NKKA 4DURA 1GHBG 1CA0C 2A4QA 1RTKA 4ISNA 1O3HA 1KY9A 2HNTC 4XOJA 2BTCE 1UMAH 2Y6TA 2ZPSA 4GLYA 4BXWA 3P95A 3E90B 3HPTB 1OSSA 2ZCKP 1IAUA 4IBLH 1TNGA 2JETC 2TIOA 3A8CA 3E91A 1S0RA 3URCA 5EODA 1GBDA 1QGFA 2ZTZA 2HNTF 3VPKA 2TGDA 1LVMA 6CHAC 3U8TH 1GG6B 1GWAA 2C8XB 1FPCH 2Z3DA 3U69H 1A46H 3OSYA 1CHOG 2B8OH 2V3HH 1K1JA 4DCDA 1OPHB 3GY8A 1QR3E 1TQ0B 4Q7ZA 4X0WU 4OGYA 4UFEH 1H8IH 1VCWA 1BTPA 1SMFE 5J4QA 4FUHA 4JZIA 1C2LA 1N6XA 4Q80A 3O8RA 1B7XB 1ELAA 1TGTA 5EXLA 2A2QH 2H9EH 4K8YA 2I6QA 5DP4A 3SU2A 2ZFTA 1ZMNA 1TNHA 4CRGA 2C8YB 1UK4A 1EXFA 3KF2A 1NY22 4CR9A 4LXBH 1EB1H 8KME2 2PGBB 2O8LA 1L1JA 4K2YA 2G00A 1DDJA 4I31A 4Y0YE 2BQWB 3ENSB 3D49H 4AORA 3RXTA 3SHCH 1EOLA 4ZHMU 1BRAA 3E1XB 4I32A 5A8ZA 2UUYA 2FYRA 3RXHA 1FPHH 1G3DA 5L30H 4WXVA 1TPSA 1N6YA 2GV7A 4IGDA 1MTSA 2WPLS 1QL7A 3HKIB 5GIBA 3ZV9A 4AGKA 1HLTH 3SNEA 3QK1A 3E8LA 5JDUB 1WTHD 4BTTB 5EXMA 3K9XB 1K9OE 4MTBA 5JBAS 3P8FA 4AFSA 2F9UA 1TYNA 4YLQH 3ODFA 3BG4C 1WOFA 3AAUA 3NCLA 5C3NA 4AFZA 2B7DH 1HRTH 3A80A 2BD9A 3GY4A 2VIPA 1ORFA 2J4IA 3FZDA 5T6FA 3UUZA 1C5UA 2C4FH 2VVCA 3UNRA 3DUXH 2BD7A 4IC6A 2UWOA 3A7VA 3MTYA 5LH8A 4O03A 3A84A 1C2MA 2FMJA 2HNTE 5B6OA 1QIXB 1C4Y2 1FNIA 3ZZAA 4ZH8A 7KMEH 3STIA 4ABGA 1TOCB 1SQOA 3SN8A 3GCTG 3M7UA 4CRBA 5L2ZH 1MKWK 1HAVB 1C9TA 1FN8A 4I8HA 4HFPB 5F6MA 1M9UA 1QB6A 1PYTC 2R0LA 5L6NH 1THPB 2GCTC 1D9IA 2BLVA 1THSH 5CMXH 3BTDE 5A09A 1EP5A 1GHWH 1MTNC 9ESTA 1F5RA 1NROH 4NIWA 3U98H 1FIWA 4AG1A 4ESTE 2AMPA 5A0BA 1CE5A 3ATLA 1QY6A 2AMDA 2STBE 2SGDE 4X2XA 2YNAA 1A4WH 2IJOB 1IQIA 4OGXA 4D9RA 3GCHC 4LZ1H 1GHVH 1EZUC 4ABFA 2C8ZB 3T5FH 4Z6AH 2OBOA 2XBVA 2GGVB 1Z8JB 1JBUH 6GCHG 3LGWA 4M7GA 2B0FA 1BBRH 1SOZA 1XXFA 3M7TA 2O8TA 3LKWA 5C2ZA 2FS8A 4R8TB 8ESTE 1BTWA 2F9PA 3TVJB 2DUCA 3KQEA 1AFEH 2RA0A 1WQSA 4I8GA 3UOUA 3A7XA 2UWPA 1O2MA 3PLPA 4FU7A 1BIOA 3ELAH 3ZZ9A 4ZAEA 4X6OA
chains in the Genus database with same CATH superfamily
1OYQA 3LONA 2PUXB 3MU5A 1ZJDA 3Q3KA 2PKSC 3TLOA 1UTOA 2OC1A 4DGJA 1O2SA 3DA9B 4I8KA 1K1NA 1TBQH 4OS4A 2BY5X 2CN0H 4Z1MD 1K1IA 2KFWA 2FOEA 4K1TA 1VJAU 1ZGIA 4ACAA 3TJUA 2NU4E 5C20A 2P93A 3RC5A 3K65B 1ZJKA 4WVPE 2F9BH 2FDAA 1DWBH 2ZU2A 5LPEA 1LQEA 3VGCB 5C94A 1VKYA 3ZYEA 1SPJA 1SVPA 1IHTH 4SGAE 1WU1A 2RG3A 3RXGA 3ATKA 5AVDA 1EJAA 2NU3E 2R3YA 4GSOA 4OS5A 4XBBA 1ANBA 1Z1IA 1BHXF 4MLFB 1THRH 1ZMLA 1O35A 3TGKE 1SC8U 3TGJE 1GCTB 2ZO3H 4BXSA 1WQVH 2ZI2H 4D7GA 1YBWA 1UTNA 3PRBA 1HJ8A 2A1DB 2EI7A 1CO7E 1GHYH 1EAUA 1HNEE 1V2NT 3ZVGA 1JOUB 1ZHPA 3B23B 1TMBH 1ARCA 2ZHEH 1AKSB 1NBME 1C2FA 4Y79A 2F3CE 6ESTA 8GCHG 4U32A 1Y5AT 4X1NU 3TK9A 3M35A 3VB3A 4LOYH 3ZVAA 2FOBA 5I25A 1MQ6A 3SORA 2D26C 1ZPZA 1T8OA 4DG4A 2ZDKA 1EASA 5FL7D 1YF4A 1O2ZA 2WV5A 2XOKD 1DSUA 3SGBE 1DVAH 4AGJA 4I8JA 1SLUB 4E7NA 3NRLA 3RXBA 3KQ5A 1Y3YA 1HJ9A 2SGPE 1YPLH 2VIVA 3RC4A 2GX4A 1DWCH 5TCCA 3F0OA 1PJPA 2YOLA 5BRRE 4Y11E 1XUHA 4X6MA 1Z6JH 3GY5A 3UTUH 2SGAA 1ZTLA 1NRPH 4Q2KA 2DE9A 3TJOA 2VJ1A 2VWLA 2QCYA 1C1PA 3V0XA 1YLNA 1RS0A 4DT7B 1GMCG 4KGAA 2FX6A 4NSVA 3S9CA 5EW2H 1ZSJA 2Y5FA 4NG9H 4BAOB 4DVAU 3I78A 2VWOA 3TJNA 1O2JA 1OKXA 1VITG 2R2MB 1P02A 2QXGA 5HGGA 1SGRE 1OWIA 1Y5UT 3W95A 3FP8E 1GJ7B 2G81E 1NM6A 2QGRA 2Z9KA 2ZHDA 1EPTC 1EKBB 1T8LA 5JYIA 1BMFD 1A2CH 1ZMJA 1LPGB 1DITH 1PPZA 1WSSH 1ZGVA 1CGIE 3U1IB 2PTCE 1P2KA 3IITA 3PWCA 1QBOA 2PGQB 2YMSD 3SOSA 