7PCYA

The crystal structure of plastocyanin from a green alga, enteromorpha prolifera
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
b'AAIVKLGGDDGSLAFVPNNITVGAGESIEFINNAGFPHNIVFDEDAVPAGVDADAISAEDYLNSKGQTVVRKLTTPGTYGVYCDPHSGAGMKMTITVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
molecule tags Electron transport protein
source organism Ulva prolifera
publication title Crystal structure of plastocyanin from a green alga, Enteromorpha prolifera.
pubmed doi rcsb
total genus 24
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1989-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 7pcyA00
1JZEA 3FYEB 4YSOA 3EHBB 1JZFA 2QT6A 1J9RA 1MDAA 4HALA 2X88A 4KO6A 2JKWA 1SF5A 1JZIA 3IBOA 3HB3B 2UXFA 4YSUA 1I53A 2I85A 4HCGA 1SDDA 5I5IA 3ZX1A 1JERA 4P5SA 2AANA 4F2FA 2GB2A 4Q89A 5F7AA 1JXDA 3T71A 3T6ZA 1L9PA 2NRDA 2XV3A 2YAFA 5B1BB 4E9QA 3L45A 4JKNA 1JZJA 3NP3A 1M56B 2XYBA 3UAEA 8PAZA 1ET5A 4CSZA 2WSDA 4JHVA 4KO9A 5I26A 1W6LA 4K9JA 3FQ1A 3NJMA 5B7FA 3S8GB 2OCCB 1V10A 1XMEB 4A2DA 4DP1X 2P80D 4AKOA 2IH9A 4NERA 2HXAA 5B7EA 2BP0B 2ZOOA 3X1GA 1F56A 1WS8A 4E9RA 1SF3A 5B1JA 2H47C 3H56A 3GYRA 3WIAA 3FSZA 2BZCA 2XV2A 2BHFA 4F2EA 1W8EA 3NJHA 2J55A 1R1CA 2XLLA 1KGYE 2EIJB 2VMJA 5D4HA 4KNSA 4E9SA 4HCFA 1OE2A 2DV6A 9PCYA 1RZPA 1PNCA 2XWZA 5A7EA 2MRYA 4N8UA 2PP9A 3QJRB 4KOCA 5AZUA 1PLAA 1ZV2A 2B08A 2BW5A 3AG2B 4HAKA 5I5MA 1NICA 1L9OA 1M57B 2FQDA 2IAAC 5AFAA 1GW0A 3N2JA 3QPKA 2PP7A 3FSVA 3TA4D 1KCBA 2FT8A 1JXGA 3QJUB 4NAJA 1KBVA 3FU7B 1GS6X 5B3SB 3FQYA 2Q5BA 1KCWA 2R7EB 4FAAB 1OCCB 2DWTA 2YAEA 4GP4B 4G7SB 3AG3B 1PZCA 1GS8A 5B1KA 1GY2A 3FU7A 1SJMA 4BXVA 2QDVA 1AG0A 2VW7A 3OM3B 2JFCA 1SNRA 4DP8X 1HAUA 1J5DA 3NP4A 4E9VA 4YSCA 2Y69B 3PXLA 2PLTA 3CG8A 1JZHA 4KO7A 2CAKA 1TU2A 4DPAX 1UATA 5FC9A 1AANA 1B3IA 3FQ2A 4AKPA 4CSPA 2HRHA 1AZBA 2P80A 1OCZB 4YSAA 5I5JA 1RZQA 3NJIA 1KDJA 1ZIAA 2W88A 4ZK8A 1SHXA 1NIDA 2QPEB 1L9TA 4X4KA 2XXGA 3NSFA 4UF7C 4E9WA 4KO5A 7PAZA 3NJJA 1RCYA 5B1AB 4GP5B 1MZZA 1E67A 2AFNA 6PCYA 1JZGA 3S8FB 3DIVA 1L9RA 4GXFA 2XVBA 2YARA 1CURA 2PPFA 3UAAA 2LLNA 1GSKA 3FS9A 4A2HA 3NYKA 1NIEA 2HZHA 2JXMA 4DP4X 1ILSA 5B7MA 3WKQA 2EIMB 4G7RB 1ASQA 4M4RB 3V9EA 2IWKA 3GXUB 4DPBX 1BYOA 1AG6A 3ABKB 3AG4B 1VLXA 2BWDA 1JOIA 2VN3A 4YL4A 1V54B 4YSPA 3FSWA 1BEXA 1JVOA 4W9ZA 3S3DB 1J5CA 4YVUA 4YSSA 3JTBA 2Q9OA 4G71B 1PLCA 1SFHA 2IDFA 3IE9A 1ASOA 1J9SA 1E5ZA 1KDIA 5TK4A 4AKQA 3N55A 3FSAA 3UGEA 1AZNA 1NDTA 2A3TA 2AZUA 1M9WA 3WNIA 4YSEA 1OCRB 2H5UA 3ABGA 3OQRA 1WS7A 3S3BB 2IDSA 1CYWA 4HHWA 4PCYA 2GC7C 2B3IA 2HX8A 3PAVA 3BVDB 2DWSA 3CDZB 4G70B 3UABA 2GIMA 1N70A 4DP2X 3TBCA 1SHWA 4BWUA 5I6MA 4DP9X 3KW7A 3ASNB 3SBRA 5I6LA 1A4BA 2VM4A 1AIZA 1XB3A 3TASA 5TK2A 3U25A 1T5KA 3C75A 1BXVA 4HHGA 4QLWA 3V9CA 2GSMB 3ABLB 4E9XA 1A4CA 4BWWA 1A8ZA 5I6OA 1A4AA 3CVBA 3IEAA 1ETJA 7PCYA 2X87A 1E30A 1HFUA 1KBWA 2EIKB 1NIAA 5B1JC 4NB7A 4JHUA 1FFTB 3CZUB 2YAPA 3OMAB 5I6NA 2FT7A 3ABMB 3MBWB 1NWPA 2R7EA 1OE1A 3CVDA 2VM3A 4M3HA 1NIBA 1JVLA 3QJTB 2GBAA 2E86A 1PZAA 3T6WA 3NT0A 4DPCX 1L9SA 2PPDA 2UXTA 4TXVB 3AG1B 4A67A 3PLYA 1EZLA 1ASPA 2PCFA 4WKXA 4BK5C 4FA7B 1OV8A 4GYBA 1PNDA 1SFDA 2HX7A 4BDVB 2FJSA 3NJGA 1TEFA 2XX1A 4GP8B 6PAZA 1QLEB 2I7SA 3HEIB 3G5WA 3PAZA 2HRGA 2UX6A 1BXUA 2CCWA 4GY4A 2BP8B 2UXVA 3WG7B 2IWFA 3EF4A 2IH8A 5I6KA 3T6VA 1XB6A 2BW4A 4KNUA 5IY5B 4G7QB 1ID2A 1WA2X 3SQRA 4E9YA 3NSCA 2BO0A 3FYIB 2BWIA 2YXVA 3PPSA 1AOZA 3WKPA 4RH4A 2PP8A 2EILB 3T6XA 1CUOA 2VW6A 1GS7A 2GC4C 2CBPA 1URIA 1AS8A 1YLBB 2HLEB 1AS6A 4HIPA 3FU9A 1E65A 2IDQA 1ZDSA 2XXFA 2OJ1A 4MFHA 5D4JA 1CYXA 2CUAA 2W8CA 2YXWA 1SDDB 4YSRA 4DP6X 1PMYA 2TSAA 1PF3A 2ZONA 1XB8A 1ZIBA 2FWLB 2TSBA 4P5RA 4Q8BA 3AZUA 4A68A 4W1TA 2VW4A 3KW8A 1PLBA 3NJLA 4KNTA 1MG2C 4DP5X 5I28A 2BZ7A 1J9TA 3FU8A 1GY1A 2BP0A 2YAQA 3SBPA 4YSQA 3OD3A 1AS7A 4UAHA 3WI9A 3ZIYA 2YAMA 3CDZA 4A2GA 4ENZA 2BP8A 5EHFA 1RKRA 2PPCA 3X1FA 1IUZA 1OCOB 1IKOP 1TKWA 4WTQA 1NTDA 1AR1B 2WO3B 5PAZA 3UADA 1ET7A 2ZWNA 1QNIA 1E5YA 2VSMB 3NJKA 1KV7A 2FNWA 3AY2A 3OMIB 3AW5A 3DTUB 2XX0A 2J5WA 5E9NA 1AZUA 1NWOA 3X2QB 2IDTA 4L0PB 1PCSA 4KOBA 3ERXA 3ZBMA 1QHQA 1WA1X 4AI7A 3FPYA 3JT2A 1BQRA 4BWTA 1ET8A 3CVCA 1IBYA 2H3XC 2YAHA 3QQXA 2DYSB 2DY2A 1AZRA 1AACA 1PAZA 3H4HA 1W6WA 1FA4A 2YAOA 5D4IA 3QJVB 1MZYA 1TEGA 1AAJA 3FPXA 1J9QA 4G72B 4PAZA 1A65A 2HX9A 1ZPUA 1X9RA 1GR7A 3QJQB 3X1EA 5I6PA 2XU9A 3H4FA 3EH4B 5LDUA 1OOWA 3ASOB 2N0MA 1KYAA 3TU6A 2IDUA 1NPJA 3D12B 4E9TA 2QPDB 2QDWA 