7LPRA

Structural basis for broad specificity in alpha-lytic protease mutants
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for broad specificity in alpha-lytic protease mutants.
pubmed doi rcsb
molecule keywords ALPHA-LYTIC PROTEASE
molecule tags Hydrolase/hydrolase inhibitor
source organism Lysobacter enzymogenes
total genus 53
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1991-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 7lprA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 7lprA01
2P94A 2FOMB 3OTJE 3BG4B 2KAIA 5FX6A 1HIAB 4BAQB 9ESTA 2ZFSA 1GI8B 2Y5GA 1O37A 1U6QA 4AFQA 2HVXA 2B9LA 1CGHA 1E34B 1GI5A 2YNBA 1C5NH 3C27B 3A7YA 2QXJA 2Y5HA 1S6FA 3ZVBA 1S82A 4D9QA 4HTCH 3SU2A 1BHXF 4F49A 3RXEA 1ELBA 1YCPK 4XBDA 1D4PB 1AO5A 1P2IA 4O03A 4WH8A 1VITF 1YPJH 4IC5A 2WUBA 3M7QA 4AZ2B 3JZ2B 1GCDA 3PLBA 3EYDA 5AFZH 5DP4A 3TH2H 3U8RH 1C2HA 1DWBH 1RGQA 1CGIE 1LHCH 1L4ZA 1AVGH 1M9UA 3TJUA 3PLKA 3A7XA 4IMZA 2FMJA 1UK3A 1J14A 1T8MA 1EAWA 4GCHG 2ZDLA 1GCTC 1SHYA 2ZQ1A 1NRNH 1AY6H 5K0HA 4D7FA 1C1MA 1G2LA 1MTSA 1ELAA 2ZEBA 4A6LA 1MZAA 2RA3A 4B75A 1QBVH 1YLCA 4ISNA 2AMPA 1TONA 2A1DB 2JKHA 1HDTH 4NZLA 1D9IA 4INKA 1GVKB 2QGRA 1GBMA 3P8GA 1LVMA 4TWYA 4DT7B 3AW1A 1YPHE 1WTGH 3SORA 3SW2B 1DY8A 1Y5BT 2XYAA 2GT8A 2GKVE 2CXVA 1TALA 3BTWE 2VWLA 2ZHEH 2XC5A 1TWXB 2HWLB 2FI5E 2W5EA 3ZYEA 3RXDA 1QL7A 3PO1C 3ODFA 4Q7XA 1K1IA 1XX9A 2A7HA 3SJ9A 4YLUA 1O2IA 2O8WA 4U01A 2PGBB 3RU4E 1LPGB 1BQYA 1DOJA 3GY8A 3AVZA 3RU4T 3SI3H 2A0QB 1YCPH 3QK1A 4KGAA 5EQSA 1Y3UA 2P59A 1TX7A 2WV5A 2BX4A 1DANH 3ITIA 4NG9H 5EW2H 1BTZA 2UWOA 4Q2KA 1EB2A 4E7RG 2HPPH 4K1EA 2Y81A 3SUEA 2WYGA 2HNTE 1JIRA 1BRAA 4K2YA 2FS9A 3GISB 1IQKA 4ZXXH 1ESAA 3ZZ4A 2F9PA 1FMGA 1XUKA 2WPHS 5LPFA 2VINA 5DP6A 1KXDA 1C1PA 1V2VT 1FN6A 3Q3YA 4ABEA 3F68H 1GPZA 4WWYA 3TH4H 2BVXH 4B74A 1ABJH 4X6OA 4I7YH 1VITH 1QY6A 4XBCA 1CA0B 1O5GH 1DE7H 1V2LT 2OBOA 5A8ZA 1BHXB 1VITG 2GDDA 2ZF0H 4CHAB 3OSYA 1BRBE 1XUHA 4MG3A 2JETC 2C8ZB 3P6ZB 1Z8IB 2FLBH 4B2BA 1PQ8A 1OOKB 2IN2A 2VNTA 1O2UA 2TGDA 2BY6X 5EQRA 4UONA 1C1TA 3KQEA 3PMHB 1QJ1B 1CHGA 4D7GA 1HJAC 4WH6A 5EPNA 4NIXA 2CN0H 1EUFA 3GCOA 1YCPM 3GDSA 1AKSA 2D26C 3QZRA 1G3DA 1SLXB 1RXPA 4DG4A 3DHKH 4OS2A 1TLDA 2ZIQH 1P2NA 1DUAA 1V3XA 5LH8A 1O31A 1F5LA 2OUAA 5JBBS 3K65B 3KQBA 4CRAA 1A61H 1O33A 2K1QA 5FCRA 1BCUH 1Y3WA 3TH3H 4AGKA 5A09A 1IQIA 1DLEA 2FOAA 1NTPA 2O8TA 4IBLH 4UE7H 1C4U2 1AQ7A 1EPTA 2FZZA 1F7ZA 3A7ZA 2XNIA 3URDA 3G01A 1E38B 3MMGA 3BG4C 3B23B 3PV4A 3UOPA 4YT6H 1C5QA 1GMHF 3QGNB 1QURH 1C5MD 3ATWA 1OYTH 3E16B 3H5CB 4H4FA 1LTOA 5EQQA 2BB4A 1GJBB 2H2ZA 1VGCC 1LQEA 4B2CA 4MPUA 1Y5AT 2Z6BD 3U9AH 1AGJA 1CHOF 2PKSC 1LHFH 2P3FH 3KF2A 3TVJB 2VJ1A 3AAVA 1C2FA 3I77A 1KLIH 3MU5A 2QYIA 5C20A 4DOQA 1D3DB 1WV7H 1K1JA 1UCYE 2G00A 3ZZ8A 2PLXA 3RXCA 3U1IB 1OP8A 1GGDB 3E3TA 3O8BA 2FX4A 3DD2H 3GY4A 4GPGA 1A5GH 2WPIS 4DW2U 4A7IB 3SI4H 4KKDA 1H8DH 2SGDE 5TJXA 1A0HB 3SN8A 3I29A 3QTOH 3P8FA 3UNSA 1ARBA 1P3EA 1DS2E 2ZFFH 5CHAC 1O3EA 4AOQA 2ZKSA 3FVFB 3M3TA 1HFDA 2XRCA 2VVUA 1GBKA 2QIQA 1F2SE 3SHAH 3M5MA 3R0FA 1L4DA 1OS8A 1EP5A 1NT1A 1ELVA 5C5OA 3U1JB 3SV8A 2ZTYA 3P70B 1KXAA 1PYTC 1TGNA 1O2KA 5FXLA 5G4BA 3BTHE 1AUTC 1MTUA 5HM9A 3A88A 3MH5A 2H1UA 1AFQC 1CT4E 3RXKA 3EE0B 2VIDA 1RRKA 1BOQA 2VH6A 1BTUA 1MUEB 2A5KA 1V6DA 5F8TA 1ZRKA 2TPIZ 2G51A 4KP0A 4NFFA 1C2GA 3KQCA 2GT7A 1GI3A 2FOBA 2GGVB 3KN2A 3RXUA 1UTOA 3A87A 3E8LA 1AE5A 1D6RA 1GMHG 4AFUA 1TRNA 1HCGA 1MMJN 4OS1A 3L6PA 2ZGBH 4KTCA 1NFYA 4IGDA 4WY3A 3K6YA 4DCDA 1DWCH 1MKWH 5CMXH 1SL3A 1TABE 4Y8YA 2NU2E 1CHOG 1V2NT 5GIBA 3TGJE 3NK8A 4FVBA 1J8AA 1ZTJA 1CA0C 2G4TA 3LOXA 4DGJA 1NROH 1ACBE 4CHAC 4BXWA 1IQEA 4Y76A 3SQEE 3TK9A 1SGFA 8GCHG 1YPMH 4TY7A 4CR5A 1O2LA 1KY9A 1A4WH 2G55A 1KXBA 1AU8A 1O5BB 1W2KH 4ABDA 1BMNH 1SGQE 1P05A 2CJIA 2PUXB 1SGNE 2AGEX 5EPYA 1O3PB 1YC0A 2VIVA 1QFKH 2EI6A 2Y7ZA 4Y8XA 1BT7A 3KQDA 4AG1A 1TGSZ 3MHWU 1O30A 2BD2A 4NIVA 3TNTA 1CBWB 5K7RA 2J94A 4HFPB 1L1NA 4DY7B 2XBYA 2VB0A 1Z8RA 3BTFE 2A7CA 2QXGA 3T26A 3V12A 2OC0A 1FIWA 1A5IA 3LJOA 2BDIA 1V2MT 2PTNA 3T27A 1P9SA 1P2QA 2AMDA 2VVCA 2XBVA 5T6DA 5JBCS 1THSH 2Y80A 2FEQH 3RLWH 4QT8C 3RM2H 3ZVDA 1ZGIA 5AHGH 3TPIZ 1Z8JB 5EW1H 1O2OA 2ZPRA 3STIA 1FI8A 1O2QA 1ETSH 1GCTB 2BDGA 1P11E 2VH0A 3BEFB 3IWMA 4ABIA 2BD4A 2WUCA 3KIDU 3S0NA 1TBZH 1EJMA 1BBRH 4YOGA 3S9CA 3QGJA 5DG6A 2CF9H 1NO9H 1TA2A 1XXFA 3RC6A 1RTKA 1SMFE 1F5KU 2BY7X 4ABGA 1C5VA 4FUCA 5HMAA 2W7SA 1GHBF 2UUYA 4NA8A 2ZO3H 4CRGA 3DFJA 3O8DA 5A2MH 1IHTH 1MBQA 5L2YH 1Y3XA 1UHBA 3CENA 5BPEA 1G3BA 4ABAA 2BZAA 1GJDB 6CHAB 5J4SA 2ZECA 3E6PH 1F5RA 2ZPQA 3M35A 1HNEE 5L2ZH 1X7AC 1C5PA 6GCHF 2BDCA 1IQMA 1ETRH 4X2XA 1TE0A 1GHAF 1DPOA 1Y5UT 2B8OH 1EJNA 1IQFA 1RS0A 3E0NB 5E0JA 2ZU5A 2LPRA 1HB0B 1FY8E 3QDZB 2AGGX 3SV7A 4ABHA 3TU7H 1ESBA 5DP7A 1DVAH 1GBIA 3OY6U 2AIPA 2Q6GA 1FY5A 1GGDC 2OQ5A 3UNQA 4FU9A 1JBUH 1S6HA 1EAUA 4O97A 1EKBB 1O32A 1K1PA 1C5OH 1K9OE 1EPTC 3LC5A 1KYNA 4B71A 1UTMA 2XWAA 1T4VH 1SQOA 1LPKB 5HXFA 3VB4A 1MZDA 5GCHF 1BIOA 2RA0A 1LHGH 1S84A 4ZHLU 3P92A 1HJ9A 2XWBI 1QJ6B 2GCTB 4ZHAA 3RXGA 1VCWA 3CS0A 4OS6A 4X6NA 2FOHA 