3S7KB 1UVOA 5EQSA 1SGNE 3L33A 1ZPBA 3CENA 2FP7B 5ABWA 1T7CA 1TNJA 2VINA 2XCNA 3S69A 3SJKA 1C5RA 2AFQB 1AE5A 1OOKB 2ZCLP 3MNXA 2W3KA 1FZZA 4X1RU 2BXUH 4RSPA 2PFEA 1IQEA 1BBRK 1Z7KA 4CRDA 2LNCA 1O3DA 1GDQA 2P8OB 5F8TA 1DWEH 4NA9H 5DKMA 1VZQH 2QAAA 3O8BA 1GHAF 1TPOA 2Q6DA 2XNIA 4YOGA 5C0UA 1L4ZA 2BY9X 2XWBI 1W0ZU 1K2I1 1O3LA 4MNWA 1RXPA 5C5NA 1D6RA 1YY3A 1C4V2 1IQLA 1L0ZA 1LKBA 3BTTE 1BITA 5GCHG 1GI2A 1XUIA 4X8VH 1S0QA 1FV9A 3P6ZB 3PTNA 2Y5HA 1AVXA 4XSKU 4ZHLU 1NU7B 4INKA 3A7ZA 1AVWA 2O9QA 2Q6GA 3RXMA 4H6TA 3U8OH 1IQFA 4B6FA 1QJ7B 2V3OH 1AKSA 1V2QT 3F2FA 1SQAA 4A6LA 1LHCH 1LHFH 1O5DH 1GG6C 3NXPA 1GBCA 4BAKB 4FOUC 2VWNA 3UNSA 4CRFA 4ISOA 1MBQA 2P95A 4B2BA 1AD8H 3GY2A 2AGEX 1BRUP 5DGJA 2L6OA 3RLYH 1ESAA 1MD8A 3O8DA 3W94A 1O30A 2BDAA 1P10A 1O5GH 5EU8A 1O5CB 4JYUH 1AVGH 2ZZUH 5A0AE 1IQNA 2GCHF 1BRBE 2VNTA 1Q3XA 4D9QA 5EQQA 2SGEE 3E0PB 5LPFA 5EG4A 3VXFH 2ZWLH 2Z94A 2HLCA 5HXFA 4UFGH 4NZLA 3N7OA 1Y3UA 3RMMH 1KIGH 1UO6A 1V6DA 2R0KA 3K6YA 5E2OA 3RC6A 1XUKA 3SUFA 1SGYE 1YPHE 3LH3A 1S83A 2EQNA 1C5XB 1JWTA 4ABEA 1XMNB 1Q2WA 1IQKA 2O8UA 1NRQH 2BD3A 1GI5A 3BEUA 3PYHA 1YKTA 2D8WA 3KYFA 1A0LA 1INCA 1KTTB 1NBMD 3M3VA 2H9HA 3MNCA 5HIZA 1J15A 2Z6BD 1YPGH 2LELA 4MPVA 4XD7D 2OP9A 3VB5A 1FDPA 5JB9S 2YNBA 1SGFG 3FN8A 1ETSH 4KTSA 1O36A 2BDYA 2SNWA 4NGAH 1SBWA 4YM9A 1RD3B 3D65E 3GCOA 1AIXH 3T29A 1UTLM 2WV4A 5LPRA 1E35B 1P05A 3LIWA 1SLVB 3PV5A 3A8BA 3VFEA 3QGNB 2KAIB 2FTMA 2DE8A 1S6HA 1SLWB 2JH5D 2A4GA 2ZDMA 3MU1A 3M3SA 2WUBA 4UE7H 2HPQH 3BV9B 4AYYB 2GT8A 1OS8A 3LGIA 1OWJA 3P8GA 3RXPA 2CXVA 3SZNA 1FAXA 2ZECA 1UTQA 1BMNH 1S82A 4OS1A 4Q4LA 3TIUA 2Y81A 2J2UA 3PTBA 4U30A 5A2MH 1S85A 4ZKNU 2RDLA 3U28C 3IWMA 2WPJS 3LPRA 3SNAA 3RMNH 1WTGH 2SFAA 2HVXA 2Y80A 4WMDA 2A5AA 3M7QA 1BOQA 1BTYA 3DSPA 2F91A 5DSFA 2XBXA 4HI3A 1V3XA 2LPRA 2KCOA 1WAYB 3M5OA 1QRWA 3KCGH 1DXPA 1QA0A 1NPMA 4ABDA 1A3BH 1QRZA 2FS9A 4LK4A 1GGDB 2RDEA 5F53A 2G5NA 3T62A 4ZROA 4NIXA 3TU7H 3RXOA 3H7OA 1GL0E 1QL9A 3RXAA 4A1XA 4BTIB 3HATH 1BT7A 3ESTA 1QNJA 1DY8A 1U6QA 2I6SA 3MWIU 1BTXA 4ZKOU 5A8YA 1GMDF 1XKBC 3VXEH 3FKSD 5TJXA 5C1XA 1FI8A 2XYAA 3RXEA 1AO5A 1WYKA 1FONA 2OD3B 2TGTA 4FUGA 4F49A 1GJ6A 1CGHA 3OTPA 3OAAD 1MTUA 3ZZDA 1O2UA 1ZRBA 2ZGBH 1SB1H 2P59A 5A8XA 4SGBE 1OWEA 1KLJH 1K1MA 3TK5A 5KEDA 1O5FH 1C5QA 3A87A 4B6EA 4Y0ZE 1CHGA 2Z3EA 3DT0H 2GTBA 1ZRKA 3FVFB 2OQ5A 1RIWC 4O3TA 2FI5E 4IMZA 1H8HD 1GHBF 2BZ6H 3SGAE 1V2WT 2TRMA 5AFZH 2EEKA 1YLCA 1QJ6B 3EAJA 1KXEA 1FY5A 3P8NA 1C5OH 2CJIA 5FCKA 5DN6D 1C1NA 2GZ7A 4OS6A 5T3HA 2A7JA 1GI4A 1PFXC 1CU1A 4TPYA 1G32B 5CHBA 1EOJA 1HJAB 4KKDA 3PB1E 4MPXA 3SV2H 3UWJH 1PQ8A 4XBDA 3PMHB 5HKKD 1DANH 4KTUA 1O0DH 1NN6A 3GYLB 3M5LA 4JZFH 2KCAA 4RI0A 3BTWE 1QB9A 1YGCH 1NS3A 1CHOF 1BBRE 1Z8IB 3GICB 3HKJB 4GAWA 3V3MA 1O3BA 3OY6U 1O2WA 2H9TH 1G3EA 3MQKC 3KEEA 2BDHA 1NT1A 2BDIA 4RT1A 3RXJA 3U9AH 1LHEH 2ZGXH 5FBIA 1G3CA 4ASUD 1MZAA 4NWLA 1Y8TA 3TITA 3WWBA 4ABHA 1AU8A 2HOBA 1MBMA 4FETA 1O2RA 4Q7YA 1SQTA 3EGKH 3UPEA 5EGMA 1SSXA 3TPIZ 3ZZ8A 2QE7D 2AYWA 3A83A 5CHAB 1BJUA 2BM2A 4HG6A 1V2UT 3MNSA 3R0FA 1AUTC 3MH6A 3RXKA 1ANEA 1DE7H 1T31A 2JDID 4GHQA 1T32A 3SJIA 2F9VA 2FM2A 1CBWB 1XUGA 3EA9A 1DLEA 1K1OA 1WDIA 4NZQA 1AE8H 2BXTH 1UVUH 3DFJA 2FIRH 1TIOA 3JZ1B 1PPHE 1SOTA 1TGCA 3LOXA 2PSYA 4D7FA 3RMOH 3L6PA 2PHBA 3LGVA 3UQVA 1PPCE 3P17H 4P00A 