3ZDWA 2DYRB 2XV0A 1AZCA 2GI0A 3BQVA 3EH5B 5F7BA 1PZBA 1NIFA 1NINA 1OF0A 2PPEA 3S3CB 4AZUA 3MX0B 3EH3B 1N68A 1DZ0A 2Y1AA 1X9UA 4A66A 1BQ5A 1CC3A 2FQEA 2UX7A 2ZXWB 2FQGA 1BXAA 3QJSB 4DP0X 5AKRA 1MG3C 3RYMA 2WO2B 2IWEA 4A2EA 4YSTA 4DP7X 4EF3A 1OE3A 1A3ZA 3X1NA 3WNJA 3IN0A 3UACA 2OV0A 3NSYA 1EHKB 2FTAA 4HZ1A 1AQ8A 3TBBA 4BXSV 1PY0A 2MTAA 2FT6A 3PCYA 1DYZA 2RACA 4A2FA 2I7OA 3X1BA 2EINB 4AX3A 3NSDA 3NJFA 1HAWA 1GYCA 3DKHA 3IN2A 4QKTA 1JXFA 2YQBA 3FT0A 3T9WA 1FWXA 2J56A 1V55B 4BDVA 4YSDA 1ILUA 4YVNA 1NZRA 2J57A 1NPNA 1WAEA 1ZDQA 1BQKA 1BYPA 3NJNA 4N4YB 5PCYA 1BAWA 2XUWA 2CALA 4UANA 2PPAA 3PAUA 1ADWA 1L9QA 2CJ3A 2FQFA 1IBZA 4F7KA 1IC0A 2UXGA 3GDCA 5ANHA 2GHZA 4HCIA 2AZAA 3SBQA 1WA0X 2VSKB 2AVFA 3OMNB 2PCYA
chains in the Genus database with same CATH superfamily
3TM6A 4XI5D 1N19A 5EZJA 3INOA 5LCVH 1J11A 4CNIA 5J11B 4HIEA 5TQ0H 1QFWH 3LZPA 4RAUB 3TBTB 3E3QE 4F8TA 1BWMA 2P5WD 4PV8B 5I17A 5JPNC 4MB4A 2XWJA 1CXFA 4XVUD 4UBDC 4HIEB 3CU1A 5FO7A 3OZ9H 2IGLA 4PRPB 4EUPG 1HQRA 1U3NA 2Q87A 1YC7A 3QXTA 2EKJA 4Z5RA 2KUTA 5IG7A 1LO2H 2FX8L 1JXKA 3MA9H 2WUBH 4HS3A 3E8UL 1A9VA 5FLUA 4HWZA 1QZNA 4NZRL 5GGTA 4AYGA 2NDFA 4NQTA 3KPPA 2PYED 1NGZB 3GLDA 1RH8A 1MXGA 3MLRL 2AMGA 3KGSA 1YNTA 3AU0A 1B0GB 4U1LA 4W9IC 1JPGB 5FO8B 3FQ1A 1JGDA 4D8OA 1T1WA 1E7VA 1NBZB 4GAJH 1BEYL 1XTMA 2WXLA 3S8GB 4Z7WB 3KPQB 4HWEH 2V7HB 4QRUB 2WUCL 5JIQA 3P9MA 3RY5A 2D73A 4LVNB 4E9RA 4L4TE 1DCLA 5DRZA 4TPRH 5DC0A 1UM6H 2J55A 1FO0H 1OAUL 3S0PA 1VFMA 1DBJH 4HEME 3HZKB 5B39G 2EIDA 4N68A 1NCBL 4S1QL 1T6VN 3MJWA 4PV1C 2Z1KA 4F7EB 3EYFA 3PL6C 4V33A 3IMBA 2DQUH 1ZV2A 5GSVA 5DWUH 5T3XH 1NICA 1OGAD 2M26A 2R0KL 1BSIA 3FKUS 2MCPH 2MOGA 3LS4H 4L29B 4PM1A 4ONFL 2QMJA 2KS0A 3IWVA 3QJUB 2YA1A 2BIOA 4P06A 1MFBH 4EDWH 3VXSA 4FI6A 4PRBA 3UERA 1GMEA 4NQDE 2GTQA 4RMWA 4XP6H 5E9DA 3RVTD 5HHXL 1TQBC 1AI1H 1NFDF 3L16A 4QT5B 2XPGB 1S7QB 3PGDA 4JFVA 3N1PC 2E6PA 4NIKB 3BQUC 3TO4C 4ZBJA 4ABVA 1VIWA 2VITA 2XWBA 2UWEF 3MLTB 3TIDB 4JMXA 4X8CA 3TBWB 5JDJA 4KXDA 3EFOA 3PL6A 4M7ZC 4I77L 3L54A 4KDWA 4LVHC 4UQ3A 3QS3A 2FJHA 2NXYD 3ZOAA 3RDTB 4C57C 3DRTA 4X4MA 1OGTB 4LIQH 5CWSA 5DCCA 3ZKXC 4AKPA 3W39A 3JYBA 3GSOA 1QHOA 3EJUA 2NUPB 1ND0B 1OCZB 3IGUA 2VLJB 3HJ0A 4KZ0A 5EBMB 3ZE0F 5ECGA 2AV1B 4ZFOL 2C9RA 3IK2A 3D39B 1WGVA 1EFXA 3SDXB 2XQBH 3C8KA 5AB0A 1A1NB 3LXCA 3NZ8A 5IBLD 1MWAB 4ODWA 4QXGL 4UAOC 3NFSL 3ZR6A 2VQTA 4GSUA 4XVSH 3D08A 5DHVA 3TN0D 3IMRA 3TVMD 3WE6A 4Y16D 3ETSA 5BRZD 2F7PA 3BKMH 4PJGB 3ESNA 1HN1A 5JOPE 2YGNA 1PZSA 2CBMA 2WVVA 5J6GA 3HUJB 3IWUA 3QEHB 4RGOH 5AUMA 2EAEA 5DUPL 1YEIH 1TFPA 4DEPB 1PZ5B 3U30C 3RLSA 3F7YA 2W0FA 2CSPA 4N2MA 2GW5A 5EOTA 4LRNL 3UTQB 2EDXA 4P3DA 1X4ZA 1KGCE 3CLEL 4WGWB 5C3IA 2OMXB 2VZOA 2GBTA 1H15A 2VCOA 2Q8AH 3BE1L 2VIRB 1JTOA 2WNKA 4PRHD 5D2NB 4DETA 5D1QB 3WFDH 5BZWA 1ETB1 1KLGB 4Z0BH 2NDGA 1MCPH 5JHLL 1KENL 1H15B 2WLJA 3RHWK 2IAMD 1XF1A 4JG1L 1AQHA 4NAMA 4P99A 1ZGLA 5HDBE 4HSCX 1IL1A 3VE0A 1J5CA 5B8CB 3D05A 4X4XB 3WHE1 3UPRA 3C5JA 5MEPB 3AVEA 2X53A 4LL9A 4MDIA 4IBZA 1A5FL 1GYWA 2VRKA 4KAQL 3RKDC 4CA4A 4HJIA 3TFKD 4HBCL 4EIBA 2X6BA 3D5OF 5AAMA 5DFVC 3F04A 4QOKB 5HP5A 4OB5L 2HAZA 4I2XA 3FCSB 5FUOL 2H2SC 3MV7D 5DUBB 1ZHLA 2X6AA 5L6YH 3W9EA 3EDEA 1BJ8A 2XZAL 3LJ3A 5DJ0B 3P11H 1ZLSH 3U4EB 4M8QA 2FBJH 1EXUA 1A66A 4NENA 2EDMA 4QWWD 3QO0A 4N20A 4ZUVA 3SE4C 4AMKH 4PJIB 5FM5M 1BLNB 5F1NA 1CF8L 3TPKA 1QI3A 4DP9X 2WXHA 4UM9A 3CDGA 5HDBB 5I6LA 3F7VB 3H42H 3QUZB 4O4YH 6FABL 1OSYA 1WHOA 3LIUA 3QPXH 3ZE0E 3HE6C 2B4CC 3OXRA 1L6ZA 2PR4H 2E27L 5CJXC 5K9QG 3V4UH 1A8ZA 1MREH 2J12B 5AVUB 1YNKL 4AJWA 4PJEA 1AQDB 3IFNL 1GVIA 4AQEB 1KJMB 4PVLA 1RIHL 3RWCB 5HSFA 4NQCD 4JM2D 2KZKA 4CILA 4WHCA 2E6JA 2VZTA 1B2WL 1T2QH 3FFDB 5D2LA 3MV11 2XBZA 2ZSWA 4WNQA 2BY2A 3ARDC 1MHHA 2PPDA 5HTSA 1U36A 2HKFL 1W72A 4LSRL 3C8KB 3PJSB 1KXVA 4MNGB 4MA8L 4Y4KA 1PZ2A 2KI6A 5H2BA 2FX9H 1CLOH 5CIPB 4PBVC 1VGEL 2COQA 4QTHB 1TTAA 5CBEB 3T1FA 2AK4A 3ZKMD 4R7NA 5HI4D 2BIIA 4ZFOB 1YUKB 4ODVL 4NM4H 4D94A 5DHMC 2VXQH 4NUMA 2NX5D 1CIUA 2OYPA 1VRSA 1NOFA 3ZHLA 3JVGC 1K3IA 4QGYA 3MREA 2PTVA 2W9LA 3EJYC 4APQA 3MV8D 3VRJA 1IC4L 1Z6JT 2W0PA 1AO7A 3VW3L 1MNNA 4HUWB 2GEQA 3F7QA 4XPBH 4ACTA 4HMDA 1KYUA 1IAKB 1ZA6B 2QL1A 2VLKE 3PWVA 5H94A 2FGZA 3FO0L 3CGTA 1WZLA 2YRLA 2APFA 4UT9L 1YYLL 3GMRB 4FMVA 4WI0B 4HOWA 1JHTA 3QI9A 5C6PB 3VFWA 4WFEE 1HQRB 2O5XH 3FUJA 3UBXI 3X3GL 4BEIA 5BUPA 3PP4L 2C3GA 1A0QL 1F0LA 2ZCKH 1EFQA 5FHBH 2J2ZA 3U9PH 5HYQA 1OT4A 