4E05H 2JETB 2JH0D 2W3KA 1C5RA 2FWWA 2H5DA 2WINI 3DT0H 3F9HA 4JZ1A 3F9GA 1SPJA 4ASHA 1IHSH 4DIIH 2Z3CA 3SJ8A 3ZZAA 4BAOB 3BN9A 1DWEH 2GMTC 2YOLA 1MH0A 2AH4X 3RC4A 1GMDF 3A89A 1HJAB 3T29A 2EC9H 4KTSA 1LCYA 1ZTKA 3UY9A 4GVUA 3T25A 3UTUH 2R2WU 2V3OH 2PW8H 1NFUA 2DUCA 1TRYA 2OCVB 5LPEA 1O2HA 4MTBA 1GHBG 1NESE 2G5VA 5A0CA 3HKJB 3B9FH 1TYNA 2THFB 1AN1E 4FUGA 1MAYA 1GI6A 4AG2A 5JPMH 4JMYA 1GMCF 3MFJA 2Z9IA 3MNCA 2IJOB 5AF9H 2D8WA 4NSVA 2FTLE 2HOBA 4GHQA 1XKAC 2GZ8A 4GLYA 4THNH 4A1XA 2FYRA 1WCZA 1OSSA 1O2SA 1SOTA 1YPHC 2W26A 1HAHH 5C3NA 1TPSA 1Z71A 1LPZB 3O8RA 1GJ7B 1YPEH 1O2RA 1IQNA 4LK4A 4X6MA 3SQHE 2ESTE 3GDUA 2NU0E 5JBTA 1P9UA 1YGCH 5FPTA 1HRTH 4H6TA 2C3SA 1O3HA 3EGKH 5F8ZA 1ANCA 1DDJA 1O5DH 3LKWA 4INHA 1VGCB 1ELGA 3E91A 3LT3A 4AN7A 1V2ST 4MVNA 2BLOA 3T5FH 3O8CA 2GD4B 4Y71A 5TCAA 1OWKA 1F92A 5GCHG 2FOFA 1CBWC 2PKSB 4NA7A 1S0RA 1TQ7B 1OWEA 4ESTE 2FIRH 1T32A 4MLFB 1OWIA 4BAKB 2HNTC 3STJA 5LPRA 2NU1E 2ZTXA 3ATLA 4GAWA 2PKAB 2BLVA 1DSTA 1GI4A 3MNXA 1ZSKA 1PFXC 3FP8E 5DPAA 3MO6A 1NU9A 1Y3YA 4X1QU 1SGRE 1EJAA 1AD8H 2BHGA 5FAHA 1O2VA 2J2UA 2R9PA 1HAPH 4ZKOU 2KAIB 2WPMS 1BRCE 5JBAS 2HLCA 1BMMH 2Z3DA 1BTHH 4IC6A 3FZDA 5CHAB 1GBEA 4Q80A 1HAGE 1GBTA 1C9TA 1CSOE 1UVTH 4R0IA 3TK6A 3UQVA 1UVUH 2ZDKA 4K69A 3IITA 2J38A 2JH5D 4LXBH 1ZRBA 1C4V2 3SNEA 3LGYA 2J34A 1TMBH 1FUJA 2G4UA 3A84A 1TBRH 3QWCH 6CHAC 1KSNA 2H9EH 4YOJA 1KLTA 1QRZA 3S7KB 1TQ0B 4KELA 1ZJKA 3RXJA 1A1RA 1ABIH 5EGMA 3LGWA 2Z9KA 2BDAA 3SJKA 3Q3XA 1AFQB 4ZMAH 1HYLA 4XE4A 1GBHA 1SB1H 4YTAA 5FHTA 3MH6A 1ZPZA 1VCQA 1A7SA 1K1OA 1CQQA 1IAUA 3EAJA 3LGTA 4AORA 2SNVA 1GWAA 2F3CE 1EASA 2BYAX 3ZZDA 3HKIB 2BD5A 1CVWH 1Z6JH 2FOGA 2ZDNA 3TIUA 1V2PT 1G30B 2ASUB 1GBFA 4FU7A 4Y7BA 1JRSA 2QAAA 2OXSA 5EU8A 2BQWB 1KTTB 3HATH 2OBQA 3F9EA 1G9IE 5C2ZA 3SV2H 2TGAA 1GDQA 1UTPA 2W3IA 1GJCB 1V2KT 1EZSC 2BD3A 3M3SA 4CREA 1BDAA 1P01A 2CHAB 2GCTC 1O34A 3MTYA 3GY7A 4WJG2 2BOHB 1AHTH 1Q31A 3BIVH 2BDBA 4Y0YE 5EG4A 4BXSA 1TMUH 1BMAA 3ATKA 1O5FH 2ZGXH 1JXPA 1Z7KA 1VJAU 3RXSA 2AERH 3RXHA 1SLUB 1RIWB 4UFDH 3RXPA 4DJZB 3OX7U 1UJ1A 3VB6A 1TMTH 1TNKA 1WBGB 4D8NA 1C1QA 3TK5A 1AIXH 1HXEH 1WYKA 2GZ7A 3Q76A 4B76A 1BTXA 1PPBH 3NUMA 1F0UA 2CF8H 3AAUA 1TBQH 3SNCA 1P57B 1DITH 1ID5H 4ZH8A 5HM2A 1ELDE 1HAVA 1PQ7A 3OU0A 2VIQA 1GJ4H 1EX3A 2PFEA 1BBRE 2ZDMA 1H4WA 4F4OC 4PROA 3SU3A 1FPCH 1C5SA 4U32A 1A5HA 3A8CA 4D76A 1E36B 4IN1A 4IMQA 1K21H 3SZNA 2DE8A 1PPHE 1BJUA 3M61U 2A4GA 4RSPA 2BY9X 1IQHA 4RKJB 1TNGA 3PMJA 3KGPA 4CRDA 3L3TA 1N6XA 1A0JA 1TNLA 1D3TB 1NU7B 3MNSA 4FUDA 3ZZ5A 2WPJS 1SC8U 1NRSH 1T31A 2SFAA 1HJ8A 1TX6A 2QXHA 4I31A 1KDQA 5EXMA 3SU5A 1O2XA 1XUFA 1ZHPA 3V13A 2GTBA 1CT2E 2Z9GA 2ZU4A 1JMOH 5JB8S 4MPXA 3TNSA 2Q1JA 1CO7E 1GBJA 3AW0A 2XW9A 2Z94A 1EZUC 1B7XB 3R3GB 2QXIA 1O3DA 2GP9B 1GJAB 1ZHRA 3S7HB 1NY22 4K3JA 1ZLRA 1AWFH 1AKSB 4BNRA 7KMEH 1TPAE 1TNIA 2ANMH 3ZVFA 1GJ9B 1GJ6A 1ARCA 1LDTT 1F0SA 4I8GA 5FBEA 1O2WA 1W0YH 4YT7H 3A81A 2AGIX 1O2ZA 1J16A 2ODPA 1JRTA 4AYVB 1O35A 3S9BA 1G3EA 5H4IB 1TGBA 2P93A 1O3LA 4XOJA 2UWPA 1ETTH 4YM9A 1S0QA 1MTWA 3BV9B 1O2YA 4LZ4B 4BAMB 4CBOA 1MKXK 1C2EA 4TY6A 2BOKA 2BDYA 1BA8B 1H9HE 1GJ5H 2BTCE 1ANDA 1FDPA 1C1SA 3EDXB 3H7TA 1EPTB 3NPSA 2SGEE 1Q3XA 1LKAA 3PMAB 4DVAU 2NU4E 1Z6EA 3AASA 1GDUA 1FPHH 1LO6A 1DICA 1WQSA 1OWDA 2C90B 3V0XA 2HNTF 1MBMA 2V3HH 2G81E 1CE5A 3M37A 3HK3B 1V2UT 2P16A 4Z0KA 2J95A 1GI9B 1AVWA 3GYLB 4IN2A 5DK1A 2QA9E 2ZU3A 1UTKA 2Q6FA 2ZG0H 2ZHFH 3BTME 1GBLA 4AFSA 1W7GH 2ALPA 1TFXA 4K8YA 3SGBE 1O5EH 1OXGA 2TIOA 1UK2A 1AB9C 4A1VA 2GMTB 3UR9A 4VGCB 1NPMA 1B0EA 1QQUA 1H1BA 2QV1A 5GJ4B 1KXEA 3D23A 1BUIA 1ANEA 1FY4A 2VWMA 1HXFH 2XCNA 3IG6B 1TIOA 2C8XB 4YO9A 1ZPBA 1YKTA 1LMWB 1FZZA 3ZZ7A 3GY6A 4ZKSU 3MU8A 1B0FA 1OP0A 1GI2A 2A2QH 3LPRA 2Z9LA 4BAHB 1L1GA 5GPIB 3GCHC 2FESH 4ABJA 4ZUHA 1C4Y2 4WMFA 1QRXA 3U8TH 4BTUB 3S9AA 3PYHA 5FCKA 3UIRA 2Y6TA 2A4QA 1C1OA 1FIZA 1B5GH 3HGNA 7ESTE 1FAXA 5C5NA 8KME2 2HGTH 3ZVGA 1XM1A 1O36A 5JYIA 3FFGA 1A3BH 3LGIA 3TGIE 4X2YA 1T7CA 4UFGH 2CHAC 1THPB 2I6QA 3UQOA 1GL0E 1IQJA 1C1WH 2ZU1A 1J9CH 3FP6E 1SGDE 2RG3A 3FP7E 4LOYH 4MDSA 1GVLA 5EODA 3SU0A 1ZTLA 2D2DA 1RIWC 1F0TA 3A80A 3ENSB 1KIGH 2Y5FA 3LGUA 1NRRH 1SGIB 2OQUA 4RKOB 4UDWH 7GCHF 3KL6A 1O3JA 1MTVA 4CH8B 3BTKE 3A8BA 2GCHF 1GBBA 3A83A 1BTWA 3ZV8A 1UVSH 2F9UA 3LIWA 2FTMA 3GY5A 1NRQH 4UFFH 4X6PA 3SJOA 2AYWA 5FX5A 1PQAA 1CGJE 2A5AA 1V2JT 2R0LA 2V6NA 2H5CA 1BZXE 1ZMNA 2ZHWH 1UVPA 3UOUA 2UUJB 2ZFQH 5FBIA 1EAIA 2A2XH 1QL8A 2CGAA 4DIHH 1ZJDA 5DP9A 1P10A 2ZCLP 2Z9JA 2OC7A 4GHTA 4AGJA 1LHDH 2PUQH 2SNWA 1ESTA 3GCTF 4NA9H 1N1LA 2ZPSA 4ZROA 2WPLS 4MNXA 4X1RU 3MOCA 2GDEH 2UUKB 1UTNA 2F9NA 5HGGA 2OC8A 4ISLA 3ZVAA 3SV9A 3B8JA 4K1TA 4O9VA 2R2MB 1G36A 1TX8A 2M5TA 4XDEA 2BX3A 2O8LA 1GHZA 1WUNH 4LZ1H 4MPVA 2BY8X 1O5CB 3VGCB 1ZGVA 2SGFE 4JCNA 2VVVA 4OGYA 3NCLA 1O38A 2ODQA 2ZU2A 5DP8A 4X0WU 1BTPA 1QHRB 1GL1A 1PYTD 1W10U 3P95A 1AFEH 5F8XA 1UCYK 3ZYDA 1C5LH 5C1XA 1TB6H 1A0LA 1W3CA 3MU0A 2ILNA 3SJIA 1MD7A 1HBTH 4OS4A 5ESTE 5E2OA 1Y59T 3GOVB 1P02A 3MU4A 4MNWA 4CRFA 4B2AA 1MCTA 1VJ9U 4OGXA 1SFQB 2G5NA 1T4UH 1BMLA 3V3MA 1EATA 3GYMA 3I78A 3SV6A 2TRMA 