1TPPA 2VGCB 1GBTA 1GBFA 1YM0A 4WF8A 2BX3A 4ABJA 3UOPA 3S9BA 1H9IE 1FMGA 3BF6H 2OINA 2ZPQA 3M36A 2ZHFH 2BZAA 4A7IB 3PO1B 2JJ2D 4BNRA 3QZQA 4WWYA 2EI8A 1EX3A 1P8VC 2R3UA 1O2XA 3SJ9A 1V2OT 1WBGB 2TPIZ 2PW8H 2VH6A 1C5NH 4P02A 3SJOA 4ZCNA 3BIVH 4I33A 2CF8H 4JZ1A 3SV7A 1D3TB 3AASA 3AVZA 1DWDH 1ZLRA 1AY6H 2Z9GA 3PWBA 2PUQH 2K8IA 2OCVB 1BMAA 4IMQA 2BX4A 1KXBA 4MPUA 1O3OA 2AEIH 2BDGA 1V2TT 3GCTF 1O2VA 4OM9A 3MI4A 4WMEA 5TCAA 1FN6A 4B74A 2GMTB 4Y7AA 1O2TA 1GBEA 5F03A 2CHAB 2RCEA 2ZHWH 1W0YH 3GDSA 2W26A 4DIHH 3ZVFA 1GI0A 3O8CA 1K21H 2W6JD 1LHGH 3T26A 3TH2H 1TBRH 4A1VA 2AMQA 1ZSLA 3ZYDA 1BB0B 1V2ST 2P94A 3BTGE 1DM4B 1GJCB 3RXSA 3LU9B 1OP8A 3BTFE 4BAHB 1E0FD 1AMHA 3CS0A 3BEIB 3F9HA 4NWKA 2QXIA 1NU9A 1SG8B 2TGPZ 4A1TA 1S6LA 2YMSB 3S7HB 2ZU5A 2ZU1A 1CA8B 3OEED 4MNXA 1NFUA 2VVVA 2ZFSA 3K2UA 1O39A 2Y82A 2BB4A 1YLDA 2HVYB 2ZDLA 1SGPE 3NWUA 5C17A 6GCHF 4CR5A 3OEHD 2HWLB 3N7EA 4YTAA 1AZ8A 1UVSH 5ETXA 1L1GA 1G37A 3LT3A 2QY0B 3NUMA 1EUFA 4K5ZA 3KIDU 2Z3CA 3LGYA 1XVMA 2QC2A 1CVWH 1SGFA 5JPMH 4BOHA 1V2LT 1JIMA 1OP0A 1KSNA 3T2NA 3V7TA 1HDTH 4YESB 2AERH 1HAZB 3F6UH 1LQDB 2AGGX 2BVSH 4FUDA 1RRKA 1UCYH 4Q63A 3B9FH 1NFXA 1P2NA 1FLEE 2AS9A 1TNIA 2QA9E 1J9CH 1IQHA 1L1NA 1MU8B 2W3IA 1N1LA 4NIVA 1ESTA 1V2RT 1ANDA 1GBJA 2CGAA 1OWHA 4TY7A 5ESTE 3FP6E 1ZZZA 2L74A 2EA3A 4ISLA 4M9FA 1ZYOA 1MTVA 2A45B 2ZKSA 4DW2U 4WH8A 3UQOA 1HAVA 3HGNA 2W5EA 4X8SH 3U1JB 1A1RA 1XUJA 1GI6A 3VB6A 1P11E 1O2GH 1GJ9B 2EC9H 1E1RD 1EZQA 1KDQB 3BG4B 3KN2A 2Q6FA 1O3MA 5C1YA 1D4PB 2GDEH 5DK1A 1Y3VA 3RLWH 1HAYB 2CF9H 1MMJN 1LPKB 2A31A 5EW1H 1TRNA 4AB9A 1HPGA 1FXYA 3BTME 4CRAA 4JZEH 2IPQX 1QRXA 1ZOMA 4NFFA 2J92A 4ZUHA 1YWUA 4BAQB 1S6FA 2GZ9A 1S5SA 1W7XH 1MTWA 2BDCA 3QTOH 4Z0KA 1TONA 4JMYA 1E79D 1V2JT 1AHTH 1QTFA 1SHHB 1IQGA 3CP7A 1O2LA 1O33A 3SNCA 4YOJA 8GCHF 2ZPRA 1ETTH 7GCHG 1AB9C 4VGCB 1C5VA 2F83A 3VG8A 2BD2A 2SGQE 3A88A 4WXIA 2GV6A 1O5EH 2ZIQH 2SGFE 3AK5A 2GCTB 1IQMA 1P9SA 3SGQE 1ABJH 1KXDA 1TALA 2ZU4A 5IDKA 4YXWD 2BY8X 2A5IA 2FOHA 3DSGA 2PP6A 4AN7A 5FXLA 4CBOA 1GI7B 3WWFA 1UW7A 3URDA 3A7YA 5F8ZA 1UVPA 1E34B 4TWWA 4H42U 1KXCA 1MKXK 4AFQA 1BMLA 2V0BA 4B1TA 2XCFA 1O5BB 2AH4X 3A8DA 1KTSB 2XW9A 1HIAB 5C1UA 3M3TA 1AI8H 2ZDNA 3GCHB 4BTUB 2KZ4A 1LVYA 1J16A 1CGJE 3FO8D 3QZRA 3EE0B 3ITIA 3SO3A 2EY4C 3MH4A 3KGPA 2UUJB 5T6DA 2B5TB 4U2WA 3ZVBA 4CHAC 5FPYA 2JJ1D 3EQ0H 4B71A 1KLIH 1GMCF 4FU9A 1Q31A 2OLGA 1A0HB 2F4LA 1LPZB 3GYMA 3GS9A 2CV3A 1G2MA 1VITF 3RM0H 4CBNA 3PLBA 1VGCB 3MO9A 1GGDC 2BD8A 1N8OB 1PPFE 4O3UA 1W13U 2GZ8A 3KQBA 3ODDA 4FUBA 5FX5A 1O3NA 4GVUA 1TBZH 1QA7A 1O2QA 4ASHA 2PKSB 1MQ5A 3RXFA 1W3CA 1RJXB 4MPWA 1DT2A 3GOVB 2ZFRH 4ABAA 2FOGA 5DP3A 4XE4A 2WV9A 1G2LA 1GJ4H 1C1WH 1PPGE 2FOCA 2QF0A 2ZA5A 4DJZB 4E06H 3DCLA 5I46H 9LPRA 1ACBE 2R9PA 4B75A 4YT6H 1UJ1A 4IW4E 1KDQA 1BHXB 2ZNKH 1GL1A 1UHBB 1Y3WA 3A82A 4WMFA 1Z71A 3AW0A 3MHWU 3W1EA 1NRRH 4IN1A 1KXFA 3LGUA 4IC5A 4K8BA 2XBYA 1T8MA 4K1SA 1HXEH 4DOQA 3BSQA 1RTLA 3A7WA 1GVZA 3PV2A 1COWD 3LDXH 4GCHG 3PV4A 1ELVA 1O38A 3UB0A 1UCYK 1MCTA 2XWAA 5F8XA 3QWCH 5GCHF 3BTKE 1SGIB 1BTZA 3SUGA 2EI6A 3FANA 2H5CA 1O5AB 1WV7H 1TB6H 4FUEA 5FBEA 3TNSA 1C2EA 3QN7A 1CT0E 1W0JD 4U01A 1H9HE 5FHTA 2ODYB 2ZG0H 3ZZ7A 4UDWH 3FFGA 4CRCA 5C67A 5HYOA 4FUJA 4JK5A 4FUIA 2OUAA 1PYTD 2Y5GA 1TA6A 2QYIA 2VH0A 3SQHE 2W6ID 5HM2A 3S9AA 1W14U 5AHGH 