4XPFL 2Y9RT 2TSAA 3W82A 4F58H 4CN6A 5DSCB 2WZAA 3U36A 5EU6A 3JWNG 3EJZC 3ZMEA 4J8RA 1IVTA 5BW7A 3A47A 3R8QA 3VD7A 1HSAA 3I6LE 5FYJL 4BK8A 1GGYA 3KPSB 4DQOL 3K6NA 4TSBL 2YK1H 4L2YA 5LG1A 2D8KA 4FI7A 4TLUA 2VDQB 3CD4A 2VM9A 3O6LL 3BUTA 1GY1A 4LEXH 3ZDYB 4PP2A 4F7CB 4NC0B 2HVJA 1J8SA 1MCKA 1FIEA 1BQLL 3RWGA 4BINA 5T1KB 1F6AA 5DD6B 4FYQA 5DXWA 5EFIA 1CU4H 4L8DB 4OCRH 3U2IA 5I8OH 4HU2A 3EYVB 3DX0A 4FQXA 1Y6MR 5TE6H 3CLFL 4OJDH 2C1PA 4DW2H 5E9NA 3HBQA 4GW4A 1IBGL 2V8MA 3ETBJ 1WA1X 3BPLB 1R19A 1HINL 5B39A 4YLBA 1AGEA 1N7MH 2V4LA 3G08A 3IJYA 3IDYB 2XWCA 2BSBA 3CVIH 4JREB 1G0YR 4M93B 3LEXB 3U0TA 3ZE1B 4NO2A 1B2YA 2LFEA 4O5LL 4WI3A 3BWZA 4YHIB 4AYFB 1FGVL 3RY6C 2VQUA 1E3FA 3ARED 1CF8H 3O4LB 3T5WA 3SCMD 3N6YA 3NJVA 4RETB 4AZ8B 3KXFA 3PWJB 1ZMYA 2HTLC 3RWIB 3AM8C 5CEZE 3MRLB 4YNYA 3OJMB 2YFNA 1BJ1J 4OH2A 3RZCA 1UXSB 5J1AA 5DJAA 4CVXA 3B56A 4BUGA 2PYEA 2VDLB 4QF1B 5F7KC 4OU3A 4X7SL 1A3QA 4GEIA 4P5KB 2UV3A 4DK5A 3LKNB 1NCAL 1GZQA 3ILEA 4M9OA 1VENA 3WKYA 5I1LA 4UYPA 2KMWA 1RZIA 3CHPA 5KYUB 5FKAA 3HC2A 4KXAA 4Y2NA 5CUSL 5BO0D 5DJ2A 2PPEA 1MCJA 4P57B 5AOJA 3ZDYE 5BQ7B 5C0DB 5A3IC 1FIGH 4X8JB 3JWNH 1BZEA 4LLYB 2D7QA 2HRLA 5EUOF 1L7TL 4LU5H 4X9GA 4YR6A 4A2EA 2WCSA 2ZOWA 3O2WH 2UWEA 4JFDA 4MXVE 2XNAB 3U4AA 2MKWA 1S2EA 3GRWL 4HZ1A 5AVYB 3ROLB 1UB6B 2R2HA 3DX6A 5F88A 5L0QC 2FJHB 4U6YB 1CI5A 3NSDA 3NJFA 1OCWL 3HCVA 3ZUNC 5F88B 4XCFL 4BZ1A 2IPUG 2AV1A 2XTJB 1YQVH 2CIIA 5GGRB 1KTCA 4BFKA 2DQHL 1VB9A 2RD0A 4HFUL 1NPNA 4HK3N 5GIRA 4XP5H 2YPLB 4PY7A 2I60L 3L6FB 5JPNA 3C09C 5EUKA 2YD6A 2DTML 4FG0A 5E9DE 1KULA 2VUOA 2DIJA 1OB1A 5CCGE 2BNUA 2GJ6B 3HUJF 1ZHBB 4FXKB 5KYXB 1G9EA 1UZ6E 2XQBL 1F8TL 1IBZA 2UY7B 1JMZA 4MJ6A 2ZOKB 1HWGB 5DJ6A 4XNDA 2WYZA 5H4YA 3SOBH 2J88L 3PE9A 3NFSH 4MMXC 3HS0B 3NEOA 1HL8A 4Y4HD 2DJUA 2C8NA 3QW9A 3ATAA 1M7IB 3VCLA 2Y2WA 1BVKB 4RMSA 4KQ4L 2ZX5A 4IS6B 2PETA 5EU7C 5IK3B 5C71A 1NCCH 2C4XA 2X6VA 1HILA 1A6ZB 2UVFA 5HGDB 4FCHA 5TE4L 4OM1H 1P5VA 1P6WA 4Y2DC 1JZIA 3GS7A 3LN5A 2GKIA 4PGDA 5ILTL 1UVQA 4FFTA 4NHCL 3IJEA 3QDMA 3S36H 4L37A 3POCA 1CT8A 3CZGA 3KGUA 4CBZA 1WTGT 3NAAH 3QEGL 1R5WA 3QE5A 2E7LC 1XEUA 5FM5O 3ULVL 1ZTXH 4J1UA 2FX8H 4MCNA 1IGML 1BV8A 2WINA 3LQZB 5DHDA 3QORA 4BZ2H 3JV5A 1GMIA 1ACZA 1A7NL 4MMXB 4XT1C 3CZKA 4Q2ZB 1ZKAA 3EJQA 3VMNA 5E4IA 2FX7L 5MEOA 2WBJD 1TJHL 2FSDA 4YDZA 3O0RL 5DRZB 3UDWC 3QUHA 1P6AB 2XOTA 2CKBB 4AEFA 2EH7L 4FE9A 1HXYB 3QIWC 1CLCA 3A4FA 4OZGF 2VL4A 4J3XA 2OP4L 5EO0A 1IQWH 4F8OA 2V7HA 1XQ4A 4POZC 3T65A 5ISZE 4RFOL 4FNRA 5HYSA 3B43A 2MFNA 1F11A 1MNUH 4EDXA 2FYYA 3PV6B 5HHOD 2XLLA 2B16A 8FABA 3KR3H 2VMJA 1S7RB 4NNYA 1L5GB 2WN2A 1WDAA 3BZFA 2VZ3A 1F41A 3ARZA 2EJ1A 3CFEB 1NFKA 2MHAA 1YC8A 3IDYC 4M93C 1XSJA 3RVXD 1L3WA 4HAKA 4UNVA 2A6KB 1B9KA 3LX9A 3SYAA 3NZHH 3UTSB 3S5ZA 2WWMD 3RPIA 1GW0A 4JPVH 2PP7A 3KS0J 1R17A 3CC1A 3Q8EA 5KJ4A 1MDTA 5ACZB 1BPVA 4J8RB 1YQ2A 2R7EB 3TX4A 3BUQA 4WJ5B 1OCCB 1F4YL 1RFDL 1G7MB 3W37A 1MHCB 3S34H 4FJZA 5EIQA 3RTQD 3K4AA 2YC1A 4GI6A 1JG9A 1CFSA 4IU3A 4HG4J 5JOFB 2PW2B 4JFEB 1U3HB 3SN6N 1P9MC 2ZOLA 3L5XH 4APQB 4G5ZH 4N87A 3QXDA 3N85L 4FXGC 4MMYA 3LH9A 3ARVA 4NRZA 4I1NB 5JQ6H 2I69A 4KPHL 3DO7A 4Q9BA 4HKJB 3OSKA 3B9AA 1QRND 3KPNA 4TKWA 1V3JA 1FL5A 4J23A 4L1BA 4LASH 3IJ7A 5D1QD 3QUML 2R69H 4NFCA 1DVFA 4O2CB 3GBEA 1LO4L 2WXRA 4M56A 1RZQA 1TCMA 4NJAL 4L2LA 2BNQE 4Q9QH 4LAQL 5KVDE 2PO6B 3GQFA 1U3HC 2WQUA 5KVEH 1V5JA 1IMHC 4NQCA 2ZNXA 5JDSA 5FM4A 4UF7C 1C5BL 4Z7VE 7PAZA 1FZMA 1MHPH 1Q38A 2AQ2A 1VADA 2HVKA 4F27A 4K07A 1WTLA 2P9RA 4QXUH 1MQKL 1FZOB 4FQHB 4MKTA 5D96C 4BZ1H 2FJGB 6PCYA 4LSUH 4MNGA 3S8FB 3CFDB 1DBAL 2I60H 1UWXK 1GAFH 2YARA 4XCYA 4JZJA 3O8XA 4KKBC 2O5ZL 3UAAA 3P3TA 1FYTD 1XGPA 1N5YH 4L9LA 3VRLF 1UT2A 1ZT1A 4G9DA 1ADQH 1MJ8H 3VXRD 2H26A 2DQHH 4W9CC 4OD1L 2HT2C 2RALA 4PGJA 4HF5H 5E0FA 3PP3H 4R97B 4JZOB 1SN2A 5DK0A 3W1ZA 1Q0YH 1ULVA 4ANVA 4U1SA 2CK0H 5FB8A 1ZT4A 4FHBD 5SWZA 2GBUA 2J8UF 2QSQA 1PJ9A 4X7TA 4OR1A 2EE6A 3ZRFC 3S4SA 4L0YA 2BWDA 3G5ZB 2IAMA 4CMMB 4BFIB 4NKDB 2CHWA 1VFUA 3QWRD 1IEBA 1G1CA 2ICES 2XA8L 4G71B 4DNLA 4M7LT 1LO3L 4OJFH 2CDGA 4OLEA 4Y19E 3RP1A 4UTAL 1AH1A 4ZTOH 3MLUL 3VXUD 3KHOA 1E5ZA 3L1FA 3CU7A 1BVNP 3EOBB 4HCRL 5D7EA 4PVBA 2VSDA 4GAAA 3D4GA 2CDFB 3GD1C 3T2NL 3GMPA 4KITB 2ODHA 3NA4A 4NX0A 4UM8A 3QC6X 4TSAH 4YSEA 5FFGA 4AYDC 1RK1B 3OQRA 3WXWL 5I66A 1XCXA 4YEFA 3UGXA 1QKZL 3C6LA 5FPIA 2ICEC 2Z92B 4HXBH 2QVMA 3ALWA 3HBPA 2GG1A 4U1IA 1AD0A 1OM3L 3LNEA 4OLWH 3ARFB 