2FODA 3ZVCA 1NM6A 1YBWA 3E90B 1SGPE 7GCHG 3DA9B 1D3QB 4MQAA 2J4IA 1P3CA 1TAWA 2SGAA 2SGQE 1MQ5A 3BEIB 4UEHH 3H7OA 1WOFA 2GZ9A 2OP9A 3LC3A 1C5XB 2WV4A 3SO3A 1PPEE 3QN7A 2C4FH 2UWLA 3KHVA 1O5AB 1D3PB 1FJSA 2XC4A 3UWJH 1UHBB 1WAYB 1AMHA 3JZ1B 4AFZA 5E2PA 3VB7A 4H42U 1RD3B 3ATMA 2A4RA 1EOJA 2P95A 1MQ6A 3FZZA 1Z1IA 2XBWA 2NU3E 3PWCA 1DXPA 2IOTA 3GCTG 3U8OH 3U98H 2ZGCA 1D6WA 4KTUA 4NCYA 5C1UA 3EQ0H 3F6UH 3RLYH 2C93B 1UCYH 1EOLA 1FNIA 4I32A 1CA8B 1MU8B 4VGCC 5C1YA 3MU1A 3PROA 4X8SH 4U30A 1H8IH 1SGTA 2PWXA 1UVOA 1RJXB 2HALA 2A7JA 1H9LB 1V2OT 3BEUA 4INLA 1HAXB 4YOIA 2XTTB 3QZQA 2G8TA 1MD8A 4GCHF 1P03A 1UTJA 3RXFA 2AEIH 4BTIB 1HIAA 1QR3E 1RTFB 1C5WB 1C9PA 1QRWA 6ESTA 4O3UA 1NZQH 5ABWA 2C8WB 4NFEA 1ELCA 1PQ5A 3UFAA 3RXLA 1EAXA 1KXCA 2EI7A 2I6SA 1O3FA 5DKMA 1MCVA 3LDXH 3A86A 1K28D 2V0BA 3M5NA 4JZDH 1GI0A 6GCHG 1GHAG 1GHXH 2PSXA 3SBKA 3CP7A 4NSYA 1NFWA 1N8OB 1GI1A 3BTQE 4BTTB 1S85A 1TOMH 1AUJA 5HYOA 2VGCC 2OLGA 2F9BH 3CS7A 1SR5C 4WMDA 2BVRH 3D62A 1P2JA 4X2WA 1ZMJA 1F0RA 3UUZA 5I25A 4DURA 5L6NH 1XUJA 3FAOA 1BITA 3NZIA 3ESTA 1GI7B 3HGPA 4TPYA 4A1TA 4AX9H 3TGKE 1QB9A 2FI4E 3UREA 4FUBA 1NN6A 5EXNA 3VFEA 1O3GA 2BD9A 1V2TT 2BQ6B 3RXVA 3UWIA 9LPRA 3NKKA 1GHYH 1EQ9A 1O3KA 1P04A 4A5TS 1UMAH 2H9HA 1YPLH 4R8TB 3MYWA 1XVMA 3K9XB 4JYUH 2Q6DA 3QUMP 2ZFTA 1W7XH 5F6MA 2FS8A 1P2KA 4Y7AA 3RUOA 1GMDG 1ELFA 1HAOH 4M7GA 3SHCH 1PPCE 3D49H 3TJVA 2ZNKH 1ELTA 2OINA 3UPEA 4FVDA 3VGCC 5I46H 1EB1H 1VZQH 1DM4B 2FLRH 4ZKRU 3RM0H 1P12E 2FYQA 3MWIU 1SHHB 1AWHB 3T62A 3RXQA 4RN6A 5JB9S 1GMCG 1ZHMA 3SGAE 2ALVA 2FPZA 4E7NA 5A8YA 4WMEA 5IDKA 1AB9B 3A82A 1O3BA 3SNAA 1TGCA 2RDLA 2QN5T 4NWLA 5E0HA 2GVFA 5C67A 1XKBC 4HI3A 5GWZA 8ESTE 1QCPA 1V2WT 1P0SH 4FUFA 4OS7A 2BMGB 4ABFA 1LVOA 1O2MA 4AYYB 3ELAH 1VR1H 3GCHB 3SOSA 4ISOA 3F9FA 5CE1A 1BTYA 2CMYA 5F03A 3ZZBA 3RXAA 2A45B 4K8BA 1V2RT 4YLQH 2AFQB 2ANWA 1UTLM 4OS5A 1RFNA 3SUGA 1T8OA 2QF0A 1C2LA 1HV7A 1GBAA 2QC2A 3EA7A 4O3TA 3SU6A 4X8VH 4CBNA 4Y6DA 2ZFPH 3BSQA 3RP2A 3SU1A 4HGCA 4ISIH 2V35A 4K60A 1C1VH 1ZOMA 4TYDA 3KNXA 1WU1A 1P09A 3W95A 1GHWH 4JZFH 1SI5H 1Q2WA 2ZI2H 1UK4A 3ZZ9A 3NWUA 4AB9A 3SGQE 4H6SB 3RU4D 3M7TA 1AZ8A 5DJ7A 2AIQA 3F1SB 2QCYA 2FP7B 3MH7A 1AI8H 2GV6A 4GUXA 1K22H 5DP3A 2BZ6H 1BRUP 3Q00A 4SGBE 3RXIA 1C5ZB 1L1JA 2P8OC 4TPIZ 1SG8B 1O3NA 3RXOA 1PJPA 2FI3E 2BLQA 4AB8A 1GHVH 2HRVA 3S69A 8LPRA 4CRCA 4ZHMU 1EP6A 3PMBB 1THRH 1ZYOA 4K5ZA 1QB6A 5JDUB 2ZWLH 5EXLA 1ZSJA 1YLDA 1ZMLA 3PB1E 1P8VC 1G3CA 2FM2A 4MNVA 1C5YB 2XCFA 3ODDA 3LONA 2ZQ2A 2XC0A 2ULLA 3C1KA 3ZVEA 1GBDA 4I33A 3RXMA 1FN8A 3PWBA 1G32B 1OP2A 4YESB 1SQAA 3ZV9A 1N8OC 1NC6A 1S83A 1OWJA 2RCEA 1G37A 3LGVA 3SUDA 1QTFA 2JH6D 2Z3EA 2R0KA 2O9QA 4XBBA 1ANBA 1NS3A 3SNDA 4ZKNU 4K1SA 3VB3A 1C2MA 2BM2A 3A8DA 1HAVB 4X8TH 2ODYB 3VPKA 1TA6A 2A31A 4FUIA 1DLKB 1O2JA 3LH3A 1W0ZU 2XXLA 1A2CH 2ZCKP 4ISHH 1ZZZA 2F9OA 2ZFRH 1C5TA 3RXRA 1LQDB 2ZHDA 3BTEE 3BTDE 1SVPA 4Q7ZA 1TPOA 2BD7A 3GY3A 4JK5A 3OY5U 2A4OA 1YP9A 1LVYA 4FU8A 4TWWA 1TNHA 1FY1A 4NIYA 1SGCA 5GXPA 1C1NA 1V2QT 1KDQB 2IPHA 3M36A 2FDAA 5AVDA 4CRBA 4J2YB 1O2GH 4X1PU 8GCHF 3VXFH 1LHEH 3M5LA 1QBOA 1AVXA 3QX5H 3A7VA 3A7TA 4BOHA 2QY0B 4X2VA 5A0AE 1SLWB 1KLJH 1MKWK 1GG6B 3TJNA 1GBCA 1LKBA 1XMNB 4ZAEA 3A8AA 1K2I1 1HAZB 1O2PA 1TRMA 1Z8GA 2P3TB 2Y82A 1MU6B 2VWOA 1AE8H 1O2TA 5B6OA 5PTPA 1C2IA 1EZQA 1L2EA 2FX6A 2ZGHA 1QGFA 1S81A 5SGAE 1O3OA 1RTLA 2PSYA 1CU1A 4B1TA 1IQGA 2H9TH 1DFPA 3GCNA 3A7WA 1KXFA 3PTBA 3NXPA 3U69H 3RXTA 4Y11E 1MAXA 2B0FA 3UNRA 3E1XB 1BB0B 2GV7A 3SNBA 5DP5A 3FANA 3K6ZA 4HZHA 2F83A 1O3AA 4UD9H 3ZZ6A 1MTNB 1Y8TA 1L0ZA 1QA7A 3PM3A 3MI4A 1NRPH 1P2OA 2FOEA 2Z7FE 4YZUA 2ZTZA 4IS5A 1SSXA 2ZA5A 1MKXH 2ZDVH 1FV9A 2BVSH 1OYQA 5ESBA 3M3VA 1W8BH 1UTQA 2J9NA 2EA3A 4A92A 2AS9A 1W14U 1XXDA 2HPQH 4Y8ZA 1J15A 4E06H 3DUXH 2XBXA 4D9RA 5FPYA 2BXTH 2VIPA 2PHBA 1XVOA 2D1JA 3BG8A 2ZDAH 3TITA 3ZZ3A 4WXIA 1O3IA 5FPSA 3QLPH 2B7DH 4CR9A 3GDVA 1E37B 2VGCB 2ZC9H 3KEEA 2C8YB 3UR6A 1UO6A 3W94A 1O2NA 4FXGH 1BBRK 1W11U 1DX5M 1HGTH 1OKXA 4Y79A 1EZXC 2VU8E 3MO3A 3URCA 2WYJA 1DUEA 1QL9A 3GICB 1GJ8B 4WXVA 2NWNA 3BIUH 3L33A 4GSOA 3BTTE 1XUIA 1QIXB 1O3CA 1WQVH 3P17H 4NZQA 4ABBA 2ZHQH 3N7OA 2F91A 1ORFA 1K1MA 3MO9A 4NWKA 1YYY1 6LPRA 1P06A 1ELEE 2ZGJA 1TNJA 1ZR0A 1SGFG 4WF8A 1DT2A 2VIWA 3T28A 4X1SU 2J92A 2YNAA 3LH1A 1O39A 3HPTB 1C5UA 1SOZA 3QO6A 5DGJA 3BF6H 1DY9A 5DO4H 1BJVA 1PPZA 2STAE 1JOUB 5BRRE 1E35B 2WPKS 3LU9B 2DE9A 3SU4A 2VIOA 1K1LA 3MNBA 1ZPCA 3M7UA 3RXBA 2OC1A 3VB5A 3RMMH 2G52A 3E0PB 4I8JA 5TCCA 3KCGH 1NFXA 1Z1JA 4X8UH 4B73A 1FY3A 2STBE 1P2MA 1HAIH 1GVZA 1YPKH 2EEKA 2SGPE 2A5IA 3Q3KA 2O8UA 1A46H 1QBNA 2BDHA 1LVBA 3QTVH 1AZZA 2BXUH 3T2NA 1KTSB 1HAYB 1QB1A 2CV3A 4MPWA 1T8LA 4U2WA 5A8XA 1JWTA 3HK6B 1HPGA 2B5TB 4IW4E 5E8EH 5J4QA 3V7TA 2BD8A 1C1UH 3PO1B 2TBSA 5T6GA 1IOEA 5AFYH 2GX4A 1OX1A 4Y0ZE 3WY8A 1WTHD 5LGOA 1A3EH 2GCHG 2PR3A 1TPPA 1TGTA 4I8HA 2R3YA 5T6FA 1HLTH 1FQ3A 2LNCA 1YM0A 1YPGH 2PGQB 3RMNH 4NIWA 1JIMA 3RDZA 1QNJA 4ZXYH 2W7UA 4JZIA 3DFLA 2ZCHP 3LJJA 1O3MA 1INCA 2H6MA 2O8MA 5ETXA 1QJ7B 1DSUA 1GG6C 1SGYE 3Q77A 1HUTH 4SGAE 1QQ4A 4JZEH 4J1YA 4FUHA 4XSKU 2PTCE 1EXFA 2TGPZ 3BTGE 4Y10E 3P8OA 4Q7YA 2F9VA 4JYVH 3TLOA 3TJOA 2AMQA 1FONA 1DXWA 1SFIA 1SQTA 1SLVB 1C1RA 1OPHB 2VWNA 4I8LA 1W13U 3PTNA 1VCPA 3MH4A 4XFQA 5IYTA 4MNYA 1E0FD 3RMOH 2BY5X 2P8OB 2BQ7B 1K1NA 1ZSLA 1PPGE 4FUEA 3VXEH 2EI8A 2A32A 1TOCB 4CH2B 1T8NA 4NGAH 4UFEH 1MTNC 2OD3B 2QF3A 1CT0E 1N6YA 4FUJA 1DWDH 1WSSH 5L30H 5EOKA 3ZZCA 3VEQB 3RMLH 2ZP0H 3EA8A 3P8NA 2ANKH 1H9IE 2PV9B 1C2DA 2ANYA 1C2JA 1SBWA 1Y3VA 1YF4A 1G2MA 2ZZUH 3D65E 5E0GA 1QA0A 1S5SA 2FXRA 2R3UA 3EA9A 4JK6A 1FXYA 3K2UA 2UUFB 4JYTA 3RC5A 1C2KA 2TGTA 1SGEE 1W12U 1IQLA 3ATIA 3SUFA 1GDNA 4I8KA 1J17T 3GY2A 5A0BA 4WVPE 5T3HA 7LPRA 2OTVA 2PKAA 5GDSH 2FOCA 4BANB 2FO9A 2BLWA 1OWHA 1FAKH 1FLEE 3A85A 4Z6AH 3PLPA 2P3UB 1PPFE 2Y7XA 1O0DH 4X1NU 3M5OA 1XUGA 3OYPA