4I7YH 3MFJA 4AZ2B 3OYPA 3P70B 2JH0D 2FLBH 1G30B 3RXIA 5H4IB 3SJ8A 2STAE 4JCNA 1C5MD 3N7DA 1ELDE 3RXLA 1XKAC 1TPAE 1IQJA 1MZDA 3ZZ5A 2VIDA 1TMTH 3U8RH 4B76A 1L4DA 4O9VA 2BQ7B 3GY7A 2ZFFH 1D3QB 3NPSA 1E1QD 4XFQA 1YCPH 4GPGA 2FX4A 1LTOA 1P0SH 1WUNH 1C5YB 1CQQA 1FJSA 3KHVA 1C1MA 2FPZA 3RXQA 3DHKH 2KR7A 2A0QB 3RU4E 3UR9A 3UR6A 1QZ8A 5CHAC 3SI4H 3A8AA 4K1EA 3LH1A 1FQ3A 3BTQE 1TQ7B 3GISB 3RXDA 1TGNA 1P04A 2K1QA 3GDUA 1O2PA 4KP0A 3QX5H 1V2PT 2BD5A 2VIQA 3E16B 5DJ7A 1YPEH 1O37A 1ELGA 2UUFB 3ATMA 2ZF0H 3A81A 4MVNA 5E0HA 1E38B 1GMHG 1SGEE 4UEHH 1P12E 1CSOE 3R3GB 1EPTB 2TBSA 1C2HA 2BQ6B 1YYY1 4MQAA 4WY3A 5FCRA 2ALVA 1W0KD 1KLTA 4TY6A 2QXJA 2ZTXA 1PQ5A 2OQUA 2UWLA 7ESTE 1O3KA 2FZZA 4X6NA 1EZXC 1P3EA 1Z8GA 1GJ5H 1GVLA 1EP6A 1SFQB 2VWMA 1SR5C 5E0GA 1FX0B 4TSFD 4YOIA 5DG6A 5AFYH 1G3BA 2OXSA 2P3TB 4ACBA 3LC3A 1DXWA 1NRNH 3PO1C 5HM9A 2HPPH 3QO6A 1H8DH 1BMMH 4D76A 2XC4A 1FY1A 5DP9A 1P06A 1UHBA 2FOFA 5IYTA 4MNYA 1C2GA 1H1BA 1O3CA 2THFB 5B6LA 1YPJH 2ANMH 4FVBA 4X8TH 1QBNA 4Y8ZA 2C8WB 1OWDA 4I86A 5DP7A 2XC5A 1GJAB 2PKAB 1C5SA 3M5NA 2O8MA 5GPIB 1E37B 4Y6DA 2FI3E 1MU6B 1TWXB 2A32A 5E8EH 2BOKA 1FAKH 2WHXA 4MG3A 2H6MA 4NSYA 5EIYA 1H4WA 1GBLA 4UFDH 4O97A 2A7CA 2G5VA 1DY9A 2BHGA 2IOTA 3GY6A 5EPNA 1NRSH 1P2JA 3OU0A 1XX9A 2AGIX 5DP6A 2NU2E 2GMTC 5HIYA 2QIQA 1CT2E 4QT8C 2CK3D 2CHAC 2QN5T 2BD4A 4TWYA 2BMGB 4YLUA 1EATA 2NU1E 1F92A 1SGQE 4FUCA 1X7AC 2BY6X 3OX7U 5KGOA 2ZEBA 5DO4H 1IHSH 1VITH 2RFKC 1TNKA 2AIQA 4I8LA 2ZQ2A 1TGSZ 3D62A 1DOJA 4HZHA 1B0EA 3V13A 3LGTA 3OE7D 1HGTH 4BAMB 1AGJA 1ZHRA 3RXUA 3E0NB 4Y10E 1MABB 1ID5H 2JKHA 1PQAA 2FODA 4WH6A 3MU8A 2WPHS 1C9PA 4RKOB 1P2OA 7LPRA 2YMSC 2ESTE 4KTCA 1UTKA 2QXHA 2G8TA 1B5GH 3OFND 2WINI 1UTMA 2KAIA 2D1JA 4D8NA 4X8UH 4XRNA 3A86A 5EQRA 2J34A 3CNRA 3SNBA 2GDDA 2ILNA 1SGCA 3VGCC 1Y59T 5SGAE 3RDZA 5T1VA 3AW1A 4K60A 1F5LA 3CS7A 2ANKH 2Z7FE 1GBBA 1FY3A 3MMGA 2VIOA 1VCPA 4ZXXH 1MD7A 4B2AA 1T8NA 2CMYA 1E36B 4DY7B 3L3TA 4YT7H 2GP9B 4X1PU 5CDFE 1SLXB 2FWWA 1GCTC 2WPIS 4AG2A 1YP9A 3EA8A 1A7SA 1EPTA 2QF4A 2ZGHA 4F4OC 3MU4A 1AUJA 2GVFA 1AQ7A 1DLKB 1HCGA 3STJA 1C5PA 1FUJA 1GHXH 1XVOA 2Q1JA 3FP7E 3MH5A 4E05H 4PROA 2Z9LA 1B0FA 4X6PA 1EAWA 1QL8A 2BLQA 1JRSA 3P8OA 1YCPK 1FIZA 1O3FA 5E2PA 3RMLH 5LGOA 3SV6A 3SBKA 1K0HA 1G36A 1Y3XA 1DFPA 2J94A 1DUAA 1NTPA 3F2GA 2PSXA 5CE1A 4ZMAH 1Z6EA 5EXNA 1TX7A 5JBCS 2VB0A 1XUFA 4F48B 1W11U 1W8BH 3RU4D 2G55A 1LCYA 2Y7ZA 1A0JA 3TJVA 1WXRA 3F3BA 1AFQB 1EJMA 5C0TA 2WUCA 1C2IA 4THNH 1C1OA 1EZSC 2FI4E 5FX6A 1C5WB 1VCQA 1GI9B 5E0JA 1UCYE 4AOQA 2PKAA 3Q3YA 5AF9H 2SNVA 1LVOA 2ZC9H 3ZZCA 3QTVH 2A4OA 1C2DA 5G4BA 4E7RG 1NESE 3P92A 4JK6A 1DICA 1UTJA 1RFNA 2ZFPH 2W7UA 2PTNA 2FTLE 4CH2B 1D3DB 3SYJA 1MKXH 2QV1A 3BTEE 2PV9B 4VGCC 4AYVB 1T4VH 5K0HA 3I77A 1ZTKA 1ABIH 3SV8A 1JIRA 3F9FA 1BTUA 4J1YA 1C1VH 3UREA 1VJ9U 3UIRA 4XBCA 1QQ4A 1DS2E 2ZTYA 2W7SA 1CA0B 2BY7X 2C93B 1ELFA 1TGBA 1YCPM 2ZDAH 4FXGH 1ZR0A 3SNDA 3RXVA 1C2KA 1HXFH 1QFKH 1J14A 3B8JA 2J5UA 2IJD1 1ZTJA 2J38A 2PWXA 1BA8B 2JH6D 2FYQA 2JETB 3MO6A 3ZVDA 3T25A 1ARBA 4HTCH 3ATIA 4ZXYH 4Y76A 3SW2B 6LPRA 3HGPA 2HRVA 3KQCA 1O32A 4X2WA 1O34A 6CHAB 2KX4A 4Y8YA 3UAIC 1F7ZA 2B9LA 1K22H 1DUEA 1PQ7A 3MOCA 3PRDA 4ZKSU 1OP2A 2ZFQH 2OC0A 1A5IA 1ETRH 1BCUH 1DSTA 2P8OC 2WYJA 4X2YA 1P3CA 1F0SA 3QGJA 3T28A 4BANB 1J17T 1Y5BT 2OBQA 1TFXA 1P2IA 