4TRPL 5KANG 3KW7A 3E1F1 1BQSA 4GKSA 3SDCC 1PKQB 4ODSH 1F86A 3H3KA 1TVHA 4PJBE 1T6WA 2WTOA 2LGNA 4AITA 1DQQB 3VXQB 3BCDA 4JHAH 5KANI 3QG6B 3V9CA 1WD9A 2W92A 4X8JA 2ADJB 1X4YA 4ZJ9A 3DTXB 4TUOB 5FK9B 4K8RH 1N7ML 4IIZA 2Y1VA 3PP3K 4YMPA 3IRZA 1JMXA 3ALPA 3FT1A 3IPFA 1KBWA 1H5BA 1YHPA 3NVQA 5E70A 4EN3A 4GT7A 3EXJA 3LRSA 2ICEB 2VLJD 5BVPH 1WP6A 3MRQA 5AB1A 2ZXBA 4YK4C 1CDBA 3ARGB 4GBXB 1YUHA 3UP6A 3IJ9A 3GHBH 1OE1A 2B59A 1ZT1B 1A6VH 3CVDA 3FONB 3KPRB 1CPUA 3QJTB 4JANA 3KPSE 3MXVH 4OF7A 3T6WA 3HC4H 3NT0A 5F8RC 1TTUA 3IJSA 2C3VB 4XOCA 2VLMD 4JGNA 3B34A 3VD3A 5D2LE 4MX7A 5GZNC 4GAYA 1EZLA 3CPLB 4XH2A 1HXMB 3DK0A 2KKQA 1FZMB 2OJZH 4W4OA 5EU6B 1KV3A 4LO9A 5DT1H 5HVHB 1NFAA 3OJ2C 4MX7B 1RUKL 1CDUA 4AQ1B 4LSPL 5C0IA 3UDWA 1YAZA 2EVIA 2XSKA 4WW1B 2CCWA 3HBZA 3OB0H 2BX5A 4P59H 1IM9D 3U7YL 1CFNB 2O6FA 2VDKH 3SDDD 1BG9A 3BKCH 4WV1C 1CZ8L 4NKQB 2ZICA 3L3JA 1I8IA 3NABH 1Z9PA 5ESQA 1KIQA 4NKIH 5IY5B 1TSRA 2E46A 4G1EB 4HIIB 3KPRE 3WO4C 4E9YA 1VEOA 1MEXL 3R06A 2NR6A 4PRNA 1E50A 3VD5A 2G3MA 2EEXA 4OFYD 5FB8B 2BWIA 1HE7A 3O3AA 3V0IA 3AWFA 3P02A 1BQUA 4P46B 4PJDE 1EVUA 1FNLA 3FT4B 2Y07H 3G5ZA 4CMMA 5EULV 3P9WB 1RP9A 2Y72A 2X4SB 4PJDA 1SLUA 3RVWC 3OHMB 1CGSH 5KSBF 1M7UA 2X9XA 2XXFA 5J11C 3S96B 1PKQA 3EGDB 2VISA 1MY7A 1KYFA 4Y2DA 1KEGH 1MY5A 1CGWA 1M2VB 4KI5E 2ZX8A 3VX1A 5C86A 3HPLA 4MNGE 3V8OA 5L2KD 4KVCL 5HGAA 4EI5A 5BCAA 5KJRL 2FHCA 4Z23A 4KKLC 3U0WH 2DD8L 4TYUA 3MBED 2HFFB 2IFGA 3I9IA 3QNZA 2QVKA 4W1TA 1TZOA 1CQYA 4F5CA 1CTMA 3ILDA 3Q1EA 2V5SA 3I50L 1GGIL 3SPVB 5F6IC 2P42B 3DTDA 5DVKA 1ZWIA 4W9FC 4UAHA 1AS7A 3LEYH 5DJZA 2YAMA 1J1OH 1KXHA 4P4KA 2HKFH 1DQKA 8FABB 2A0LD 5IQ9A 2JI3A 2KLSA 3MUGA 3K6SB 5ABZA 3WIIL 3VTAA 3AUVA 3JTTA 3RGVA 5T3XL 3BISA 1NC4D 5AVTB 4AIXA 1E5YA 5DFAA 3CSPA 5DFTA 3QZBA 4TOYL 4QDGA 3H7BA 3MYZA 2W60B 1I1AB 4ZMWA 2Q7NA 1I8LA 4KHXH 4BWTA 4DSYA 1HINH 1A0QH 2ZCKL 1MFCL 1QFUH 3WNNA 1X7QB 5I1CH 1G7MA 1DQLH 3N0PB 1B0WA 1F58L 4X5QA 1IAOB 3VXRE 1I9RH 2NZ1A 1SJHB 1EGJL 1TEGA 2B8OT 4UOW1 1RVFH 4XMTA 2GIYA 4PVMA 4UQDA 3KS0H 3FFOA 4QTIH 4APXA 4R7DB 2AJSH 5LDUA 5CJXA 2N0MA 2QBWA 1YMME 4PTUB 4K2UH 4UZUA 1OAXL 1ED3A 2BLFA 1RU9H 5IOPB 4HX1A 5TD4A 4QYAA 2OKMA 3ATEA 5TE7L 2XV6B 4XZUA 3RPKA 3OBAA 3OLEA 3AADB 3ETBF 2PW1B 4H8WH 4BJLA 4E41D 1FUNA 4G42A 4DO4A 5FS5A 4UDUA 2NZIA 4WDIB 1F3DJ 5LGHH 1CBJA 2OX5A 3FBKA 4PJXA 1MCSA 4F15B 4NRYB 2YQ2A 2VUYA 5KYXA 5DMYA 1NGQL 5D1QE 4A66A 1KNOB 2D7NA 4Z7QB 3E2HC 1JGUH 3RNQB 1ZHLB 3GS0A 5F7EL 5HYEA 2H1LM 2MPAL 1QRNE 4FJ6A 1Z3GH 5AKRA 3HI6H 2BNQA 2DJSA 1OE3A 4K8RD 4PI2A 3WNJA 2A6KA 1FNSL 2KQMA 2WP3O 4Z7QE 2OV0A 3SE8L 1UYWH 2P45B 4P46A 4EIUA 2VE6B 4OLXL 2XN9A 4WWID 3PCYA 2ZSVB 3HW7A 3QRGH 5DJ0A 4UQ9A 5IJKA 5F3BB 3JUZA 2X4PA 3DKHA 1QTSA 3QPQD 3LPPA 3SY6A 3GZPA 1PX3A 5AB9A 3T9WA 1FWXA 3T1FB 3N43B 1Z5LA 1TO5A 2ZXGA 4PJHE 5M94B 3DUUA 3MRDB 3BN9D 3QP3A 4G11A 5KN5B 1DBKH 3NCYP 5E8DH 1K4DB 4YVNA 4M6MH 1Y18B 5DRNB 1EZSA 5PCYA 4U1HA 1IBHA 1U3JA 1WBYB 3Q5YA 4PP1D 5IFHH 2IBZY 2Z4QB 1P53A 2BINA 2FWSA 1RZKL 5CZKA 4X8XA 3NDZE 5GGTH 4N0UB 2UWEE 4JFDE 4LLDA 1J18A 2FQFA 3WN5B 1ZD6A 5C0CA 1E42A 2ARWA 3GDCA 1NCHA 1H8OA 4J3BA 4WV1A 2F53A 3STZB 1XGRA 2DQEH 3NIDF 3GRWA 2K9UA 4PQXA 3V4VA 2AVFA 3OMNB 3L3KB 3BZEA 5ITFB 3IFLH 3IYLW 3GT6A 3O6KL 5ID0A 1M7XA 3BVNA 3PY9A 4YBLB 5IB5B 3ZT7A 4BM7A 1VEMA 3BP4A 1OWRM 1D9KD 4ORGB 5CFHA 4P2OB 2WLIA 1WBXB 4AEIL 3P73B 4PYGA 5GGUA 3S8WA 1Y1UA 3D39A 3G04B 4FRWA 1HSBA 4NS0A 1DFXA 1JVKA 3MXWL 4FLRA 2EYSB 4ZW7A 2GBVA 3ZKNC 2XA8H 1FAKT 3WUWG 1MFAH 2V3DA 1D9KB 3GFUA 4AE0A 2CK2A 3V0AC 4X2UA 1XGPB 3SD5A 3MUY1 4XN7A 1Q9LB 4I4WA 1XCTA 1XDTT 1Z0MA 2ZD0A 1FCGA 2NYKA 2CHXA 3OAZK 3RURA 1J0KA 2EIZA 3FCTB 4JPIA 3ECBB 4YQXL 3NJMA 1IC4H 3QJHA 4XMVA 2H3NB 1M4KA 3OPZH 4MB5A 4KNQA 4MAUL 1A25A 2NY6C 5I75C 3I2CH 4PFEA 2DQFA 2CO7B 2NXYB 3QJHB 5DURB 2MOQA 2GQHA 5IVOA 1U58B 1A1NA 3NJHA 2XXMB 4JM2A 1R24A 2HJKA 1SMAA 2FECL 5BUAA 4AT6B 1QSFE 1NCTA 3MUHL 4NC1C 4YDNA 1FN4A 4CN4A 4O2EA 2G9HA 5LXGH 4PIRF 4L9LC 5EZOL 5AW4B 2VQ4A 1SVCP 3CLWA 4FNTA 1W72L 2R1YA 1Q9WA 1T22B 4MQSB 3CN2A 4JFWA 4KJYA 4GKZB 2H4EA 1HL4A 4ZX6A 2YR3A 3FQYA 4JL1A 4HK0B 4PTTA 4N0UA 5JOPD 4MNQA 5F9OH 3HMWL 5DQ9B 4S1RH 4LL1A 3RHWF 3TNNA 4QRQB 4NJ9L 3U7WL 4PRHB 3F12B 4IU3B 1NKRA 3L4ZA 4HUCA 4XCYB 3O2VH 3HI1B 3IDJB 2GFBA 4OI7A 3NP4A 4LVHB 1BZ9B 4L3CA 3EHBD 1JZHA 1MW1A 5B22A 1E6OH 5F7EH 3HC3L 3ULVF 4FG6C 2XKNB 4MA1C 4HGMA 3WEBA 5C0AE 5I0XA 4XC3H 2OMYB 2QHLA 5J1TC 2DAVA 4UT7H 