chains in the Genus database with same CATH superfamily
2P94A 4HG6A 2FOMB 3OTJE 3BG4B 2KAIA 5FX6A 2QF4A 1HIAB 4BAQB 9ESTA 2ZFSA 3H09A 1GI8B 2Y5GA 1O37A 1U6QA 4AFQA 2HVXA 2B9LA 1CGHA 1E34B 1GI5A 2YNBA 1C5NH 3C27B 3A7YA 2QXJA 2Y5HA 1S6FA 3ZVBA 1S82A 4D9QA 4HTCH 3SU2A 1BHXF 4F49A 3RXEA 1ELBA 1YCPK 4XBDA 1D4PB 3PRDA 1AO5A 1P2IA 4O03A 4WH8A 1VITF 1YPJH 4IC5A 2WUBA 3M7QA 4AZ2B 3JZ2B 1GCDA 3PLBA 3EYDA 3N7EA 5AFZH 5DP4A 3TH2H 3U8RH 1E1RD 1C2HA 1DWBH 2VBCA 1RGQA 1CGIE 1LHCH 1L4ZA 1AVGH 1M9UA 3TJUA 3PLKA 3A7XA 4IMZA 2FMJA 1UK3A 1J14A 1T8MA 1EAWA 4GCHG 2ZDLA 1GCTC 1SHYA 2ZQ1A 3UAIC 1NRNH 1AY6H 5K0HA 4D7FA 1C1MA 1G2LA 1MTSA 1ELAA 2ZEBA 4A6LA 1MZAA 2RA3A 4B75A 1QBVH 1YLCA 4ISNA 2OK5A 2AMPA 1TONA 2A1DB 2JKHA 3MQKC 1HDTH 4NZLA 1D9IA 4INKA 1GVKB 2QGRA 1GBMA 3P8GA 1LVMA 4TWYA 4DT7B 3AW1A 1YPHE 1WTGH 3SORA 3SW2B 1DY8A 1Y5BT 2XYAA 2GT8A 2GKVE 2CXVA 1TALA 3BTWE 2VWLA 2ZHEH 2XC5A 1TWXB 2HWLB 2FI5E 2W5EA 3ZYEA 3RXDA 1QL7A 3PO1C 3ODFA 4Q7XA 1K1IA 2QE7D 3DCLA 1XX9A 2A7HA 3SJ9A 4YLUA 1O2IA 2O8WA 4U01A 2PGBB 3RU4E 1LPGB 1BQYA 1DOJA 3GY8A 3AVZA 3RU4T 3SI3H 2A0QB 1YCPH 3QK1A 4KGAA 5EQSA 1Y3UA 2P59A 1TX7A 2WV5A 2BX4A 1DANH 3ITIA 4NG9H 5EW2H 4Q4LA 1BTZA 2XOKD 2UWOA 4Q2KA 1EB2A 4E7RG 2HPPH 4K1EA 2Y81A 3SUEA 2WYGA 2HNTE 1JIRA 1BRAA 4K2YA 2FS9A 3GISB 1IQKA 4ZXXH 1ESAA 3ZZ4A 2F9PA 1FMGA 1XUKA 2WPHS 5FL7D 5LPFA 2VINA 5DP6A 1KXDA 1C1PA 1V2VT 1FN6A 3Q3YA 4ABEA 3F68H 1GPZA 4WWYA 3TH4H 2BVXH 4B74A 1ABJH 4X6OA 4I7YH 1VITH 1QY6A 4XBCA 1CA0B 1O5GH 1DE7H 5HIYA 1V2LT 2OBOA 5A8ZA 1BHXB 1VITG 2GDDA 2ZF0H 4CHAB 3OSYA 1BRBE 1XUHA 4MG3A 2JETC 2C8ZB 4TSFD 3P6ZB 1Z8IB 2FLBH 4B2BA 1PQ8A 1OOKB 2IN2A 2VNTA 1O2UA 2TGDA 2BY6X 5EQRA 3SYJA 4UONA 1C1TA 3KQEA 3PMHB 1QJ1B 1CHGA 4D7GA 1HJAC 4WH6A 5EPNA 4NIXA 2CN0H 1EUFA 3GCOA 1YCPM 3GDSA 1AKSA 2D26C 3QZRA 1G3DA 1SLXB 1RXPA 4DG4A 3DHKH 4OS2A 1TLDA 2ZIQH 1P2NA 1DUAA 1V3XA 4ASUD 5LH8A 1O31A 1F5LA 2OUAA 5JBBS 3K65B 3KQBA 4CRAA 1A61H 1O33A 2K1QA 5FCRA 1BCUH 1Y3WA 3TH3H 4AGKA 5A09A 1IQIA 1DLEA 2WV9A 2FOAA 1NTPA 2O8TA 4IBLH 4UE7H 1C4U2 1AQ7A 1EPTA 2EY4C 2FZZA 1F7ZA 3A7ZA 2XNIA 3URDA 3G01A 1E38B 3MMGA 3BG4C 3B23B 3PV4A 3UOPA 4YT6H 1C5QA 1GMHF 3QGNB 4ACAA 2JJ2D 5CDFE 1QURH 1C5MD 3ATWA 1OYTH 3E16B 3H5CB 4H4FA 1LTOA 5EQQA 2BB4A 1GJBB 2H2ZA 1VGCC 1LQEA 4B2CA 4MPUA 1Y5AT 2WSSD 2Z6BD 3U9AH 1AGJA 1CHOF 2PKSC 1LHFH 2P3FH 3KF2A 3TVJB 2VJ1A 3AAVA 1C2FA 3I77A 3F2FA 1KLIH 3MU5A 2QYIA 5C20A 4DOQA 1D3DB 1WV7H 1K1JA 1UCYE 2G00A 3ZZ8A 2PLXA 3RXCA 2LP6A 3U1IB 1OP8A 1GGDB 3E3TA 3O8BA 2FX4A 3DD2H 3GY4A 4GPGA 2GJGA 2HVYB 1A5GH 2WPIS 4DW2U 4A7IB 3SI4H 4KKDA 1H8DH 2SGDE 5TJXA 1A0HB 3SN8A 3I29A 3QTOH 3P8FA 3UNSA 1ARBA 1P3EA 1DS2E 2ZFFH 5CHAC 1O3EA 4AOQA 2ZKSA 3FVFB 3M3TA 1HFDA 2XRCA 2VVUA 1GBKA 2QIQA 5EIYA 1F2SE 3SHAH 3M5MA 3R0FA 1L4DA 1OS8A 1EP5A 1NT1A 1ELVA 5C5OA 3U1JB 3SV8A 2ZTYA 3P70B 1KXAA 1PYTC 1TGNA 1O2KA 5FXLA 1S6LA 5G4BA 3BTHE 1AUTC 1MTUA 4P00A 5HM9A 3A88A 3MH5A 2H1UA 1AFQC 1CT4E 3RXKA 3EE0B 2VIDA 1RRKA 1BOQA 2VH6A 1BTUA 1MUEB 2A5KA 1V6DA 5F8TA 1ZRKA 2TPIZ 2G51A 4KP0A 4NFFA 1C2GA 3KQCA 2GT7A 5DSFA 1GI3A 2FOBA 2GGVB 3KN2A 3RXUA 1UTOA 3A87A 3E8LA 1AE5A 1D6RA 1GMHG 4AFUA 1TRNA 1HCGA 1MMJN 4Q63A 4OS1A 3L6PA 2ZGBH 4KTCA 1NFYA 4IGDA 4WY3A 3K6YA 4DCDA 1DWCH 1MKWH 5CMXH 1SL3A 1TABE 4Y8YA 2NU2E 5EJZA 1CHOG 1V2NT 5GIBA 3TGJE 3NK8A 4FVBA 1J8AA 1ZTJA 1CA0C 2G4TA 3LOXA 4DGJA 1NROH 1ACBE 4CHAC 4BXWA 1IQEA 2KCYA 4Y76A 3SQEE 3TK9A 1SGFA 8GCHG 1YPMH 4TY7A 4CR5A 1O2LA 1KY9A 1A4WH 2G55A 1KXBA 3FKSD 1AU8A 1O5BB 1W2KH 4ABDA 1BMNH 1SGQE 1P05A 2CJIA 2PUXB 3CNRA 1SGNE 2AGEX 5EPYA 1O3PB 1YC0A 4RI0A 2VIVA 1QFKH 2EI6A 2Y7ZA 4Y8XA 1BT7A 3KQDA 4AG1A 1TGSZ 3MHWU 1O30A 2BD2A 4NIVA 3TNTA 1CBWB 5K7RA 2J94A 4HFPB 1L1NA 4DY7B 2XBYA 2VB0A 1Z8RA 3BTFE 2A7CA 2QXGA 3T26A 3V12A 2OC0A 1FIWA 1A5IA 3LJOA 2BDIA 1V2MT 2PTNA 3T27A 1P9SA 1P2QA 2AMDA 2VVCA 2XBVA 5T6DA 5JBCS 1THSH 2Y80A 2FEQH 3RLWH 4QT8C 3RM2H 3OEHD 3ZVDA 1ZGIA 1NBMD 5AHGH 3TPIZ 1Z8JB 5EW1H 1O2OA 2ZPRA 2J97A 3STIA 1FI8A 1O2QA 1ETSH 1GCTB 2BDGA 1P11E 2VH0A 2IJD1 3BEFB 3IWMA 4ABIA 2BD4A 2WUCA 3KIDU 3S0NA 1TBZH 1EJMA 1BBRH 4YOGA 3S9CA 3QGJA 5DG6A 2CF9H 1NO9H 1TA2A 1XXFA 3FOAA 4XD7D 3RC6A 1RTKA 1SMFE 1F5KU 2BY7X 4ABGA 1C5VA 4FUCA 5HMAA 2W7SA 1GHBF 2UUYA 4NA8A 2ZO3H 4CRGA 3DFJA 3O8DA 5A2MH 1IHTH 1MBQA 5L2YH 1Y3XA 1UHBA 3CENA 5BPEA 1G3BA 