1LKAA 1RGQA 1VGCC 1BDAA 1C4U2 2ANWA 1N8OC 1TNLA 1HAHH 1RIWB 1C2JA 1O2NA 1BQYA 2J98B 3ZIAD 1V2MT 2XRCA 1ANCA 1D3PB 1P9UA 3RXRA 3SU1A 5L2YH 1SHYA 4UD9H 3PMJA 3A85A 1MAYA 3QUMP 1F0RA 2PR3A 3SUEA 4ABBA 2G4TA 1UK2A 3PMAB 4RN6A 5JB8S 2P3FH 3RP2A 3PROA 2A7HA 3MO3A 3NK8A 2UUKB 2A5KA 1LDTT 4X2VA 1GDNA 1EQ9A 2FLRH 2H2ZA 1HAOH 2XC0A 1GI8B 1MAXA 4MDSA 1EB2A 4ISIH 4UFFH 5EOKA 3M61U 4RT0A 1OHHD 1LVBA 1HAXB 3E6PH 3TH4H 3PM3A 1SL3A 2WZQA 4A92A 2P3UB 2ZGCA 1GBMA 3MH7A 1C1QA 3UFAA 2VBCA 2FOAA 3H7TA 2BYAX 2H5DA 4JYTA 8LPRA 1XM1A 3EE7A 1W2KH 1AN1E 2XTTB 4Q7XA 3SU5A 1QB1A 4Y71A 1G9IE 1KXAA 5HMAA 4CH8B 1GDUA 4NFEA 1O3EA 1W12U 4CREA 2ZP0H 5C5OA 2FESH 1A5GH 1QCPA 3G01A 1GPZA 2BOHB 2BVXH 2NU0E 2ASUB 1HUTH 2JIZD 1C5ZB 1KMHB 1O31A 4YZUA 2V3MA 3SU4A 4A5TS 2HALA 1OXGA 4JYVH 4GUXA 1GVKB 3M37A 1CT4E 4NCYA 1JXPA 2M5TA 1BZXE 1NFYA 1VR1H 1GBHA 1ZPCA 1TX6A 3VEQB 2RA3A 1GI1A 5A0CA 4ABIA 1C5LH 1C1SA 1P09A 1QJ1B 2IPHA 3BN9A 1Z8RA 5EJ1A 1HAIH 4RKJB 1RTFB 2AIPA 1P57B 5JBTA 2VU8E 3RM2H 3DSOA 1NFWA 3TK6A 3KYGA 2WPMS 2TGAA 3LC5A 3Q3XA 2OK5A 1SGTA 4XDEA 3TNTA 5DP5A 4IN2A 1OYTH 2Y7XA 1F0TA 3WW7A 1MCVA 1MTNB 3BTHE 1HBTH 4FVDA 1YPHC 3T27A 1XXDA 1ZHMA 3A89A 3LJJA 2ZHQH 3HK3B 1O2HA 1EAIA 4B73A 3H5CB 1O2OA 3JZ2B 1GHAG 4ZKRU 2XXLA 2GD4B 1A3EH 1J8AA 2J98A 3PMBB 2WPKS 1F0UA 2A4RA 5IK2D 1LO6A 3F0PA 2O8WA 3WY8A 3Q76A 3GY3A 3ZVEA 4B2CA 1K1LA 4DIIH 1BTHH 2ULLA 2ZGJA 1KYNA 2OC7A 3UNQA 2NWNA 3VB7A 1A5HA 1K28D 1SKYE 7GCHF 1TABE 1QQUA 2G51A 3EA7A 1PPEE 1DX5M 2FEQH 2ZQ1A 3KQDA 4H6SB 2J9NA 4DT4A 1DPOA 1TOMH 3C1KA 5GWZA 1FY4A 1TRMA 4TYDA 1SGDE 1GCDA 3VB4A 2ODQA 4K69A 3FZZA 1MUEB 1O3GA 2PLXA 2QF3A 2P16A 3RU4T 5DPAA 1F2SE 1Z1JA 3LJOA 1NC6A 1AZZA 3NZIA 4JZDH 3OY5U 2BVRH 1TMUH 3SQEE 4TPIZ 3S0NA 1D6WA 3Q77A 4MNVA 5EJZA 1O2YA 3TH3H 4NA7A 1P2MA 1ELTA 2BLOA 1P2QA 2GCHG 3RXCA 3C27B 2K0QA 3V12A 1L2EA 1YPMH 4ZHAA 1BRCE 1WCZA 5GDSH 2OTVA 4YO9A 1LMWB 4FUFA 3EYDA 1HYLA 1GJBB 3EDXB 2GT7A 3SI3H 3E3TA 3SU6A 4IS5A 4Y7BA 3ZZ6A 2IN2A 2KCPA 1GJDB 1V2VT 3UY9A 1EJNA 2BLWA 1GI3A 4FU8A 2ODPA 3ZVCA 1PPBH 1GBKA 1EAXA 4X1SU 2A2XH 1ELBA 3TGIE 1EFRD 1A61H 3RUOA 1MH0A 5PTPA 2GKVE 1C1UH 3A7TA 2BDBA 1OWKA 1V2KT 3BIUH 5FPTA 5KECA 3DFLA 3ZZBA 1K1PA 1HJAC 4NIYA 1AWFH 2ANYA 3D23A 1YC0A 5GJ4B 1O2KA 1HB0B 1BJVA 1GBAA 3I29A 4AX9H 3BG8A 1P03A 1LHDH 1O3JA 2FOMB 1HAPH 5T6GA 3QDZB 4NA8A 1UK3A 1S84A 4H4FA 2FO9A 3KL6A 4OS2A 3QLPH 3BEFB 4HGCA 1HV7A 1QBVH 1TA2A 4GCHF 4J2YB 4K3JA 2F43B 1HIAA 3AAVA 1O3IA 2KCYA 3F1SB 1OX1A 1BUIA 4KELA 2V35A 3SU0A 1O3AA 5EPYA 3ZV8A 3ZZ3A 4LZ4B 3PLKA 3MNBA 3SHAH 2FXRA 3M5MA 3GDVA 1ELEE 5FAHA 1JRTA 1C1RA 4GHTA 2J95A 2D2DA 3IG6B 1TX8A 2M2AA 1P01A 1TRYA 1GHZA 3DD2H 1AB9B 1TE0A 4AFUA 1SI5H 3K6ZA 1HFDA 5K7RA 2G52A 2J97A 1CBWC 1SFIA 2VIWA 3MU0A 2AHME 3UWIA 4INLA 2Z9JA 3F9GA 4OS7A 5GNDA 1H9LB 1C5TA 1ESBA 5ESBA 1AFQC 2H1UA 4WJG2 1O3PB 1TLDA 3F68H 3Q00A 3SUDA 1UTPA 3OTJE 3ZZ4A 1IOEA 4Y8XA 2ZU3A 2VGCC 1HAGE 1MKWH 1F5KU 4R0IA 5GXPA 5DP8A 2F9OA 2ALPA 2ZCHP 5FPSA 1GMDG 2F9NA 3ATWA 1C1TA 3GCNA 2HGTH 1UVTH 2C3SA 2ZDVH 5BPEA 1JMOH 1W7GH 4CHAB 2G4UA 2GJGA 1NO9H 2QF5A 1FY8E 2C90B 3SU3A 5J4SA 3SV9A 1ZSKA 1AWHB 3HK6B 1YPKH 1S81A 1T4UH 2VVUA 1ELCA 2XBWA 1QURH 3KNXA 3N99A 4ISHH 3FAOA 4UONA 3MYWA 1GJ8B 4INHA 1GBIA 1QHRB 1TAWA 2R2WU 2Z9IA 2WYGA 1GMHF 1SQRA 3F9EA 1NZQH 5JBBS 2V6NA 4AB8A 