3MLVL 4CSPA 1HDMA 1YN6B 3GMOB 1KPRA 3DX1A 1WCQA 5F9DC 5C0RH 3VG0L 1T1WB 3SDAD 4NZ8A 4GJTB 4ZK8A 1B9ZA 4NZUL 4ETQB 3P4NB 4IHBA 4NNXA 3DGGA 4N0FA 4X7CC 4DQAA 5DC2A 5DC9B 5EUOB 4GP5B 4NQDA 1XGUB 3FO9A 5DS1A 2OS7A 3CFMA 3CXFA 1AY1H 1ZJAA 5JQIB 5G4MA 3V5HB 5IHUL 4GXFA 5IG7B 2DEYX 4Z5RB 3RIFK 1IM3D 4TLKA 3RWDA 3WFDL 3UG3A 3F84A 1E9QB 4U1SB 1GKEA 1GSKA 3DURA 4AVKA 3NCFB 5JMRA 2ERJC 3GK8L 3QRLA 2HZHA 5AALA 4RIRA 5EPMB 4NN7C 4FZEH 4ZTPH 3WKQA 2WTRB 1BECA 2AJUL 1UA6H 4M4RB 1JNJA 4F8PA 1WUNT 1CFMA 5I2IB 1VFBB 4PBXA 1WFNA 4DZ8A 2FB4H 1QA9A 2JKIS 3WS6A 2HFFA 2A1WH 3H53A 5F7HA 4YSPA 1DO6A 4NWUL 3QNXA 5L8LB 4OM0H 1UOWA 2XN9D 3AU1B 1XGTB 3B2XA 3WYRA 4URTB 2QKIA 3WJMA 3GBNL 4IS6A 5JIHA 4P2QD 2IDFA 4GUPB 2ZKHL 3EO9L 1NLDH 2Y06H 2FEEI 1CK0L 3NGBB 4M6OL 3VI3B 2SEBB 2XY1A 3R19A 3UG4A 3QORC 1KB9K 3C6LC 3BWAA 4C4BA 3PWPE 1AP2B 1CGTA 3RGVB 1M9WA 5IBLC 2FHBA 1QACA 4LSSH 2ESVB 3ABGA 3IFNH 2YSTA 1OGPA 5F8QC 4CDGC 4ZFOA 5SV4A 4OF8A 4NQSA 2BCKA 2DWEB 1PZDA 4QRRB 3W38A 2WAQA 5GIRB 3DHPA 5AW3B 3P77A 1P7KA 3LVEA 2DQMA 4NAQA 3CPLA 3T0XA 3CHOA 5IREA 3G6JF 1CXIA 4NZTH 5I15H 1JZ7A 3EYQD 2YXFA 3SBRA 5I1CL 1EO8H 2ZAHA 5TK2A 3C12A 5DLML 1I1AD 2O5YH 4HHGA 3L9YA 2ZZUT 3Q0HA 1XL4A 5BS0A 1A4CA 2JKSA 4HD9A 1JWSB 4BRJA 3CVBA 5K5YA 1IM9B 2CD0A 1CT8B 1FZKA 2GIXA 4EN3B 2A9NL 5LQBL 3QR1A 3OXSA 3LRHA 4JUSA 3THML 4MXQC 3VFTB 4ZFFA 3WU1A 2JH2A 5SWSD 1ICTA 3CK0H 3BGMA 1KB9J 1K5WA 2MMXA 4R96A 4AQOA 3S5YA 4N8CL 3AG1B 1WCBB 1QO3A 2H1PH 2G4EA 3VXUA 2OSYA 4H0HB 4I0PC 4HFWB 4Y1AA 4LXFA 1WE5A 2A9ML 3Q1SL 1DVTA 5CEYB 5JHLH 1JI2A 2XX1A 2ADYA 5K69A 4XXDB 3VFMB 3MLRH 1KFAH 4KKPA 5E99H 2QVTA 2VDQL 4PJAE 2K4WA 2VLLA 1CXLA 2AABL 2HLFD 2ZX6A 3FT2A 5HHMB 4CVZB 3D51A 2F0CA 4J5VA 5C2BL 3QQ3B 2ZUQB 2RIKA 5B4MD 5BNXD 3R4RA 1H3TA 2BW4A 2HUHA 3ZKQD 4EI5D 1IAIH 4CVZA 1Z32X 5ABDE 2X4RA 4TNWK 2V2TB 4NZUH 5J6SA 2BO0A 2VN5A 4OT1L 3WENA 1UHVA 3IDUA 4AVJA 3W2DH 3DO4A 4YUEH 1DDHA 5C0FA 1GGUA 2WHVA 4P2OA 4H1LA 2X2YA 2PXYB 4I9WE 1Z9NA 4G8AC 5L6YL 3H0TA 2QV2A 4C83B 5FYKU 2A9AA 3OAUH 3GHPA 4HUNB 4AE1A 5F93C 4LCCA 1OZTG 5D4JA 1JGLH 1QEXA 1XSIA 4IOFC 4URKA 3AREB 4F7PA 3H0TB 1IZJA 3SE3C 3ZT6A 5IMOA 4ERSL 5EZLB 3V2AR 5KOVC 1B4TA 3DPDA 4OD2B 5JW5A 1RK7A 1UXSA 5FHAL 5E99L 2Y23A 2UY7A 1C5CL 4DKDC 5E56A 3BZEB 4QR7A 4ZNEA 3V52H 1WHPA 3TA3B 4BFNA 4P5KA 5CEZL 1BJMA 1TQVA 1IO4C 1FZKB 1QR4A 2UZXB 4YIQB 4XNAA 1FORL 2NXZD 2V9UA 2DLFH 4JY5H 4KTDH 4R5TA 1YEHL 3FU8A 5BS0D 3HZMB 2GT9A 4JRYE 4ORZC 5JPMA 4JN2B 2RQ8A 4K23L 5F9WB 3C9NA 4XPAL 2ZWYA 4YDIL 3FK3A 2Z64C 4AYID 3KH3A 1AGCA 2DM3A 3MJ9L 3QCTH 2WP3T 4L1SA 3SDYL 3UADA 1DN0A 1WZ1L 3HHMA 1UXWA 3U0PB 2FJGA 1IEAA 3B3BA 3M17B 3OMIB 1IGFL 4R2GB 4B9FA 3AW5A 3FHEA 4BFFA 4EBQH 1J0YA 3BGAA 2L7JA 4PWIA 1PCSA 2WXQA 4LLVA 3C08H 3BWUC 1BD2B 2F54E 1SQ2N 3VFMA 5C7ZA 5BZDA 4HQQL 5F7DB 2YAHA 1U9KA 1XT5A 1GAFL 1FVEB 2OXGA 2QADD 5DYFA 1H9VA 4U3SB 2CHZA 3V4VH 1FA4A 3M86A 1LDSA 5TPWL 1NGYA 1J9QA 3L3OB 4AXWB 4YE4L 4MZ3A 1M42A 1ZLVK 1XF5A 3PHQB 3ILPA 5DLMH 3F7LA 3QAZC 4KKRA 4UNIA 4AG4H 3FQ4A 4H88L 4RGMB 5CBEA 3KYNA 2J8UA 4DGVH 4AWJC 1KYAA 5BV7B 4NCDA 1VZHA 4UINH 3TNMB 3F05A 4QHMA 2F9BT 1F90H 2FSEA 4LQFL 5IOPA 5DDHA 3KWXA 3MA7B 5E2UL 3BEVA 4S0HA 3DETC 5HYJD 1L7TH 4DZ8B 1F5WA 1L0XA 2NLJB 4Y1TA 5JQ6L 3GIZL 1BQHB 4APQC 3OKNB 4AM0B 4WTXA 1SUHA 3MACH 2WBJA 1QPKA 4YFLI 1UJ3A 1C5DA 4N2FA 5K9JL 3W39B 2DLGA 4RRPM 1OAZH 1D5ZA 2G5RA 3P4MB 1IAKA 4U6XA 3QJSB 4Z7UB 1E4HA 4DP0X 1FV1A 3NCBB 5GRUH 1MLBB 1CR9H 2FWOB 3ZTNH 4YFEA 3TO2A 2Y4SA 1AQ8A 1GW6A 4M48H 3RJDA 4PS3A 1C08A 4LLAA 2HB0A 1WFMA 4V11A 5F1IA 15C8L 2WMPB 2IANE 1J8HE 2WOYA 2BCKB 2PWDA 3U2JA 2I25N 3GMMB 4W70A 4OIIL 2A6DA 4G43B 3ZU8A 3C5ZA 4YSDA 2KDYA 2EO1A 5DZAA 3RVVC 3UEZA 5IVXB 3U0PA 3L5IA 3ZE1F 4NNPL 1O6TA 1VFBA 1KTBA 2HRPH 2VQ1A 5T3XD 2IBZX 4N1HB 3LNHA 2KLRA 1YEJH 4PWKA 4EUPB 1L9QA 3EGSB 1KLFB 4B3VA 1K8DB 4NT6B 5TQ2L 3BZFB 2R4RH 4WHDA 1E4WL 5E2WH 5C0CD 4R4BB 2OBGA 2RH0A 2PXYC 4M6NH 1UWGL 4JO2H 3UPRB 3BQUA 3RZCC 1MHHB 2HA1A 4LPWA 4YSOA 4CMHC 2HT4D 1JZFA 3RL1A 2YJLA 5JIKA 3MC0A 3WTUA 2GY5A 4Y16B 2JVUA 2JKWA 4L4TB 5FGCB 4FQIH 1L9NA 1NDMA 3DGGB 3T0EA 1NCIA 2A83A 4LVNC 2WUBL 3AWGA 4OGAC 2D0HA 3WFBH 4JY6B 2GB2A 1QW8A 1H8LA 4MQ7A 1RZFL 4XNQB 5B21A 3HC3H 2NRDA 5J56B 4E9QA 2Q7YB 3FOMA 4N90E 3DGDA 5CGTA 2FATH 8PAZA 4CSZA 3QWOB 5E6SB 3ARDD 3L3HB 3AFLA 4N1EA 2VDOL 4CMHB 1J0IA 4LCIL 4EIZC 1KWGA 1AQMA 5HHPB 3W0WD 3B8YA 2PTUA 3DNKA 3KPSD 1T80A 4K71B 1KB3A 5CSBA 3U82B 4KUZL 