4ABAA 2BZAA 1GJDB 6CHAB 5J4SA 2ZECA 3E6PH 2YMSB 1F5RA 2ZPQA 3M35A 1HNEE 5L2ZH 1X7AC 1C5PA 6GCHF 2BDCA 1IQMA 1ETRH 4X2XA 1TE0A 1GHAF 1DPOA 1Y5UT 2B8OH 1EJNA 1IQFA 1RS0A 3E0NB 5E0JA 2ZU5A 2LPRA 1HB0B 5C94A 1FY8E 3QDZB 2AGGX 3SV7A 4ABHA 3TU7H 1ESBA 5DP7A 1DVAH 1GBIA 3OY6U 2AIPA 2Q6GA 1FY5A 1GGDC 2OQ5A 3UNQA 4FU9A 1JBUH 1S6HA 1EAUA 4O97A 1EKBB 1O32A 1K1PA 1C5OH 1K9OE 1EPTC 4I86A 3LC5A 1KYNA 4B71A 1UTMA 2XWAA 1T4VH 1SQOA 1LPKB 5B6LA 1SKYE 5HXFA 3VB4A 1MZDA 5GCHF 1BIOA 2RA0A 1LHGH 1S84A 4ZHLU 3P92A 1HJ9A 2XWBI 1QJ6B 2GCTB 4ZHAA 3RXGA 1VCWA 3CS0A 4OS6A 2WPDD 4X6NA 2FOHA 4E05H 2JETB 2JH0D 2W3KA 1C5RA 2FWWA 2H5DA 2WINI 3DT0H 3F9HA 4JZ1A 3F9GA 1SPJA 4ASHA 1IHSH 4DIIH 2Z3CA 3FN8A 3SJ8A 3ZZAA 4BAOB 3BN9A 1DWEH 2GMTC 2YOLA 1MH0A 2AH4X 3RC4A 1GMDF 3A89A 1HJAB 3T29A 2EC9H 4KTSA 2K0QA 1LCYA 1ZTKA 3UY9A 4GVUA 3T25A 3UTUH 2R2WU 2V3OH 2PW8H 1NFUA 2DUCA 1TRYA 2OCVB 5LPEA 1O2HA 4MTBA 1GHBG 1NESE 2G5VA 5A0CA 3HKJB 3B9FH 1TYNA 2THFB 1AN1E 4FUGA 1MAYA 1GI6A 4AG2A 5JPMH 4JMYA 1GMCF 3MFJA 2Z9IA 3MNCA 2IJOB 5AF9H 2D8WA 4NSVA 2FTLE 2HOBA 4GHQA 1XKAC 2GZ8A 4GLYA 4THNH 4A1XA 2F4LA 2FYRA 1WCZA 1OSSA 1O2SA 1SOTA 2QF5A 1YPHC 2W26A 1HAHH 5C3NA 1TPSA 1Z71A 1LPZB 3O8RA 1GJ7B 1YPEH 1O2RA 1IQNA 4LK4A 4X6MA 3SQHE 2ESTE 3GDUA 2NU0E 5JBTA 1P9UA 1YGCH 5FPTA 1HRTH 4H6TA 5GNDA 2C3SA 1O3HA 3EGKH 5F8ZA 1ANCA 1DDJA 1O5DH 3LKWA 4INHA 1VGCB 1ELGA 3E91A 3LT3A 4AN7A 1V2ST 4MVNA 2BLOA 3T5FH 3O8CA 2GD4B 3N7DA 4Y71A 5TCAA 1OWKA 1F92A 5GCHG 2FOFA 1CBWC 2PKSB 3NRLA 4NA7A 1S0RA 1TQ7B 1OWEA 4ESTE 2FIRH 4AC9A 1T32A 4MLFB 1OWIA 4BAKB 2HNTC 3STJA 5LPRA 2NU1E 2ZTXA 1YWUA 3ATLA 4GAWA 2PKAB 2BLVA 1DSTA 1GI4A 3MNXA 1ZSKA 1PFXC 3FP8E 5DPAA 3MO6A 1NU9A 1Y3YA 4X1QU 1SGRE 1EJAA 1AD8H 2BHGA 5FAHA 1O2VA 2J2UA 2R9PA 1HAPH 4B6FA 4ZKOU 2KAIB 2WPMS 1BRCE 5JBAS 2HLCA 1BMMH 2Z3DA 1BTHH 4IC6A 3PV5A 3FZDA 5CHAB 1GBEA 4Q80A 1HAGE 1GBTA 1C9TA 1CSOE 1UVTH 4R0IA 3TK6A 3UQVA 1UVUH 5HIZA 2ZDKA 4K69A 3IITA 2J38A 2JH5D 4LXBH 1ZRBA 1C4V2 3SNEA 2CK3D 3LGYA 2J34A 1TMBH 1FUJA 2G4UA 3A84A 1TBRH 5C17A 3QWCH 6CHAC 1KSNA 2H9EH 4YOJA 1KLTA 1QRZA 3S7KB 1TQ0B 2YMSC 1ZJKA 4KELA 3RXJA 1A1RA 1ABIH 5EGMA 3LGWA 2Z9KA 2BDAA 3SJKA 3Q3XA 1AFQB 4ZMAH 1HYLA 4XE4A 1GBHA 1SB1H 4YTAA 5FHTA 3MH6A 1ZPZA 1VCQA 1A7SA 1K1OA 1CQQA 1IAUA 3EAJA 3LGTA 4AORA 2SNVA 1GWAA 2F3CE 1EASA 2BYAX 3ZZDA 3HKIB 2BD5A 1CVWH 1Z6JH 2FOGA 2ZDNA 3TIUA 1V2PT 1G30B 2ASUB 1GBFA 4FU7A 4Y7BA 1JRSA 2QAAA 2OXSA 5EU8A 2BQWB 1KTTB 3HATH 2OBQA 3F9EA 1G9IE 5C2ZA 3SV2H 2TGAA 1GDQA 1UTPA 3KYGA 2W3IA 1GJCB 1V2KT 1EZSC 3OE7D 2BD3A 3M3SA 4CREA 2W6ID 1BDAA 1FX0B 1P01A 3KQ5A 2CHAB 2GCTC 1O34A 3MTYA 3GY7A 4WJG2 5F53A 2BOHB 1AHTH 1Q31A 3BIVH 2BDBA 4Y0YE 5EG4A 4BXSA 1TMUH 1BMAA 3ATKA 1O5FH 2ZGXH 1JXPA 1Z7KA 1VJAU 3RXSA 2AERH 3RXHA 1SLUB 1RIWB 4UFDH 3RXPA 4DJZB 3OX7U 1UJ1A 3VB6A 1TMTH 1TNKA 1WBGB 4D8NA 1C1QA 1WXRA 3TK5A 1AIXH 1HXEH 1WYKA 2GZ7A 3Q76A 4B76A 1BTXA 1PPBH 3NUMA 1F0UA 2CF8H 3AAUA 1TBQH 3SNCA 3WWFA 1P57B 1DITH 1ID5H 4ZH8A 5HM2A 1ELDE 1HAVA 1PQ7A 3OU0A 2VIQA 1GJ4H 1EX3A 2PFEA 1BBRE 2ZDMA 1H4WA 4F4OC 4PROA 3SU3A 1FPCH 5EJ1A 1C5SA 3WWBA 4U32A 1A5HA 3A8CA 4D76A 1E36B 4IN1A 4IMQA 1K21H 3SZNA 2DE8A 1PPHE 1BJUA 3M61U 2A4GA 4RSPA 2BY9X 1IQHA 4F55A 4RKJB 1TNGA 3PMJA 3KGPA 4CRDA 3L3TA 1N6XA 1A0JA 1TNLA 1D3TB 1NU7B 3MNSA 4FUDA 3ZZ5A 2WPJS 1SC8U 1NRSH 1T31A 2SFAA 1HJ8A 1TX6A 2QXHA 4I31A 1KDQA 5EXMA 3SU5A 1O2XA 1XUFA 1ZHPA 3V13A 2GTBA 1CT2E 2Z9GA 2ZU4A 1JMOH 5JB8S 4MPXA 3TNSA 2Q1JA 1CO7E 1GBJA 3AW0A 2XW9A 2Z94A 1EZUC 1B7XB 3R3GB 2QXIA 1O3DA 2GP9B 1GJAB 3OTPA 1ZHRA 3S7HB 1NY22 4K3JA 1ZLRA 1AWFH 1AKSB 4BNRA 7KMEH 1TPAE 1TNIA 2ANMH 3F2GA 3ZVFA 1GJ9B 1GJ6A 1ARCA 1LDTT 1F0SA 4I8GA 5FBEA 1O2WA 1W0YH 4YT7H 3A81A 2AGIX 1O2ZA 1J16A 2ODPA 1JRTA 4AYVB 1O35A 3S9BA 1EFRD 1G3EA 5H4IB 1TGBA 5C0TA 2P93A 1O3LA 4XOJA 2UWPA 1ETTH 3WW7A 4YM9A 1S0QA 1MTWA 3BV9B 1O2YA 4LZ4B 1E1QD 4BAMB 4CBOA 1MKXK 1C2EA 4TY6A 2BOKA 2BDYA 1BA8B 1H9HE 1GJ5H 2BTCE 1ANDA 1FDPA 1C1SA 3EDXB 3H7TA 1EPTB 3NPSA 2SGEE 1Q3XA 1LKAA 3PMAB 4DVAU 2NU4E 4F48B 1Z6EA 3AASA 1GDUA 1FPHH 1LO6A 2W6JD 3F0PA 1DICA 1WQSA 1OWDA 2C90B 3V0XA 2HNTF 1MBMA 2V3HH 2G81E 1CE5A 3M37A 3HK3B 2J98A 1V2UT 2P16A 4Z0KA 2J95A 1GI9B 1AVWA 3GYLB 4IN2A 5DK1A 2QA9E 2ZU3A 1UTKA 2Q6FA 2ZG0H 2ZHFH 3OEED 3BTME 1GBLA 4AFSA 1W7GH 2ALPA 1COWD 1TFXA 4K8YA 3SGBE 1O5EH 1OXGA 2TIOA 1UK2A 1AB9C 4A1VA 2GMTB 3UR9A 3AK5A 4VGCB 1NPMA 1B0EA 1QQUA 1H1BA 2QV1A 5GJ4B 1KXEA 3D23A 4RT0A 1BUIA 1ANEA 1FY4A 2VWMA 1HXFH 2XCNA 3IG6B 1TIOA 2C8XB 4YO9A 1ZPBA 1YKTA 1LMWB 1FZZA 3ZZ7A 3GY6A 4ZKSU 3MU8A 1B0FA 1OP0A 1GI2A 2A2QH 3LPRA 2Z9LA 4BAHB 1L1GA 2F43B 5GPIB 3GCHC 2FESH 4ABJA 4ZUHA 1C4Y2 4WMFA 1QRXA 3U8TH 3W1EA 4BTUB 3S9AA 3PYHA 5FCKA 3UIRA 2Y6TA 2A4QA 1C1OA 1FIZA 1B5GH 3HGNA 7ESTE 1FAXA 5C5NA 8KME2 2HGTH 3ZVGA 1XM1A 1O36A 5JYIA 3FFGA 1A3BH 3LGIA 3TGIE 4X2YA 1T7CA 4UFGH 2CHAC 1THPB 2I6QA 3UQOA 1GL0E 1IQJA 1C1WH 2ZU1A 1J9CH 3FP6E 1SGDE 2RG3A 3FP7E 4LOYH 4MDSA 2JJ1D 1GVLA 5EODA 3SU0A 1ZTLA 2D2DA 1RIWC 1F0TA 3A80A 3ENSB 1KIGH 2Y5FA 3LGUA 1NRRH 1SGIB 2OQUA 4RKOB 4UDWH 7GCHF 1NBME 1O3JA 1MTVA 3KL6A 3BTKE 4CH8B 