1O2IA 4X1QU 1W10U 2OC8A 2WSSD 3NKKA 4DURA 1GHBG 1CA0C 2A4QA 1RTKA 4ISNA 1O3HA 1KY9A 2HNTC 4XOJA 2BTCE 1UMAH 2Y6TA 2ZPSA 4GLYA 4BXWA 3P95A 3E90B 3HPTB 1OSSA 2ZCKP 1IAUA 4IBLH 1TNGA 2JETC 2TIOA 3A8CA 3E91A 1S0RA 3URCA 5EODA 3FOAA 1GBDA 1QGFA 2ZTZA 2HNTF 3VPKA 2TGDA 1LVMA 6CHAC 3U8TH 1GG6B 1GWAA 2C8XB 1FPCH 2Z3DA 3U69H 3F2HA 1A46H 3OSYA 1CHOG 2B8OH 2V3HH 1K1JA 4DCDA 1OPHB 3GY8A 1QR3E 1TQ0B 4Q7ZA 4X0WU 4OGYA 4UFEH 1H8IH 1VCWA 1BTPA 1SMFE 5J4QA 4FUHA 4JZIA 1C2LA 1N6XA 4Q80A 2WPDD 3O8RA 1B7XB 1ELAA 1TGTA 5EXLA 2A2QH 2H9EH 4K8YA 2I6QA 5DP4A 3SU2A 2ZFTA 1ZMNA 1TNHA 4CRGA 2C8YB 1UK4A 1EXFA 3KF2A 1NY22 4CR9A 4LXBH 2XNDD 1EB1H 8KME2 2PGBB 2O8LA 1L1JA 4K2YA 2G00A 1DDJA 4I31A 4Y0YE 2BQWB 3ENSB 3D49H 3SZEA 4AORA 3RXTA 3SHCH 1EOLA 4ZHMU 1BRAA 3E1XB 4I32A 5A8ZA 2UUYA 2FYRA 3RXHA 1FPHH 1G3DA 5L30H 4AC9A 4WXVA 1TPSA 1N6YA 2GV7A 4IGDA 1MTSA 2WPLS 1QL7A 3HKIB 5GIBA 3ZV9A 4AGKA 1HLTH 3SNEA 3QK1A 3E8LA 5JDUB 1WTHD 4BTTB 5EXMA 3K9XB 1K9OE 4MTBA 1H8ED 5JBAS 3P8FA 4AFSA 2F9UA 1TYNA 4YLQH 3ODFA 3BG4C 1WOFA 3AAUA 3NCLA 5C3NA 4AFZA 2B7DH 5EJLA 1HRTH 3A80A 2BD9A 3GY4A 2VIPA 1ORFA 2J4IA 3FZDA 5T6FA 3UUZA 1C5UA 2C4FH 2VVCA 3UNRA 3DUXH 2BD7A 4IC6A 2UWOA 3A7VA 3MTYA 5LH8A 4O03A 3A84A 1C2MA 2FMJA 2HNTE 5B6OA 1QIXB 1C4Y2 1FNIA 3ZZAA 4ZH8A 7KMEH 3STIA 4ABGA 4F55A 1TOCB 1SQOA 3SN8A 3GCTG 3M7UA 4CRBA 5L2ZH 1MKWK 1HAVB 1C9TA 1FN8A 4I8HA 4HFPB 5F6MA 1M9UA 1QB6A 1PYTC 2R0LA 5L6NH 2V7QD 1THPB 2GCTC 1D9IA 2BLVA 1THSH 5CMXH 3BTDE 5A09A 1EP5A 1GHWH 1MTNC 9ESTA 1F5RA 1NROH 4NIWA 2KM0A 3U98H 1FIWA 4AG1A 4ESTE 2AMPA 5A0BA 1CE5A 3ATLA 1QY6A 2AMDA 2HLDD 2STBE 2SGDE 4X2XA 2YNAA 1A4WH 2IJOB 1IQIA 4OGXA 4D9RA 3GCHC 4LZ1H 3H09A 1GHVH 1EZUC 4ABFA 2C8ZB 3T5FH 4Z6AH 2OBOA 2XBVA 2LP6A 2GGVB 1Z8JB 1JBUH 6GCHG 3LGWA 4M7GA 2B0FA 1BBRH 1SOZA 1XXFA 3M7TA 2O8TA 3LKWA 5C2ZA 2FS8A 4R8TB 8ESTE 1BTWA 2F9PA 3TVJB 2DUCA 3KQEA 1AFEH 2RA0A 1WQSA 4I8GA 4TT3D 3UOUA 3A7XA 2UWPA 1O2MA 3PLPA 4FU7A 1BIOA 3ELAH 3ZZ9A 4ZAEA 4X6OA
chains in the Genus database with same CATH topology
1OYQA 3LONA 2PUXB 3MU5A 1ZJDA 3Q3KA 2PKSC 3TLOA 1UTOA 2OC1A 4DGJA 1O2SA 3DA9B 4I8KA 1K1NA 1TBQH 4OS4A 2BY5X 2CN0H 1K1IA 2FOEA 4K1TA 1VJAU 1ZGIA 3TJUA 2NU4E 5C20A 2P93A 3RC5A 3K65B 1ZJKA 4WVPE 2F9BH 2FDAA 1DWBH 2ZU2A 5LPEA 1LQEA 3VGCB 3ZYEA 1SPJA 1SVPA 1IHTH 4SGAE 1WU1A 2RG3A 3RXGA 3ATKA 5AVDA 1EJAA 2NU3E 2R3YA 4GSOA 4OS5A 4XBBA 1ANBA 1Z1IA 1BHXF 4MLFB 1THRH 1ZMLA 1O35A 3TGKE 1SC8U 3TGJE 1GCTB 2ZO3H 4BXSA 1WQVH 2ZI2H 4D7GA 1YBWA 1UTNA 1HJ8A 2A1DB 2EI7A 1CO7E 1GHYH 1EAUA 1HNEE 1V2NT 3ZVGA 1JOUB 1ZHPA 3B23B 1TMBH 1ARCA 2ZHEH 1AKSB 1C2FA 4Y79A 2F3CE 6ESTA 8GCHG 4U32A 1Y5AT 4X1NU 3TK9A 3M35A 3VB3A 4LOYH 3ZVAA 2FOBA 5I25A 1MQ6A 3SORA 2D26C 1ZPZA 1T8OA 4DG4A 2ZDKA 1EASA 1YF4A 1O2ZA 2WV5A 1DSUA 3SGBE 1DVAH 4AGJA 4I8JA 1SLUB 4E7NA 3RXBA 1Y3YA 1HJ9A 2SGPE 1YPLH 2VIVA 3RC4A 2GX4A 1DWCH 5TCCA 1PJPA 2YOLA 5BRRE 4Y11E 1XUHA 4X6MA 1Z6JH 3GY5A 3UTUH 2SGAA 1ZTLA 1NRPH 4Q2KA 2DE9A 3TJOA 2VJ1A 2VWLA 2QCYA 1C1PA 3V0XA 1RS0A 4DT7B 1GMCG 4KGAA 2FX6A 4NSVA 3S9CA 5EW2H 1ZSJA 2Y5FA 4NG9H 4BAOB 4DVAU 3I78A 2VWOA 3TJNA 1O2JA 1OKXA 1VITG 2R2MB 1P02A 2QXGA 5HGGA 1SGRE 1OWIA 1Y5UT 3W95A 3FP8E 1GJ7B 2G81E 1NM6A 2QGRA 2Z9KA 2ZHDA 1EPTC 1EKBB 1T8LA 5JYIA 1A2CH 1ZMJA 1LPGB 1DITH 1PPZA 1WSSH 1ZGVA 1CGIE 3U1IB 2PTCE 1P2KA 