1MH5B 2GFBB 2G3XA 4I9WD 4AT6A 2PCPB 2NW2B 4NQCE 3SDCB 3N41F 1U8HA 5B1JA 1N67A 3IAQA 4RGND 3QNYB 5T3ZD 2YJQA 2EIJB 5CU5A 5GS1C 1QBML 1HXKA 5EEWA 1G7JA 1RZPA 1SYVB 3C6EA 4I1PA 1CICA 2IC2A 3NA9H 2VDPL 4FKKA 3WL9B 4XN2A 2VUKA 1NLBL 4W9HC 1TTCA 1ZXQA 3JUYA 2X70B 4JRXA 4NP4L 1E27B 2QHRH 5HY9B 3D4ZA 2K0RA 3MRFB 3BEWB 1Q9WB 1T22A 3ENEA 4HDIB 1OARL 4ANUA 3HFML 1PEWA 3RDTC 4U6TA 3K46A 4OZFB 3KYMB 2BHZA 3FT9A 3KDMA 5H37H 3QAZB 5TH2A 4Y4FA 1J10A 3E7JA 3OXSB 3F7YB 1B0RA 5BRQA 1RIHH 2PMZA 2QDVA 4J2QA 5ITBL 2GJZB 3IDXH 4WWKC 1LEKB 3RJOA 3RIKA 1HVXA 2VABB 3P3YA 3DV4A 2J1ZA 5D7IF 3SYOA 3ES6B 2MSPA 1UFGA 3EJZD 3GZKA 3U46A 2HMID 1S7VA 2DQJL 4NSKA 1BFTA 1FDLH 1Z9MA 4BGDA 4RA3A 3GHEH 1Y0LB 3NCWA 1NAMB 1OVZA 1A3LH 1TQTA 1WH0A 1EA9C 3UH8A 3WFEL 1ZHKB 1A02N 1YEFL 3CIQA 2OL3H 3H9YA 2HKHH 2IAMC 4L3EA 3QDJA 5FUCE 4HIHA 1HIML 4WENB 3EGSA 1G5GA 2AXHA 2E7DA 5JO5B 4AENA 1ROWA 4IBSA 1NAMH 1M7DA 5JW4R 3I9GL 5AD0B 1Z9SB 3D3VB 4WWKB 2R39A 5KVGH 5JOEA 4ZSOA 2WQSA 3MLZL 3LKQB 4PJCE 3I84A 1JPFA 2WWNA 3HNSL 5KYWB 1SHSA 2NY2D 4MD0B 4EZMA 3E80A 4Z7OE 3ZSSA 5C0CE 3FB5B 1MFBL 4LCVA 4HXAL 2HRPL 25C8L 4FEMA 4JZJC 4YWGH 2P8LA 2BS71 2E8ZA 4YGVA 4Z77A 5FGBC 3HHSA 1C1EL 2PKDA 3GUFA 2DJMA 4ONHA 4P2RB 1Q8MA 4TQIA 1O75A 2EYTA 5T1KD 3G7TA 3J2PA 3T0VA 2RFXA 4JBSA 4AQAA 5J1SC 1RZ8A 4QRRD 4AK1A 2APBA 2BWQA 4GFXA 3IU4H 2Z4QA 1ASQA 4JG1H 4Y7OC 1MCQA 1AZZC 5K1VA 1U3HA 3FRPG 3DOSB 5ANMA 1Z9LA 3O2DH 4OJFL 4DPBX 4IIQA 2MQGA 2JKTM 3GZOA 3RU8L 1EUUA 3T0DA 3DUSA 1URZA 3W9DB 2FIKA 1NUDA 1RHHB 2P7TB 4XBGA 2ITDB 1RPQA 2CA3A 4PJFA 3UTSE 5BQDA 2VC2H 3UCRA 2YK1L 5DD3L 4Y4HA 1SXBA 2C9UA 5HXMA 2XN9B 5EZPA 3LY6A 1J9SA 4LEXL 2HSIA 4GS7B 3BVTA 5I74B 4DCQB 3E8UH 1MJJA 1UCBH 3P77B 4A37A 1JTPA 1UWYA 4QHUB 2ZYRA 1UQSB 1LK2A 3S3JA 1WS7A 4DZBA 1E2VA 5IJDC 5TE7H 4ELMB 1GPOH 5ILTH 1T3FB 2TAAA 3CDZB 2VR7A 5D5MF 2ZYSA 3WJJA 4V2CB 4DP2X 4PP2B 1V7MH 4QTIL 1OTSC 5DD1L 5DGRA 2JKJA 2NT1A 5F7DA 1F3JA 1J8RA 1X6NA 4PB9L 1NCWL 3ARDB 2D9QB 1F42A 2CO1A 3TASA 4RQQB 1UOVA 4MA3A 5KYYA 3V4VL 2XWTB 5HYSG 4XP4L 4NRZB 4QKXB 3QDJD 4BKLA 3CAFA 2GSMB 3IPEA 4AL8H 3RUGE 3CFTA 2G4GA 3ABLB 5GS0L 4BWWA 2HKAA 4FP8L 5B3NA 4G9FB 7PCYA 2UZIH 4BKLB 2JJUA 4L9LB 4TTDD 4NQVA 4YN3A 3AQYA 2BIPA 3TJEL 1KCVH 1IC5L 1R6VA 5E6RB 2CCVA 5AVXB 3H9ZA 3OMAB 4XVTL 2ATAA 4JVUA 3EIFA 4UMGA 2YFOA 2VDPH 2JELL 2WLHA 3ARPA 4GAFB 4MQXD 1UUSA 5HGAB 4JKLA 3M1OA 4OLZL 2BVUA 2C7UB 5BZDB 1IAII 2P48B 4OLVL 2ZKHH 3EO9H 4MAYD 3BRGC 3RDJA 2NMSA 1F1AA 4JFQB 4NXSA 1CL7H 1PAMA 3QQ9D 4J3OG 4Z7UF 4D3CH 1N6QH 5MERB 2KPWA 2WB1A 3DXAB 4B50A 4C4KT 4ODTH 4K5MA 2CWRA 5BXFB 4ES8A 1BLIA 4L3FA 3ZMNA 4I3GA 4B9ZA 1FVCA 5E6UB 5IQ9B 2MCPL 3F01A 4LF3A 3F7VA 2ZE0A 2BP8B 1BFSA 4X6BB 4JM2F 3CSGA 3O9WD 2IH8A 3QDJE 1CN4A 1KTKE 3TV8A 3V6OA 5E8OA 2KQNA 3L4YA 1EV2E 5I1DB 1ZE3C 3O6KH 4JVPA 5KEZA 4P46C 4ETYA 4OGXL 5E1AA 4CJ1A 1JI1A 4BE5A 3SDXE 2K70A 1JNNL 4PJ8D 2FE0A 1NC2B 5A16B 1G43A 4P49A 2E59A 4KUCF 1UOKA 1DSWA 3CSYB 3DUSB 3QSKB 2AQRA 1UXWB 3BD4A 2F5AL 1EAJA 2AJ3B 1BX2B 3HRPA 3IFLL 4IBQA 4M7KH 2CO3A 4XMWA 3B2MA 4YLCA 4HZLA 4YHNA 3GPSA 2OJ1A 1M7IA 5IQ7L 1MAJA 4JQVC 1SBBA 1CS6A 3QZLA 4UIKH 3I3BA 4MNQB 2X1XR 4V2BA 4XCCL 2DKMA 1PG7W 1PF3A 1UURA 4FFZA 1J86A 2HTKC 1P5VB 3CMOH 3JWNC 3FRPB 1CIDA 4FN0A 3D07A 3Q9QA 4GFTB 3O2VL 1HHKA 4WW2F 1UA3A 3ARGA 5F21B 4PJ9B 3VQ2C 1KJ2L 3KW8A 1UQSA 4DZBB 1EZUA 1ZLDA 4JANB 2IAND 2VAJA 5JQHC 4PJ6A 2BP0A 2YAQA 2IQ9L 4XC1H 4MJ6B 4U7MA 3PGFL 3H55A 4I0KA 2E9WA 4FJYA 3OWEA 5BZZA 4RISH 4CC4A 4EN3D 5J13C 2A77L 3WNOA 3RTQC 5E2JA 3HE6B 3HE7A 1M05B 5PAZA 1ET7A 3MKKA 1E9PB 3HR5B 4CJ0A 1G4MA 2WGNB 1KV7A 1TQBB 4QAMB 4ZO9A 5HVFB 5DMIH 3HIZA 2YEVB 2H7WA 3ALXA 12E8H 1KELL 1J0JA 5HHPA 2OMBA 4D0DA 1D5MB 4AI7A 4YZFE 2XDHA 1MI5B 3JT2A 5BZWB 4I4WB 5A7BA 1UZ6F 2Q76B 1JGLL 2R2HB 3QQXA 3B9DA 4LMQI 4M29A 5L2JA 1AZRA 1IQWL 1NBYA 3CVHB 3A5VA 4G6JL 2EE9A 3C2SA 5BJTA 3GI9L 5ESAA 5IB5A 1LNUA 3QJVB 1I3VA 1IJ9A 1OLLA 1P7QB 2OTUB 4Q74A 4G72B 3MLPA 2BRRL 1MCEA 5L88L 2P8LB 4CVWA 3P73A 3OF6D 1FAIL 1G4RA 5CU9A 3BPNC 1MHEA 3H4FA 2BJML 3VXMD 1LK3L 4FFWC 1S7VB 2IADA 4NO3B 1NPJA 3MFFB 4WEBH 2BXYA 1KCUH 1JPTH 1LDPH 4XMZA 3VI3A 5HDQH 4PRPE 4U2YA 1S7QA 2UY6A 4WI8A 3V4VB 3DI2B 3VVWA 4GAGL 1DVZA 1O7SA 4ZMYA 3H9SA 1E8WA 4WO4B 3BQVA 1IGIL 1IC7H 1JD7A 4Z7NB 1BIHA 1TTBA 1TZ8A 3BD5A 3U30B 1N68A 2V7NA 2VZUA 3WS3B 2UX7A 4MA1B 4GRMB 4XVJL 2LVEA 4Y9GA 2PO6A 2ZIDA 3QIWA 4FFVC 3RRQA 3B4NA 1Y07A 1EJFA 1YZZA 2QGEA 4NSKB 2X70A 