3A8BA 2GCHF 1GBBA 3A83A 1BTWA 3ZV8A 1UVSH 2F9UA 3LIWA 2FTMA 3GY5A 1NRQH 4UFFH 4X6PA 3SJOA 3FO8D 2AYWA 5FX5A 1PQAA 1CGJE 2A5AA 1V2JT 2R0LA 2V6NA 2H5CA 1BZXE 1ZMNA 2ZHWH 1UVPA 3UOUA 2UUJB 2ZFQH 2HLDD 5FBIA 1EAIA 4B6EA 2A2XH 1QL8A 2CGAA 4DIHH 1ZJDA 5DP9A 1P10A 2ZCLP 2Z9JA 2OC7A 4GHTA 1WDIA 4AGJA 1LHDH 2PUQH 4P02A 2SNWA 1YY3A 1ESTA 3GCTF 4NA9H 1N1LA 2ZPSA 5CHBA 4ZROA 2WPLS 4MNXA 4X1RU 3MOCA 2GDEH 2UUKB 1UTNA 2F9NA 5HGGA 2OC8A 4ISLA 3ZVAA 5HKKD 3SV9A 3B8JA 4K1TA 4O9VA 2R2MB 1G36A 1TX8A 2M5TA 4XDEA 2BX3A 4RT1A 2O8LA 1GHZA 1WUNH 4LZ1H 4MPVA 2BY8X 1O5CB 3VGCB 1ZGVA 2SGFE 4JCNA 2VVVA 4OGYA 3NCLA 1O38A 2ODQA 2ZU2A 5DP8A 4X0WU 1BTPA 1QHRB 1GL1A 3F2HA 1PYTD 1W10U 3P95A 1AFEH 5F8XA 1UCYK 3ZYDA 1C5LH 5C1XA 1TB6H 1A0LA 1W3CA 3MU0A 2ILNA 3SJIA 1MD7A 1HBTH 4OS4A 5ESTE 5E2OA 1Y59T 3GOVB 1P02A 3MU4A 4MNWA 1UW7A 4CRFA 4B2AA 1MCTA 1VJ9U 4OGXA 1SFQB 2G5NA 1T4UH 1BMLA 3V3MA 1EATA 3GYMA 3I78A 3SV6A 2JIZD 2TRMA 2FODA 3ZVCA 1NM6A 1YBWA 3E90B 1SGPE 7GCHG 3DA9B 1D3QB 2J5UA 2J4IA 4MQAA 1P3CA 1TAWA 2SGAA 2SGQE 1MQ5A 3BEIB 4UEHH 3H7OA 1WOFA 2GZ9A 2OP9A 3LC3A 1C5XB 2WV4A 3SO3A 1PPEE 3QN7A 2C4FH 2UWLA 3KHVA 1O5AB 1D3PB 1FJSA 2XC4A 3UWJH 1UHBB 1WAYB 1AMHA 3JZ1B 4AFZA 5E2PA 3VB7A 4H42U 1RD3B 3ATMA 1QZ8A 2A4RA 1EOJA 2P95A 1MQ6A 3FZZA 1Z1IA 2XBWA 2NU3E 3PWCA 1DXPA 2IOTA 3GCTG 3U8OH 3U98H 2ZGCA 1D6WA 4KTUA 5C0UA 4NCYA 5C1UA 3EQ0H 3F6UH 3RLYH 2C93B 1UCYH 1EOLA 1FNIA 3EE7A 4I32A 1CA8B 1MU8B 4VGCC 5C1YA 3MU1A 3PROA 3PRBA 4U30A 4X8SH 1H8IH 1SGTA 2PWXA 1UVOA 1RJXB 2HALA 2A7JA 1H9LB 1V2OT 3BEUA 2L6OA 4INLA 1HAXB 4YOIA 2XTTB 3QZQA 2G8TA 1MD8A 4GCHF 1P03A 1UTJA 3RXFA 2AEIH 2KFWA 2KZ4A 4BTIB 1HIAA 1QR3E 1RTFB 1C5WB 1C9PA 1QRWA 6ESTA 4O3UA 1NZQH 5ABWA 2C8WB 4NFEA 1ELCA 1PQ5A 3UFAA 3RXLA 1EAXA 1KXCA 2EI7A 2I6SA 2PP6A 1O3FA 4OM9A 5DKMA 1MCVA 3LDXH 3A86A 1K28D 2V0BA 3M5NA 4JZDH 1GI0A 6GCHG 1GHAG 1GHXH 2PSXA 3SBKA 3CP7A 4NSYA 1MABB 1NFWA 1N8OB 1GI1A 3BTQE 4BTTB 1S85A 1TOMH 1AUJA 5HYOA 2VGCC 2OLGA 2F9BH 3CS7A 1SR5C 4WMDA 2BVRH 3D62A 1P2JA 4X2WA 1ZMJA 1F0RA 3DSOA 3UUZA 2WHXA 5I25A 4DURA 3VG8A 5L6NH 1XUJA 3FAOA 1BITA 3NZIA 3ESTA 1BMFD 1GI7B 2KX4A 3HGPA 4TPYA 4A1TA 4AX9H 3TGKE 1QB9A 2FI4E 3UREA 3GS9A 4FUBA 1NN6A 3PV2A 5EXNA 3VFEA 1O3GA 2BD9A 1V2TT 2BQ6B 3RXVA 3UWIA 9LPRA 3NKKA 1GHYH 1EQ9A 1O3KA 1P04A 4A5TS 1UMAH 1KMHB 2H9HA 1YPLH 4R8TB 3MYWA 4YXWD 1XVMA 3K9XB 4JYUH 2Q6DA 3QUMP 2ZFTA 1W7XH 5F6MA 2FS8A 2KCPA 1P2KA 4Y7AA 3RUOA 1GMDG 1ELFA 1HAOH 4M7GA 3SHCH 3F3BA 1PPCE 3D49H 3TJVA 2ZNKH 1ELTA 2OINA 3UPEA 4FVDA 3VGCC 5I46H 1EB1H 1VZQH 1DM4B 2FLRH 4ZKRU 3RM0H 1P12E 2FYQA 3MWIU 1SHHB 1AWHB 3T62A 3RXQA 4RN6A 5JB9S 1GMCG 1ZHMA 3SGAE 2ALVA 2FPZA 4E7NA 5A8YA 2JDID 4XRNA 4WMEA 5IDKA 1AB9B 3A82A 1O3BA 3SNAA 1TGCA 2RDLA 2QN5T 4NWLA 5E0HA 2GVFA 5C67A 1XKBC 4HI3A 5GWZA 8ESTE 1QCPA 1V2WT 1P0SH 4FUFA 4OS7A 3UB0A 2BMGB 4ABFA 1LVOA 1O2MA 4AYYB 3ELAH 5EJLA 1VR1H 3GCHB 3SOSA 4ISOA 3F9FA 5CE1A 1BTYA 2CMYA 5F03A 3ZZBA 3RXAA 5IK2D 2A45B 4K8BA 1V2RT 4YLQH 2AFQB 2ANWA 1UTLM 4OS5A 2KR7A 1RFNA 2V3MA 3SUGA 1T8OA 2QF0A 1C2LA 1HV7A 1GBAA 2QC2A 3EA7A 4O3TA 3SU6A 4X8VH 4CBNA 4Y6DA 2ZFPH 3BSQA 3RP2A 3SU1A 4HGCA 4ISIH 2V35A 4K60A 1C1VH 1ZOMA 5KEDA 4TYDA 3KNXA 1WU1A 1P09A 3W95A 1GHWH 4JZFH 1SI5H 1Q2WA 2ZI2H 1UK4A 3ZZ9A 3NWUA 4AB9A 3SGQE 4H6SB 3RU4D 3M7TA 1AZ8A 5DJ7A 2AIQA 3F1SB 2QCYA 2FP7B 3MH7A 1AI8H 2GV6A 4GUXA 1K22H 5DP3A 2BZ6H 1BRUP 3Q00A 4SGBE 3ZIAD 5DN6D 3RXIA 1C5ZB 1L1JA 2P8OC 4TPIZ 1SG8B 1O3NA 3RXOA 1PJPA 2FI3E 2BLQA 4AB8A 1GHVH 2HRVA 2XNDD 3S69A 3OAAD 8LPRA 3SZEA 4CRCA 4ZHMU 2V7QD 1EP6A 3PMBB 1THRH 1ZYOA 4K5ZA 2KCAA 2IPQX 1QB6A 5JDUB 2ZWLH 5EXLA 1ZSJA 1YLDA 2K8IA 1ZMLA 3PB1E 1P8VC 1G3CA 2FM2A 4MNVA 1C5YB 2XCFA 2M2AA 3ODDA 3LONA 2ZQ2A 2XC0A 2ULLA 3C1KA 3ZVEA 1GBDA 4I33A 3RXMA 1FN8A 3PWBA 1G32B 1OP2A 4YESB 1SQAA 3ZV9A 1N8OC 1NC6A 4ACBA 1S83A 1OWJA 2RCEA 1G37A 1W0JD 3LGVA 3F0OA 3SUDA 5KECA 1QTFA 4TT3D 2JH6D 2Z3EA 4FETA 2R0KA 2O9QA 4XBBA 1ANBA 1NS3A 3SNDA 2YMSD 4ZKNU 4K1SA 3VB3A 1C2MA 2BM2A 3A8DA 1HAVB 4X8TH 2ODYB 3VPKA 1TA6A 2A31A 4FUIA 1DLKB 1O2JA 3LH3A 1W0ZU 2XXLA 1A2CH 2ZCKP 4ISHH 1ZZZA 2F9OA 2ZFRH 1C5TA 3RXRA 1LQDB 2ZHDA 3BTEE 3BTDE 1SVPA 3OFND 4Q7ZA 1TPOA 2BD7A 3GY3A 4JK5A 3OY5U 2A4OA 1YP9A 2AHME 1LVYA 4FU8A 2EQNA 1TNHA 4TWWA 1FY1A 4NIYA 1SGCA 5GXPA 1C1NA 1V2QT 1H8ED 1KDQB 2IPHA 3M36A 2FDAA 5AVDA 4CRBA 4J2YB 1O2GH 4X1PU 8GCHF 3VXFH 1LHEH 3M5LA 1QBOA 1AVXA 3QX5H 3A7VA 3A7TA 4BOHA 2QY0B 4X2VA 5A0AE 1SLWB 1KLJH 1MKWK 1GG6B 3TJNA 1GBCA 1LKBA 1XMNB 4ZAEA 3A8AA 1K2I1 1HAZB 1O2PA 1TRMA 1Z8GA 2P3TB 2Y82A 1MU6B 2VWOA 1AE8H 1O2TA 5B6OA 5PTPA 1C2IA 1EZQA 1L2EA 2FX6A 2ZGHA 1QGFA 1S81A 5SGAE 1O3OA 1RTLA 2PSYA 1CU1A 4B1TA 1IQGA 2H9TH 1DFPA 3GCNA 3A7WA 1KXFA 3PTBA 3NXPA 3U69H 3RXTA 4Y11E 1MAXA 2B0FA 3UNRA 3E1XB 1BB0B 2GV7A 3SNBA 5DP5A 3FANA 5T1VA 3K6ZA 4HZHA 2F83A 1O3AA 4UD9H 3ZZ6A 1MTNB 1Y8TA 1L0ZA 1QA7A 3PM3A 3MI4A 1NRPH 1P2OA 2FOEA 2Z7FE 4YZUA 2ZTZA 4IS5A 1SSXA 3N99A 2ZA5A 1MKXH 2ZDVH 1FV9A 2BVSH 1OYQA 5ESBA 3M3VA 2J98B 1W8BH 1UTQA 2J9NA 2EA3A 4A92A 2AS9A 1W14U 1XXDA 2HPQH 4Y8ZA 1J15A 4E06H 3DUXH 2XBXA 4D9RA 4FOUC 5FPYA 