3IITA 3PWCA 1QBOA 2PGQB 3SOSA 3S7KB 1UVOA 5EQSA 1SGNE 3L33A 1ZPBA 3CENA 2FP7B 5ABWA 1T7CA 1TNJA 2VINA 2XCNA 3S69A 3SJKA 1C5RA 2AFQB 1AE5A 1OOKB 2ZCLP 3MNXA 2W3KA 1FZZA 4X1RU 2BXUH 4RSPA 2PFEA 1IQEA 1BBRK 1Z7KA 4CRDA 2LNCA 1O3DA 1GDQA 2P8OB 5F8TA 1DWEH 4NA9H 5DKMA 1VZQH 2QAAA 3O8BA 1GHAF 1TPOA 2Q6DA 2XNIA 4YOGA 1L4ZA 2BY9X 2XWBI 1W0ZU 1K2I1 1O3LA 4MNWA 1RXPA 5C5NA 1D6RA 1C4V2 1IQLA 1L0ZA 1LKBA 3BTTE 1BITA 5GCHG 1GI2A 1XUIA 4X8VH 1S0QA 1FV9A 3P6ZB 3PTNA 2Y5HA 1AVXA 4XSKU 4ZHLU 1NU7B 4INKA 3A7ZA 1AVWA 2O9QA 2Q6GA 3RXMA 4H6TA 3U8OH 1IQFA 1QJ7B 2V3OH 1AKSA 1V2QT 1SQAA 4A6LA 1LHCH 1LHFH 1O5DH 1GG6C 3NXPA 1GBCA 4BAKB 2VWNA 3UNSA 4CRFA 4ISOA 1MBQA 2P95A 4B2BA 1AD8H 3GY2A 2AGEX 1BRUP 5DGJA 3RLYH 1ESAA 1MD8A 3O8DA 3W94A 1O30A 2BDAA 1P10A 1O5GH 5EU8A 1O5CB 4JYUH 1AVGH 2ZZUH 5A0AE 1IQNA 2GCHF 1BRBE 2VNTA 1Q3XA 4D9QA 5EQQA 2SGEE 3E0PB 5LPFA 5EG4A 3VXFH 2ZWLH 2Z94A 2HLCA 5HXFA 4UFGH 4NZLA 3N7OA 1Y3UA 3RMMH 1KIGH 1UO6A 1V6DA 2R0KA 3K6YA 5E2OA 3RC6A 1XUKA 3SUFA 1SGYE 1YPHE 3LH3A 1S83A 1C5XB 1JWTA 4ABEA 1XMNB 1Q2WA 1IQKA 2O8UA 1NRQH 2BD3A 1GI5A 3BEUA 3PYHA 1YKTA 2D8WA 1A0LA 1INCA 1KTTB 3M3VA 2H9HA 3MNCA 1J15A 2Z6BD 1YPGH 4MPVA 2OP9A 3VB5A 1FDPA 5JB9S 2YNBA 1SGFG 1ETSH 4KTSA 1O36A 2BDYA 2SNWA 4NGAH 1SBWA 4YM9A 1RD3B 3D65E 3GCOA 1AIXH 3T29A 1UTLM 2WV4A 5LPRA 1E35B 1P05A 3LIWA 1SLVB 3A8BA 3VFEA 3QGNB 2KAIB 2FTMA 2DE8A 1S6HA 1SLWB 2JH5D 2A4GA 2ZDMA 3MU1A 3M3SA 2WUBA 4UE7H 2HPQH 3BV9B 4AYYB 2GT8A 1OS8A 3LGIA 1OWJA 3P8GA 3RXPA 2CXVA 3SZNA 1FAXA 2ZECA 1UTQA 1BMNH 1S82A 4OS1A 3TIUA 2Y81A 2J2UA 3PTBA 4U30A 5A2MH 1S85A 4ZKNU 2RDLA 3IWMA 2WPJS 3LPRA 3SNAA 3RMNH 1WTGH 2SFAA 2HVXA 2Y80A 4WMDA 2A5AA 3M7QA 1BOQA 1BTYA 2F91A 2XBXA 4HI3A 1V3XA 2LPRA 1WAYB 3M5OA 1QRWA 3KCGH 1DXPA 1QA0A 1NPMA 4ABDA 1A3BH 1QRZA 2FS9A 4LK4A 1GGDB 2G5NA 3T62A 4ZROA 4NIXA 3TU7H 3RXOA 3H7OA 1GL0E 1QL9A 3RXAA 4A1XA 4BTIB 3HATH 1BT7A 3ESTA 1QNJA 1DY8A 1U6QA 2I6SA 3MWIU 1BTXA 4ZKOU 5A8YA 1GMDF 1XKBC 3VXEH 5TJXA 5C1XA 1FI8A 2XYAA 3RXEA 1AO5A 1WYKA 1FONA 2OD3B 2TGTA 4FUGA 4F49A 1GJ6A 1CGHA 1MTUA 3ZZDA 1O2UA 1ZRBA 2ZGBH 1SB1H 2P59A 5A8XA 4SGBE 1OWEA 1KLJH 1K1MA 3TK5A 1O5FH 1C5QA 3A87A 4Y0ZE 1CHGA 2Z3EA 3DT0H 2GTBA 1ZRKA 3FVFB 2OQ5A 1RIWC 4O3TA 2FI5E 4IMZA 1GHBF 2BZ6H 3SGAE 1V2WT 2TRMA 5AFZH 2EEKA 1YLCA 1QJ6B 3EAJA 1KXEA 1FY5A 3P8NA 1C5OH 2CJIA 5FCKA 1C1NA 2GZ7A 4OS6A 5T3HA 2A7JA 1GI4A 1PFXC 1CU1A 4TPYA 1G32B 1EOJA 1HJAB 4KKDA 3PB1E 4MPXA 3SV2H 3UWJH 1PQ8A 4XBDA 3PMHB 1DANH 4KTUA 1O0DH 1NN6A 3GYLB 3M5LA 4JZFH 3BTWE 1QB9A 1YGCH 1NS3A 1CHOF 1BBRE 1Z8IB 3GICB 3HKJB 4GAWA 3V3MA 1O3BA 3OY6U 1O2WA 2H9TH 1G3EA 3KEEA 2BDHA 1NT1A 2BDIA 3RXJA 3U9AH 1LHEH 2ZGXH 5FBIA 1G3CA 1MZAA 4NWLA 1Y8TA 3TITA 4ABHA 1AU8A 2HOBA 1MBMA 1O2RA 4Q7YA 1SQTA 3EGKH 3UPEA 5EGMA 1SSXA 3TPIZ 3ZZ8A 2AYWA 3A83A 5CHAB 1BJUA 2BM2A 1V2UT 3MNSA 3R0FA 1AUTC 3MH6A 3RXKA 1ANEA 1DE7H 1T31A 4GHQA 1T32A 3SJIA 2F9VA 2FM2A 1CBWB 1XUGA 3EA9A 1DLEA 1K1OA 4NZQA 1AE8H 2BXTH 1UVUH 3DFJA 2FIRH 1TIOA 3JZ1B 1PPHE 1SOTA 1TGCA 3LOXA 2PSYA 4D7FA 3RMOH 3L6PA 2PHBA 3LGVA 3UQVA 1PPCE 3P17H 1TPPA 2VGCB 1GBTA 1GBFA 1YM0A 4WF8A 2BX3A 4ABJA 3UOPA 3S9BA 1H9IE 1FMGA 3BF6H 2OINA 2ZPQA 3M36A 2ZHFH 2BZAA 4A7IB 3PO1B 4BNRA 3QZQA 4WWYA 2EI8A 1EX3A 1P8VC 2R3UA 1O2XA 3SJ9A 1V2OT 1WBGB 2TPIZ 2PW8H 2VH6A 1C5NH 3SJOA 3BIVH 4I33A 