4JRXB 5I1AA 5I1EH 2BOBB 1XF2A 2FX9L 5ELIA 1B4RA 4BCZA 2EKSB 2FT6A 1GGIH 4IKLA 2EDWA 4A2FA 2I7OA 5FA4A 1QLEH 2WMPA 3IDNA 1FL3B 4ZTPL 1VKXB 4HH8A 1H3UA 5CILL 2A83B 2DQUL 3FFCE 3GSWA 4J8QA 3GINA 4HFUH 2YUWA 3UPCA 5TH2B 1IV8A 1GJUA 4GSQA 4K5OA 4K5NA 4C56E 4GXUM 2DQDH 2HVKB 4MSWA 4K94C 2CJUL 4MB1A 1G7PA 2NTSP 4H40A 2DWDA 5D72H 4XCFH 3HPJA 4G3YH 3GK8H 2IF7A 2XFXB 1RY7B 3IU3B 5KBNC 3UC2A 1UD2A 3PP4H 4HK3J 4PJ9A 2WXNA 1NKOA 2PYEB 4ZO6A 4CADB 4UOZA 4MAZA 2VDNL 3QGVA 5F1KC 2BSSB 4WIQA 1GGCL 4XPHL 3FHQA 5B4MC 3AY4C 4MAYA 3DJRA 3S36X 4HWEL 2RAMA 1RZJL 4DGIH 2XYCA 3P30H 5FLVA 4YH6A 2WKLA 4NZRH 1MCHA 2AEPL 2MHAB 4LLQB 3TCLA 1AQKL 2EDYA 1VADB 3QXAB 2WWKO 2LLGA 3HB3B 3IBOA 3QFJA 5EU7E 4RIRB 5EPMA 4LIQE 4NQUA 4YPGB 5IZ7A 1IBBA 1EIBA 5E6IC 1SMOA 4LLQA 2ZCHL 2Q86A 3TCLB 5I1GH 5KYNA 5IQ7H 1BVZA 4BZ2L 3L2NA 3QWOA 2AV7B 4EVNA 1JWUA 5KSAB 1MHCA 1BOYA 2G75A 3QYNA 1VGEH 1ZE3H 5BW7C 1VACA 4JKNA 4WSGA 1FO0B 1RUPL 1ET5A 3V0FA 3W3BA 5KYYB 3HFFA 5F7UA 3B2DC 4R8WL 3VYNA 1RJLA 5B7FA 4MMYB 4RAVA 1FNEB 3U6RB 2BC4B 3SCMC 1TETL 4XAWH 2K9FB 4AH2A 4AYBA 3SPCA 4A04A 5DQJA 5CCKL 1A6AB 5E6IB 3U9UB 3N42B 4QOKE 1WS8A 3MNVB 1U30A 2EYRA 1EZVX 3Q2CA 2X05A 3VGBA 4D0CB 4JJ5A 3LRMA 2LU5A 1MCBA 2WJ5A 5I82A 4E9LA 2I07A 2BVPB 2Q8AL 5FO9B 4OAWB 1IT9H 2Z31B 1P4LB 3O3BA 2VKXA 5IK3A 1T2XA 2GTWB 2VLRE 3J27A 2F8VA 1PL3A 4GQRA 4F8NA 3GJFH 4N5ED 4X6EA 4P2QB 1KGIA 5FWQA 4GW1B 3PHOA 1EPFA 2AMUA 1OQXA 4K3EH 1GS6X 1OAKH 3CFJA 4EOWH 5CGMA 1U6AL 2H0EA 3NK3A 3FFDA 3KEDA 3HNTH 4AGNA 2XG5A 3BXNB 2F1BA 4X7FC 1N59B 4A6YB 1MCFA 1YMHB 4K94L 5LXVA 3E0GA 1E28A 3EZ8A 4J3OH 1NCUA 5H35A 3GKWL 4BXVA 3RIFF 2VLME 4XBPA 3ULUD 2EEBA 4AW7A 1AG0A 2VW7A 5FA4B 1A4JB 4BKTC 4HIJA 1JK9B 2CNZA 5ENWA 4BA0A 1TNNA 5DO2D 1TQWA 3MA7A 2YOAA 4JFFA 3EYOA 3O81A 1KZQA 3FF8A 4AQAB 3DXAD 3SPHA 3BVWA 1NMBH 1UKQA 2EO9A 4E41B 4Q7DA 4OZGA 2LU3A 3V6OC 3KWVA 3ZRSA 2B20A 1B3IA 3I6LD 1TPXB 1SOSA 4IU2A 1OAQH 2XT1B 4ZO8A 4S0SD 1ZHNA 2UWEB 2VERA 4JFDB 2WK2A 4MMZB 1JPFB 5KVFE 1CL7L 4L0ZA 5AW6B 2OI9B 1QBAA 1N3NA 2OMUB 2D3JA 1SQMA 1OGAE 4N3UA 4BCYA 5AD0A 4NP9A 3I6GB 2O1AA 1RJZA 4LNVA 1NOLA 3V4LA 5T8IA 5DDHB 4A7UA 4JFDD 1RCYA 4YE4H 1KIPA 1KY6A 3ZUCA 1NLBH 5K9KA 4HAGA 1DUYB 1H8NA 3OGOE 4Q9CA 2VZVA 2HVBA 1MEXH 3DX4A 4Y2OA 5D2LF 1OARH 4M5SA 4R96B 5DVMA 5TF0A 3U1SL 2KL6A 2DOCA 4HF5L 5DHEA 2X38A 3PUCA 4A2HA 3EO0A 1SY6H 2QTVA 3WTXA 3TYFB 4I3RH 1T5XB 2XWEA 1RZ8B 4Z76A 3A21A 1C12B 4MXWL 3MBXL 3N50A 1WAAE 1WIPA 4G1MA 3V9EA 4GRLA 3GSNH 3NIGB 1I1YB 4PRNB 1LGVA 1CD9B 1U93B 3BGFC 4HEPA 3CVHH 4IM8A 1ZS8A 1XR9A 4LU5L 5F96H 1VLXA 4UTBL 1BYNA 2YUZA 3IMTA 1BEXA 3CE1A 1COBA 4OD2A 3OGCB 3MR9A 3MU3A 1RZJC 2DW5A 5C08B 3STBA 2Q9OA 5FX3A 5G55A 2GAZB 4HMCA 4YFDB 2X4RB 4FULA 5IB3B 2Y6SC 2X4OB 1ORQA 2G2RB 2C1PB 2YOCA 1DFBH 1TZIA 3JTSB 1TYEB 4G7YL 4NQXB 5SWSE 5TDOB 2X6UA 1OANA 3FSAA 3I3EA 1Z5LB 5CD3B 1TJMA 4KKZA 2OL3B 3KL3A 3UAJA 2FJFB 3NEXA 1S5HA 4ZPTA 4Z1PA 3MOBL 1N2RB 2GC7C 3CZSA 2AERT 4TRPH 4BQCA 3BVDB 3LKOB 3QDGE 4HGKC 4B41A 1G9NL 3L4UA 1IAOA 2CA4A 3S9DB 2ZP0T 4L4VB 4IJ3C 1FYTB 3A67L 4KGJA 1TYJA 1GTFA 3CMGA 4UILH 1BZOA 4RMTA 3T77B 1YDPB 4LEEA 4UQ3B 2GPZA 4JPVL 1S5IL 4G6MH 2EACA 2R0ZL 4PREB 2ADFL 1JPSL 4L1HA 1DE4B 1DQLL 1RLBA 2VDPB 1ED3B 4FABL 4AVIA 1B90A 4E9XA 1NM4A 4KDVA 4LSTH 5ERWA 3DVNB 1A6WL 4OIFA 4OCLC 4P0DA 1DJYA 3GGWB 2W65A 2FO1A 1MF2L 4NB7A 4P05A 3RQ3A 5FYJU 4Y2OB 3HI5H 1N0LA 1CD0A 1ID5I 4J3OF 1Z9OA 4Y9BA 5KW9L 5I76A 2EDEA 4NRYA 2R7EA 3VD0A 2OP4H 2VXQL 4M3HA 1INDH 1U4FA 2E5EA 3KWTA 3MLUH 1ZA6A 3VI3F 2IQ9H 4XC1L 4RFEB 3CN1A 4OLVH 5IB1A 2K7PA 4FERA 1MWOA 1IKFH 4QRRE 3KLHC 1X5LA 3SE3A 3BH9A 3LVTA 3PFQA 2IDCA 1TZHA 4R0LA 5D70L 1DO5A 1ASPA 2BIHA 2AXFA 1AP2A 4JM2C 4V1DB 3H3PL 3WIHH 3LQMA 3EBIA 4LRNH 5AB2A 1NGQH 5D7JD 3TJHD 2A9DA 3DUUB 3MRDA 5EB9A 1U3HD 1AE6L 2BRQA 1UWEH 4JFED 1JZ5A 4FYTA 1LO2L 4ZUWB 5T1JA 4GP8B 4NQSB 2D9CA 3P54A 1BM7A 4LAJH 4LHUG 4F92B 2F54A 3KPNB 3BZ4B 4AXWA 1WF5A 5GISH 1X5FA 4QXTA 3ECUA 4P3CH 4FZEL 1TQCC 2CKNA 4PJGF 2IWFA 4W93A 4UB0H 3EYQC 1QZ1A 1R3JA 3QA3B 2BSTA 2JMRA 4Z7NF 1XB6A 4KNUA 3VJ6A 4PW4A 3VXME 3F64A 4XWOC 2VKWA 2ZJSH 4ZX5A 3T2QA 3VXPB 4IJTA 2WQVA 1YEKH 1I1AA 5SWQA 1E8ZA 3APFA 1MHPL 5DJ8B 1G7LB 5I30H 1D7CA 1DVFC 4Z7WF 1KT2B 2CBPA 4OLUH 3KYKL 2NY6D 3W5NA 3UAJD 3QIWB 2F54D 4X80L 3LD8B 2JK5A 3QUKA 4Y5XB 1HEZB 5ANME 4KK9D 1MJ7H 3TCXA 1PCXA 4HSAC 2ODIA 3ZDZE 1G94A 1KLFA 4LKXB 1DLFL 2QSCL 1KN4H 1DANT 2C3XA 4FXLA 4L5FH 4LLMB 4IRSC 5DZJA 4Z77B 