2BXTH 2VIPA 2PHBA 1XVOA 2D1JA 3BG8A 2ZDAH 3TITA 3ZZ3A 4WXIA 1O3IA 5FPSA 3QLPH 2B7DH 4CR9A 4Z1MD 3GDVA 1E37B 2VGCB 2ZC9H 3KEEA 2WZQA 2C8YB 3UR6A 1UO6A 3W94A 1O2NA 4FXGH 1BBRK 2RDEA 1W11U 1DX5M 1HGTH 1OKXA 4Y79A 1EZXC 2VU8E 3MO3A 2L74A 3URCA 2WYJA 1DUEA 1QL9A 3GICB 1GJ8B 4WXVA 2NWNA 3BIUH 3L33A 4GSOA 3BTTE 1XUIA 1QIXB 1O3CA 1WQVH 3P17H 4NZQA 4ABBA 2ZHQH 3N7OA 2F91A 1ORFA 1K1MA 3MO9A 4NWKA 1YYY1 6LPRA 1P06A 1ELEE 2ZGJA 4DT4A 1TNJA 1ZR0A 1SGFG 4WF8A 1DT2A 2VIWA 3U28C 3T28A 4X1SU 2J92A 2YNAA 3LH1A 1O39A 3HPTB 1C5UA 1SOZA 1H8HD 3QO6A 5DGJA 3BF6H 1DY9A 5DO4H 1BJVA 1PPZA 2STAE 3DSPA 1JOUB 5BRRE 1E35B 2WPKS 3LU9B 2DE9A 3SU4A 2VIOA 1K1LA 3MNBA 1ZPCA 3M7UA 3RXBA 2OC1A 3VB5A 3RMMH 2G52A 3E0PB 4I8JA 5TCCA 3KCGH 1NFXA 1Z1JA 4X8UH 4B73A 1FY3A 2STBE 1P2MA 1HAIH 1GVZA 1YPKH 2EEKA 2SGPE 2A5IA 3Q3KA 2O8UA 1A46H 1QBNA 2BDHA 1LVBA 3QTVH 1AZZA 2BXUH 3T2NA 1KTSB 1HAYB 1QB1A 2CV3A 4MPWA 1T8LA 4U2WA 5A8XA 1JWTA 3HK6B 1HPGA 2B5TB 4IW4E 5E8EH 5J4QA 3V7TA 2BD8A 1C1UH 3PO1B 2TBSA 5T6GA 1IOEA 5AFYH 2GX4A 1OX1A 4Y0ZE 3WY8A 1WTHD 5LGOA 1A3EH 2GCHG 2PR3A 1TPPA 1TGTA 4I8HA 1OHHD 2R3YA 5T6FA 1HLTH 1FQ3A 2LNCA 1YM0A 1YPGH 2PGQB 3RMNH 4NIWA 1JIMA 3RDZA 1QNJA 4ZXYH 2W7UA 4JZIA 3DFLA 2ZCHP 3LJJA 1O3MA 1E79D 1VKYA 1INCA 2H6MA 2O8MA 4ZCNA 5ETXA 1QJ7B 1DSUA 1GG6C 1SGYE 3Q77A 1HUTH 4SGAE 1QQ4A 4JZEH 4J1YA 4FUHA 4XSKU 2PTCE 1EXFA 2TGPZ 3BTGE 4Y10E 3P8OA 4Q7YA 2F9VA 4JYVH 4M9FA 3TLOA 3TJOA 2AMQA 1FONA 1DXWA 1SFIA 1SQTA 1SLVB 1C1RA 1OPHB 2VWNA 4I8LA 1W13U 3PTNA 1VCPA 1W0KD 3MH4A 4XFQA 5IYTA 4MNYA 2LELA 1E0FD 2RFKC 3RMOH 1YLNA 2BY5X 2KM0A 2BQ7B 2P8OB 1K1NA 1ZSLA 1PPGE 4FUEA 3VXEH 2EI8A 2A32A 1TOCB 4CH2B 1T8NA 4NGAH 4UFEH 1MTNC 2OD3B 2QF3A 1CT0E 1N6YA 4FUJA 1K0HA 1DWDH 1WSSH 5L30H 5EOKA 3ZZCA 3VEQB 3RMLH 2ZP0H 3EA8A 3KYFA 3P8NA 2ANKH 1H9IE 2PV9B 1C2DA 2ANYA 2KCOA 1SQRA 1C2JA 1SBWA 1Y3VA 1YF4A 1G2MA 2ZZUH 3D65E 5E0GA 1QA0A 1S5SA 2FXRA 2R3UA 3EA9A 4JK6A 1FXYA 3K2UA 2UUFB 4JYTA 3RC5A 1C2KA 2TGTA 1SGEE 1W12U 5KGOA 1IQLA 3ATIA 3DSGA 3SUFA 1GDNA 4I8KA 1J17T 3GY2A 5A0BA 4WVPE 5T3HA 7LPRA 2OTVA 2PKAA 5GDSH 2FOCA 4BANB 2FO9A 2BLWA 1OWHA 1FAKH 1FLEE 3A85A 4Z6AH 3PLPA 2P3UB 1PPFE 2Y7XA 1O0DH 4X1NU 3M5OA 1XUGA 3OYPA
chains in the Genus database with same CATH topology
2P94A 2FOMB 3OTJE 3BG4B 2KAIA 5FX6A 1HIAB 4BAQB 9ESTA 2ZFSA 1GI8B 2Y5GA 1O37A 1U6QA 4AFQA 2HVXA 2B9LA 1CGHA 1E34B 1GI5A 2YNBA 1C5NH 3C27B 3A7YA 2QXJA 2Y5HA 1S6FA 3ZVBA 1S82A 4D9QA 4HTCH 3SU2A 1BHXF 4F49A 3RXEA 1ELBA 1YCPK 4XBDA 1D4PB 1AO5A 1P2IA 4O03A 4WH8A 1VITF 1YPJH 4IC5A 2WUBA 3M7QA 4AZ2B 3JZ2B 1GCDA 3PLBA 3EYDA 5AFZH 5DP4A 3TH2H 3U8RH 1C2HA 1DWBH 1RGQA 1CGIE 1LHCH 1L4ZA 1AVGH 1M9UA 3TJUA 3PLKA 3A7XA 4IMZA 2FMJA 1UK3A 1J14A 1T8MA 1EAWA 4GCHG 2ZDLA 1GCTC 1SHYA 2ZQ1A 1NRNH 1AY6H 5K0HA 4D7FA 1C1MA 1G2LA 1MTSA 1ELAA 2ZEBA 4A6LA 1MZAA 2RA3A 4B75A 1QBVH 1YLCA 4ISNA 2AMPA 1TONA 2A1DB 2JKHA 1HDTH 4NZLA 1D9IA 4INKA 1GVKB 2QGRA 1GBMA 3P8GA 1LVMA 4TWYA 4DT7B 3AW1A 1YPHE 1WTGH 3SORA 3SW2B 1DY8A 1Y5BT 2XYAA 2GT8A 2GKVE 2CXVA 1TALA 3BTWE 2VWLA 2ZHEH 2XC5A 1TWXB 2HWLB 2FI5E 2W5EA 3ZYEA 3RXDA 1QL7A 3PO1C 3ODFA 4Q7XA 1K1IA 1XX9A 2A7HA 3SJ9A 4YLUA 1O2IA 2O8WA 4U01A 2PGBB 3RU4E 1LPGB 1BQYA 1DOJA 3GY8A 3AVZA 3RU4T 3SI3H 2A0QB 1YCPH 3QK1A 4KGAA 5EQSA 1Y3UA 2P59A 1TX7A 2WV5A 2BX4A 1DANH 3ITIA 4NG9H 5EW2H 1BTZA 2UWOA 4Q2KA 1EB2A 4E7RG 2HPPH 4K1EA 2Y81A 3SUEA 2WYGA 2HNTE 1JIRA 1BRAA 4K2YA 2FS9A 3GISB 1IQKA 4ZXXH 1ESAA 3ZZ4A 2F9PA 1FMGA 1XUKA 2WPHS 5LPFA 2VINA 5DP6A 1KXDA 1C1PA 1V2VT 1FN6A 3Q3YA 4ABEA 3F68H 1GPZA 4WWYA 3TH4H 2BVXH 4B74A 1ABJH 4X6OA 4I7YH 1VITH 1QY6A 4XBCA 1CA0B 1O5GH 1DE7H 1V2LT 2OBOA 5A8ZA 1BHXB 1VITG 2GDDA 2ZF0H 4CHAB 3OSYA 1BRBE 1XUHA 4MG3A 2JETC 2C8ZB 3P6ZB 1Z8IB 2FLBH 4B2BA 1PQ8A 1OOKB 2IN2A 2VNTA 1O2UA 2TGDA 2BY6X 5EQRA 4UONA 1C1TA 3KQEA 3PMHB 1QJ1B 1CHGA 4D7GA 1HJAC 4WH6A 5EPNA 4NIXA 2CN0H 1EUFA 3GCOA 1YCPM 3GDSA 1AKSA 2D26C 3QZRA 1G3DA 1SLXB 1RXPA 4DG4A 3DHKH 4OS2A 1TLDA 2ZIQH 1P2NA 1DUAA 1V3XA 5LH8A 1O31A 1F5LA 2OUAA 5JBBS 3K65B 3KQBA 4CRAA 1A61H 1O33A 2K1QA 5FCRA 1BCUH 1Y3WA 3TH3H 4AGKA 5A09A 1IQIA 1DLEA 2FOAA 1NTPA 2O8TA 4IBLH 4UE7H 1C4U2 1AQ7A 1EPTA 2FZZA 1F7ZA 3A7ZA 2XNIA 3URDA 3G01A 1E38B 3MMGA 3BG4C 3B23B 3PV4A 3UOPA 4YT6H 1C5QA 1GMHF 3QGNB 1QURH 1C5MD 3ATWA 1OYTH 3E16B 3H5CB 4H4FA 1LTOA 5EQQA 2BB4A 1GJBB 2H2ZA 1VGCC 1LQEA 4B2CA 4MPUA 1Y5AT 2Z6BD 3U9AH 1AGJA 1CHOF 2PKSC 1LHFH 2P3FH 3KF2A 3TVJB 2VJ1A 3AAVA 1C2FA 3I77A 1KLIH 3MU5A 2QYIA 5C20A 4DOQA 1D3DB 1WV7H 1K1JA 1UCYE 2G00A 3ZZ8A 2PLXA 3RXCA 3U1IB 1OP8A 1GGDB 3E3TA 3O8BA 2FX4A 3DD2H 3GY4A 4GPGA 1A5GH 2WPIS 4DW2U 4A7IB 3SI4H 4KKDA 1H8DH 2SGDE 5TJXA 1A0HB 3SN8A 3I29A 3QTOH 3P8FA 3UNSA 1ARBA 1P3EA 1DS2E 2ZFFH 5CHAC 1O3EA 4AOQA 2ZKSA 3FVFB 3M3TA 1HFDA 2XRCA 2VVUA 1GBKA 2QIQA 1F2SE 3SHAH 3M5MA 3R0FA 1L4DA 1OS8A 1EP5A 1NT1A 1ELVA 5C5OA 3U1JB 3SV8A 2ZTYA 3P70B 1KXAA 1PYTC 1TGNA 1O2KA 5FXLA 5G4BA 3BTHE 1AUTC 1MTUA 5HM9A 3A88A 3MH5A 2H1UA 1AFQC 1CT4E 3RXKA 3EE0B 2VIDA 1RRKA 1BOQA 2VH6A 1BTUA 1MUEB 2A5KA 1V6DA 5F8TA 1ZRKA 2TPIZ 2G51A 4KP0A 4NFFA 1C2GA 3KQCA 2GT7A 1GI3A 