2CF8H 4JZ1A 3SV7A 1D3TB 3AASA 3AVZA 1DWDH 1ZLRA 1AY6H 2Z9GA 3PWBA 2PUQH 2OCVB 1BMAA 4IMQA 2BX4A 1KXBA 4MPUA 1O3OA 2AEIH 2BDGA 1V2TT 3GCTF 1O2VA 3MI4A 4WMEA 5TCAA 1FN6A 4B74A 2GMTB 4Y7AA 1O2TA 1GBEA 5F03A 2CHAB 2RCEA 2ZHWH 1W0YH 3GDSA 2W26A 4DIHH 3ZVFA 1GI0A 3O8CA 1K21H 1LHGH 3T26A 3TH2H 1TBRH 4A1VA 2AMQA 1ZSLA 3ZYDA 1BB0B 1V2ST 2P94A 3BTGE 1DM4B 1GJCB 3RXSA 3LU9B 1OP8A 3BTFE 4BAHB 1E0FD 1AMHA 3CS0A 3BEIB 3F9HA 4NWKA 2QXIA 1NU9A 1SG8B 2TGPZ 4A1TA 3S7HB 2ZU5A 2ZU1A 1CA8B 4MNXA 1NFUA 2VVVA 2ZFSA 3K2UA 1O39A 2Y82A 2BB4A 1YLDA 2ZDLA 1SGPE 3NWUA 6GCHF 4CR5A 2HWLB 4YTAA 1AZ8A 1UVSH 5ETXA 1L1GA 1G37A 3LT3A 2QY0B 3NUMA 1EUFA 4K5ZA 3KIDU 2Z3CA 3LGYA 1XVMA 2QC2A 1CVWH 1SGFA 5JPMH 4BOHA 1V2LT 1JIMA 1OP0A 1KSNA 3T2NA 3V7TA 1HDTH 4YESB 2AERH 1HAZB 3F6UH 1LQDB 2AGGX 2BVSH 4FUDA 1RRKA 1UCYH 3B9FH 1NFXA 1P2NA 1FLEE 2AS9A 1TNIA 2QA9E 1J9CH 1IQHA 1L1NA 1MU8B 2W3IA 1N1LA 4NIVA 1ESTA 1V2RT 1ANDA 1GBJA 2CGAA 1OWHA 4TY7A 5ESTE 3FP6E 1ZZZA 2EA3A 4ISLA 1ZYOA 1MTVA 2A45B 2ZKSA 4DW2U 4WH8A 3UQOA 1HAVA 3HGNA 2W5EA 4X8SH 3U1JB 1A1RA 1XUJA 1GI6A 3VB6A 1P11E 1O2GH 1GJ9B 2EC9H 1EZQA 1KDQB 3BG4B 3KN2A 2Q6FA 1O3MA 5C1YA 1D4PB 2GDEH 5DK1A 1Y3VA 3RLWH 1HAYB 2CF9H 1MMJN 1LPKB 2A31A 5EW1H 1TRNA 4AB9A 1HPGA 1FXYA 3BTME 4CRAA 4JZEH 1QRXA 1ZOMA 4NFFA 2J92A 4ZUHA 4BAQB 1S6FA 2GZ9A 1S5SA 1W7XH 1MTWA 2BDCA 3QTOH 4Z0KA 1TONA 4JMYA 1V2JT 1AHTH 1QTFA 1SHHB 1IQGA 3CP7A 1O2LA 1O33A 3SNCA 4YOJA 8GCHF 2ZPRA 1ETTH 7GCHG 1AB9C 4VGCB 1C5VA 2F83A 2BD2A 2SGQE 3A88A 4WXIA 2GV6A 1O5EH 2ZIQH 2SGFE 2GCTB 1IQMA 1P9SA 3SGQE 1ABJH 1KXDA 1TALA 2ZU4A 5IDKA 2BY8X 2A5IA 2FOHA 4AN7A 5FXLA 4CBOA 1GI7B 3URDA 3A7YA 5F8ZA 1UVPA 1E34B 4TWWA 4H42U 1KXCA 1MKXK 4AFQA 1BMLA 2V0BA 4B1TA 2XCFA 1O5BB 2AH4X 3A8DA 1KTSB 2XW9A 1HIAB 5C1UA 3M3TA 1AI8H 2ZDNA 3GCHB 4BTUB 1LVYA 1J16A 1CGJE 3QZRA 3EE0B 3ITIA 3SO3A 3MH4A 3KGPA 2UUJB 5T6DA 2B5TB 4U2WA 3ZVBA 4CHAC 5FPYA 3EQ0H 4B71A 1KLIH 1GMCF 4FU9A 1Q31A 2OLGA 1A0HB 1LPZB 3GYMA 2CV3A 1G2MA 1VITF 3RM0H 4CBNA 3PLBA 1VGCB 3MO9A 1GGDC 2BD8A 1N8OB 1PPFE 4O3UA 1W13U 2GZ8A 3KQBA 3ODDA 4FUBA 5FX5A 1O3NA 4GVUA 1TBZH 1QA7A 1O2QA 4ASHA 2PKSB 1MQ5A 3RXFA 1W3CA 1RJXB 4MPWA 1DT2A 3GOVB 2ZFRH 4ABAA 2FOGA 5DP3A 4XE4A 1G2LA 1GJ4H 1C1WH 1PPGE 2FOCA 2QF0A 2ZA5A 4DJZB 4E06H 5I46H 9LPRA 1ACBE 2R9PA 4B75A 4YT6H 1UJ1A 4IW4E 1KDQA 1BHXB 2ZNKH 1GL1A 1UHBB 1Y3WA 3A82A 4WMFA 1Z71A 3AW0A 3MHWU 1NRRH 4IN1A 1KXFA 3LGUA 4IC5A 4K8BA 2XBYA 1T8MA 4K1SA 1HXEH 4DOQA 3BSQA 1RTLA 3A7WA 1GVZA 3LDXH 4GCHG 3PV4A 1ELVA 1O38A 1UCYK 1MCTA 2XWAA 5F8XA 3QWCH 5GCHF 3BTKE 1SGIB 1BTZA 3SUGA 2EI6A 3FANA 2H5CA 1O5AB 1WV7H 1TB6H 4FUEA 5FBEA 3TNSA 1C2EA 3QN7A 1CT0E 4U01A 1H9HE 5FHTA 2ODYB 2ZG0H 3ZZ7A 4UDWH 3FFGA 4CRCA 5C67A 5HYOA 4FUJA 4JK5A 4FUIA 2OUAA 1PYTD 2Y5GA 1TA6A 2QYIA 2VH0A 3SQHE 5HM2A 3S9AA 1W14U 5AHGH 4I7YH 3MFJA 4AZ2B 3OYPA 3P70B 2JH0D 2FLBH 1G30B 3RXIA 5H4IB 3SJ8A 2STAE 4JCNA 1C5MD 1ELDE 3RXLA 1XKAC 1TPAE 1IQJA 1MZDA 3ZZ5A 2VIDA 1TMTH 3U8RH 4B76A 1L4DA 4O9VA 2BQ7B 3GY7A 2ZFFH 1D3QB 3NPSA 4XFQA 1YCPH 4GPGA 2FX4A 1LTOA 1P0SH 1WUNH 1C5YB 1CQQA 1FJSA 3KHVA 1C1MA 2FPZA 3RXQA 3DHKH 2A0QB 3RU4E 3UR9A 3UR6A 5CHAC 3SI4H 3A8AA 4K1EA 3LH1A 1FQ3A 3BTQE 1TQ7B 3GISB 3RXDA 1TGNA 1P04A 2K1QA 3GDUA 1O2PA 4KP0A 3QX5H 1V2PT 2BD5A 2VIQA 3E16B 5DJ7A 1YPEH 1O37A 1ELGA 2UUFB 3ATMA 2ZF0H