2FOBA 2GGVB 3KN2A 3RXUA 1UTOA 3A87A 3E8LA 1AE5A 1D6RA 1GMHG 4AFUA 1TRNA 1HCGA 1MMJN 4OS1A 3L6PA 2ZGBH 4KTCA 1NFYA 4IGDA 4WY3A 3K6YA 4DCDA 1DWCH 1MKWH 5CMXH 1SL3A 1TABE 4Y8YA 2NU2E 1CHOG 1V2NT 5GIBA 3TGJE 3NK8A 4FVBA 1J8AA 1ZTJA 1CA0C 2G4TA 3LOXA 4DGJA 1NROH 1ACBE 4CHAC 4BXWA 1IQEA 4Y76A 3SQEE 3TK9A 1SGFA 8GCHG 1YPMH 4TY7A 4CR5A 1O2LA 1KY9A 1A4WH 2G55A 1KXBA 1AU8A 1O5BB 1W2KH 4ABDA 1BMNH 1SGQE 1P05A 2CJIA 2PUXB 1SGNE 2AGEX 5EPYA 1O3PB 1YC0A 2VIVA 1QFKH 2EI6A 2Y7ZA 4Y8XA 1BT7A 3KQDA 4AG1A 1TGSZ 3MHWU 1O30A 2BD2A 4NIVA 3TNTA 1CBWB 5K7RA 2J94A 4HFPB 1L1NA 4DY7B 2XBYA 2VB0A 1Z8RA 3BTFE 2A7CA 2QXGA 3T26A 3V12A 2OC0A 1FIWA 1A5IA 3LJOA 2BDIA 1V2MT 2PTNA 3T27A 1P9SA 1P2QA 2AMDA 2VVCA 2XBVA 5T6DA 5JBCS 1THSH 2Y80A 2FEQH 3RLWH 4QT8C 3RM2H 3ZVDA 1ZGIA 5AHGH 3TPIZ 1Z8JB 5EW1H 1O2OA 2ZPRA 3STIA 1FI8A 1O2QA 1ETSH 1GCTB 2BDGA 1P11E 2VH0A 3BEFB 3IWMA 4ABIA 2BD4A 2WUCA 3KIDU 3S0NA 1TBZH 1EJMA 1BBRH 4YOGA 3S9CA 3QGJA 5DG6A 2CF9H 1NO9H 1TA2A 1XXFA 3RC6A 1RTKA 1SMFE 1F5KU 2BY7X 4ABGA 1C5VA 4FUCA 5HMAA 2W7SA 1GHBF 2UUYA 4NA8A 2ZO3H 4CRGA 3DFJA 3O8DA 5A2MH 1IHTH 1MBQA 5L2YH 1Y3XA 1UHBA 3CENA 5BPEA 1G3BA 4ABAA 2BZAA 1GJDB 6CHAB 5J4SA 2ZECA 3E6PH 1F5RA 2ZPQA 3M35A 1HNEE 5L2ZH 1X7AC 1C5PA 6GCHF 2BDCA 1IQMA 1ETRH 4X2XA 1TE0A 1GHAF 1DPOA 1Y5UT 2B8OH 1EJNA 1IQFA 1RS0A 3E0NB 5E0JA 2ZU5A 2LPRA 1HB0B 1FY8E 3QDZB 2AGGX 3SV7A 4ABHA 3TU7H 1ESBA 5DP7A 1DVAH 1GBIA 3OY6U 2AIPA 2Q6GA 1FY5A 1GGDC 2OQ5A 3UNQA 4FU9A 1JBUH 1S6HA 1EAUA 4O97A 1EKBB 1O32A 1K1PA 1C5OH 1K9OE 1EPTC 3LC5A 1KYNA 4B71A 1UTMA 2XWAA 1T4VH 1SQOA 1LPKB 5HXFA 3VB4A 1MZDA 5GCHF 1BIOA 2RA0A 1LHGH 1S84A 4ZHLU 3P92A 1HJ9A 2XWBI 1QJ6B 2GCTB 4ZHAA 3RXGA 1VCWA 3CS0A 4OS6A 4X6NA 2FOHA 4E05H 2JETB 2JH0D 2W3KA 1C5RA 2FWWA 2H5DA 2WINI 3DT0H 3F9HA 4JZ1A 3F9GA 1SPJA 4ASHA 1IHSH 4DIIH 2Z3CA 3SJ8A 3ZZAA 4BAOB 3BN9A 1DWEH 2GMTC 2YOLA 1MH0A 2AH4X 3RC4A 1GMDF 3A89A 1HJAB 3T29A 2EC9H 4KTSA 1LCYA 1ZTKA 3UY9A 4GVUA 3T25A 3UTUH 2R2WU 2V3OH 2PW8H 1NFUA 2DUCA 1TRYA 2OCVB 5LPEA 1O2HA 4MTBA 1GHBG 1NESE 2G5VA 5A0CA 3HKJB 3B9FH 1TYNA 2THFB 1AN1E 4FUGA 1MAYA 1GI6A 4AG2A 5JPMH 4JMYA 1GMCF 3MFJA 2Z9IA 3MNCA 2IJOB 5AF9H 2D8WA 4NSVA 2FTLE 2HOBA 4GHQA 1XKAC 2GZ8A 4GLYA 4THNH 4A1XA 2FYRA 1WCZA 1OSSA 1O2SA 1SOTA 1YPHC 2W26A 1HAHH 5C3NA 1TPSA 1Z71A 1LPZB 3O8RA 1GJ7B 1YPEH 1O2RA 1IQNA 4LK4A 4X6MA 3SQHE 2ESTE 3GDUA 2NU0E 5JBTA 1P9UA 1YGCH 5FPTA 1HRTH 4H6TA 2C3SA 1O3HA 3EGKH 5F8ZA 1ANCA 1DDJA 1O5DH 3LKWA 4INHA 1VGCB 1ELGA 3E91A 3LT3A 4AN7A 1V2ST 4MVNA 2BLOA 3T5FH 3O8CA 2GD4B 4Y71A 5TCAA 1OWKA 1F92A 5GCHG 2FOFA 1CBWC 2PKSB 4NA7A 1S0RA 1TQ7B 1OWEA 4ESTE 2FIRH 1T32A 4MLFB 1OWIA 4BAKB 2HNTC 3STJA 5LPRA 2NU1E 2ZTXA 3ATLA 4GAWA 2PKAB 2BLVA 1DSTA 1GI4A 3MNXA 1ZSKA 1PFXC 3FP8E 5DPAA 3MO6A 1NU9A 1Y3YA 4X1QU 1SGRE 1EJAA 1AD8H 2BHGA 5FAHA 1O2VA 2J2UA 2R9PA 1HAPH 4ZKOU 2KAIB 2WPMS 1BRCE 5JBAS 2HLCA 1BMMH 2Z3DA 1BTHH 4IC6A 3FZDA 5CHAB 1GBEA 4Q80A 1HAGE 1GBTA 1C9TA 1CSOE 1UVTH 4R0IA 3TK6A 3UQVA 1UVUH 2ZDKA 4K69A 3IITA 2J38A 2JH5D 4LXBH 1ZRBA 1C4V2 3SNEA 3LGYA 2J34A 1TMBH 1FUJA 2G4UA 3A84A 1TBRH 3QWCH 6CHAC 1KSNA 2H9EH 4YOJA 1KLTA 1QRZA 3S7KB 1TQ0B 4KELA 1ZJKA 3RXJA 1A1RA 1ABIH 5EGMA 3LGWA 2Z9KA 2BDAA 3SJKA 3Q3XA 1AFQB 4ZMAH 1HYLA 4XE4A 1GBHA 1SB1H 4YTAA 5FHTA 3MH6A 1ZPZA 1VCQA 1A7SA 1K1OA 1CQQA 1IAUA 3EAJA 3LGTA 4AORA 2SNVA 1GWAA 2F3CE 1EASA 2BYAX 3ZZDA 3HKIB 2BD5A 1CVWH 1Z6JH 2FOGA 2ZDNA 3TIUA 1V2PT 1G30B 2ASUB 1GBFA 4FU7A 4Y7BA 1JRSA 2QAAA 2OXSA 5EU8A 2BQWB 1KTTB 3HATH 2OBQA 3F9EA 1G9IE 5C2ZA 3SV2H 2TGAA 1GDQA 1UTPA 2W3IA 1GJCB 1V2KT 1EZSC 2BD3A 3M3SA 4CREA 1BDAA 1P01A 2CHAB 2GCTC 1O34A 3MTYA 3GY7A 4WJG2 2BOHB 1AHTH 1Q31A 3BIVH 2BDBA 4Y0YE 5EG4A 4BXSA 1TMUH 1BMAA 3ATKA 1O5FH 2ZGXH 1JXPA 1Z7KA 1VJAU 3RXSA 2AERH 3RXHA 1SLUB 1RIWB 4UFDH 3RXPA 4DJZB 3OX7U 1UJ1A 3VB6A 1TMTH 1TNKA 1WBGB 4D8NA 1C1QA 3TK5A 1AIXH 1HXEH 1WYKA 2GZ7A 3Q76A 4B76A 1BTXA 1PPBH 3NUMA 1F0UA 2CF8H 3AAUA 1TBQH 3SNCA 1P57B 1DITH 1ID5H 4ZH8A 5HM2A 1ELDE 1HAVA 1PQ7A 3OU0A 2VIQA 1GJ4H 1EX3A 2PFEA 1BBRE 2ZDMA 1H4WA 4F4OC 4PROA 3SU3A 1FPCH 1C5SA 4U32A 1A5HA 3A8CA 4D76A 1E36B 4IN1A 4IMQA 1K21H 3SZNA 2DE8A 1PPHE 1BJUA 3M61U 2A4GA 4RSPA 2BY9X 1IQHA 4RKJB 1TNGA 3PMJA 3KGPA 4CRDA 3L3TA 1N6XA 1A0JA 1TNLA 1D3TB 1NU7B 3MNSA 4FUDA 3ZZ5A 2WPJS 1SC8U 1NRSH 1T31A 2SFAA 1HJ8A 1TX6A 2QXHA 4I31A 1KDQA 5EXMA 3SU5A 1O2XA 1XUFA 1ZHPA 3V13A 2GTBA 1CT2E 2Z9GA 2ZU4A 1JMOH 5JB8S 4MPXA 3TNSA 2Q1JA 1CO7E 1GBJA 3AW0A 2XW9A 2Z94A 1EZUC 1B7XB 3R3GB 2QXIA 1O3DA 2GP9B 1GJAB 1ZHRA 3S7HB 1NY22 4K3JA 1ZLRA 1AWFH 1AKSB 4BNRA 7KMEH 1TPAE 1TNIA 2ANMH 3ZVFA 1GJ9B 1GJ6A 1ARCA 1LDTT 1F0SA 4I8GA 5FBEA 1O2WA 1W0YH 4YT7H 3A81A 2AGIX 1O2ZA 1J16A 2ODPA 1JRTA 4AYVB 1O35A 3S9BA 1G3EA 5H4IB 1TGBA 2P93A 1O3LA 4XOJA 2UWPA 1ETTH 4YM9A 1S0QA 1MTWA 3BV9B 1O2YA 4LZ4B 4BAMB 4CBOA 1MKXK 1C2EA 4TY6A 2BOKA 2BDYA 1BA8B 1H9HE 1GJ5H 2BTCE 1ANDA 1FDPA 1C1SA 3EDXB 3H7TA 1EPTB 3NPSA 2SGEE 1Q3XA 1LKAA 3PMAB 4DVAU 2NU4E 1Z6EA 3AASA 1GDUA 1FPHH 1LO6A 1DICA 1WQSA 1OWDA 2C90B 3V0XA 2HNTF 1MBMA 2V3HH 2G81E 1CE5A 3M37A 3HK3B 1V2UT 2P16A 4Z0KA 2J95A 1GI9B 1AVWA