4NO0A 1S7SA 3QCTL 5C09A 4NUQA 3T8MA 2V3FA 2ICWB 1WSST 1VFAA 3E1ZA 3DYPA 4PRDA 4XP6L 1VZIA 1X5IA 3HPJB 5F70A 3JWDC 5GS3A 5E6IA 2X7LB 2PN5A 3TBYB 1NJ9B 2Z8SA 4ZMXA 1Y1DA 5GXBB 3D8MA 5I76B 4YZFF 2A6DB 4G43A 4KJWC 3MCKA 2WCPA 2W95A 2C7FA 5TFSL 5K1NA 2GITA 1J8HA 3VI3E 5L8JB 4UBDD 1YDPA 4UNTA 3MRIA 1GC1C 5CKGA 3O3DB 4MA7H 1OTTC 2ZWNA 4GQPH 4NLAA 5F1NB 3RKDD 3SGKC 1XBDA 1AJ7H 4KQ3H 3QEUA 2XX0A 1CE1H 2FH6A 3E3QC 4F1ZA 4C55A 4PLOB 3FB8A 3QIUB 3A6BL 2FECI 3LNGA 1E5AA 4LHUD 4M7LL 4G3YL 2CMRL 4CN1A 5JXEA 1CGSL 3O3EA 4EE2A 1KIRB 3CCHB 1BF2A 2YHGA 2YD7A 4TSCL 5CIPA 1LO0H 2OJEA 2Q3ZA 2XA3A 2H9GB 3MLSL 1XHHA 4PSRA 1VCBC 4UILL 4AQEA 2Z93B 2ARJB 4FA8A 1V3LA 1CLZH 1XD0A 5DQ9A 1GR7A 5KG9A 1OD7A 1FFPB 3RILA 5TDNB 1QEWB 3FTWA 1SEBA 2XETA 4PS4L 2KH2B 3LQAC 3TU6A 5IGXH 3WKNA 3HHRB 3L3IA 4Z7VF 1PY9A 2R29H 2ED8A 4Q0XH 3KPOB 3QEGH 1PBYA 2QELA 2O72A 3RX8A 2AABH 3BUYB 1NDGA 2GJJA 3C2AH 3MRFA 3HKZA 4JFZL 5GRXG 2PYEE 3FUMA 4PP1C 4WV1B 5AW8B 3WJLA 4KMTL 5K9OB 3ARRA 1NIFA 1NINA 3QZMA 1IC7L 1A3LL 3WFEH 3T2NH 1FZJB 4H8VA 4QRAA 1DZ0A 3KYMA 1X9UA 1XAKA 1OB1B 2CMRH 2ZG3A 1KY7A 1D5XA 4WY7L 2X9ZA 3U7WH 3LPFA 4HJSA 5D1QC 5D1XC 3A6OA 4GKZA 4WWPA 4ODUB 4Q2ZA 2WVVB 3IFOA 1D2PA 2B4CL 4Z7OF 1PVHA 1QYGL 3FO0H 3HR6A 1CICB 1YY8A 2MTAA 1QP1A 4MQXC 3THMH 1DN0B 1RLWA 3F12A 3DPBB 1I31A 2J88H 4IMKA 4ZOAA 5C0EB 2D7MA 1G7IA 5J12B 4MVBC 1CFVH 1FE8H 3LZFL 3PWPA 2X2UA 4L1DA 2COVD 6TAAA 3QUYB 3BKCL 1E4XH 5C07B 1RJZB 4P2OC 1U93A 4EI6B 5HHVL 3ECBA 3CZLA 5C0NC 2XUWA 3NH7H 4UANA 1CWVA 1PIGA 2DWYA 3ZVVA 2J5LB 3L5WA 2ZNWA 2ZUUA 2UZIL 3V6OE 2NX5A 4WU5A 4XNBA 1KJ2B 3FUNA 3HNVL 1O6SB 3LNFA 4L4VE 3O6FC 1DEDA 3D30A 3DV4B 1PW3A 4ZFFB 4A6YH 3LMJL 3STLB 3VDAA 1UGNA 3SDYH 2B5IB 3QJZA 1QWNA 2A9CA 4Y16C 2RB8A 4YX2L 4YXKH 2R69A 3BQUD 4MYPA 1JZEA 4GQ9L 2Q0ZX 4OFYA 4PJXF 4LCIH 4OF3A 2N59A 2GYSA 5KZCB 2AHIA 4GUOA 2UXFA 1LD9B 4JQIL 3ULUF 1R5IB 4X0NA 3FCTA 2VWEE 5J3HD 2NXYC 3ZQXA 3FF7A 1JGVH 3RWIA 3AACA 4P5SA 2VN4A 2JB6A 4BCXA 2CLRB 3QCUH 5HVGB 4FL4C 1L9PA 3R1GH 1MCWW 3U1QA 4NUJA 1TMCB 4RAVB 5JW4N 4NC2B 5ACZA 1F4WL 3S5LB 2Y6TE 2LE9A 2NY7H 2WSDA 5KSAD 4U1LB 4X7SH 2J1WA 1CDCA 2HFGH 2Y06L 4G2AA 3IS0X 4IRSA 4L29A 4RDQF 5I26A 1RFDH 3KNBB 3V0WL 1XGYH 4Z95H 3V7MA 5IKCA 2X9WA 5JHDB 2YQ3A 3DI3B 2Q2EB 5DHVH 3BP6A 4W68A 4B95C 1R3JB 1BFOA 1V7NH 3N40P 5FIEA 5D71L 1DUZA 2Q3AA 3G6DH 3MROA 3BUIA 1OW0A 4B96A 1SRDA 3H56A 2CIKB 2D03H 5C0BB 3A6BH 1KTDB 4HUKB 1CD1A 4DH2A 4WK0B 4D0CA 1R1CA 1DBJL 1DVYA 1R9FA 3BUYA 3PABB 2DYPA 2P1YA 4UDTB 4E9SA 3MROB 1A7RH 1D5ZB 1T03L 2VDNH 4G7VL 5F9JB 1VFOA 3DX7B 1IQDA 4BFOA 3CNKA 43CAB 4HGWB 4KOCA 1OT1A 2OR7A 1ACYH 2GUOA 5L4JA 2PXYD 4PJFF 3AG2B 1Z0NA 3OZLA 3SJVA 4EXKA 4WCYH 1QFOA 4OZ4B 1JPSH 1L9OA 3BSZA 5G4OA 4OIIH 1SUJA 1JPGA 3FSVA 3FO1A 3QFGA 2VAAA 4MNQE 4JFSA 4L3CB 4BELD 5DHYA 5BS0E 1OAJA 3O0LA 5F0JB 3HAEB 4DOHB 3TL5A 1MXDA 4G82A 2B1OA 2BIMA 4LCUA 1PGRB 5ETUA 5C9KA 5GZND 4NOFA 4ZMLA 5KVGL 3VI4A 3KLDA 3CFDA 1DVSA 2WTRA 3P9MB 4M7ZB 1E6OL 4G8FB 2I26N 3ARWA 4CU6A 2E3VA 2QKIC 3N91A 4YJZL 4YSCA 3QDGA 2JV6A 3GJFK 1KEML 2FGWH 4G6AD 3VVVA 4XPFH 1TVBB 2NR6D 2DN7A 1YSOA 2R51A 3NIGE 1Y7VA 3II3A 4KZEH 2ZG1A 2FZ3A 2WSPA 3L9RB 4NWTH 5A40E 2OFQA 1AYOA 4XGZA 1WWWX 3L3JB 3VH8G 2FL5B 1EEZA 5FCSH 3ZZQA 5MERA 3LB6C 3VXOB 4UAOB 2Q10A 1Q0XH 2W88A 4NN5B 4WO4D 3IJEB 3BAEL 5LUMA 3LYRA 4JGUA 4QXGH 3O2DL 1BIIB 1HH6B 1UT1A 1ZTXE 5CP7A 3R7QA 5GJSL 5IB2B 1EAPB 4HC1H 5FECB 4KFMA 1QFWI 4KO5A 4LKXA 4BFEA 5ICXB 5LBSH 5B1AB 4Q6IA 3TEXA 1JFQL 1FAIH 4OLYL 4HUUA 1XSKA 2Y7SA 4N9OB 3EJCA 4N1CA 3OR6B 3BUBA 1W0VB 3EJPA 3FBQA 3QCVH 3MLYH 5KSVB 3BEVB 5JOFA 1P2CB 2W9DL 1C7TA 2APXA 1G1KA 5INDB 2B7DT 5JW5B 4MB3A 1SY6L 5HI5D 1HL5A 3AXIA 3IDJA 1ORSA 1EFXD 3IDMB 1EO7A 4LDLB 1DSFH 5ALBL 3S97C 3MCLL 1LXMA 1KF9B 5T1MB 3A0OA 3HRZA 5HHOA 3ABKB 1CE6B 5CBAA 3WS3A 2Z65C 4ADJA 2VDRB 5CR8A 1V54B 2PXYA 2R2EA 1KYDA 4NENB 3AXLB 4XPAH 3S3DB 4HXBL 1HHHA 2OSLA 3K3QA 1B3JA 2ATPB 3F83A 4YDIH 3VFWB 5I1EL 1DVUA 3LZOA 3TXAA 2X0UA 3R0NA 3UXFA 4PWJA 3SYQA 1I3UA 1U8CB 4ELME 2Y7LA 3P9LB 3TVMC 2GJ6E 3QHFL 5SX5K 4AENB 2PTTA 4YHLH 5JO5A 3H54A 4M03A 1NCAH 2A3TA 4M8UA 5IW1B 1OIOA 3LV3B 2DQGL 4QRBA 5T3XE 3GBLA 3QDHA 4NO5B 3D25A 2B3IA 3FB6B 4BZYA 5CEYA 1GHFH 1QLFB 2XTJE 3RL2B 3MBEB 3UABA 4Z78B 5HDQL 2BVQB 5AVVB 3NN8A 3SHSA 5HI3C 1HHIB 3TTSA 5I19H 1FLRL 2VLLB 3MCG1 1XMWA 4YHPB 1ZLUH 3FFCD 4NC1E 4HQQH 3U25A 5FGSA 1THAA 2R0KH 2JLLA 2NNFA 1Q9KA 3BFWA 5DURD 5JR1H 4BFIA 1MCCA 2RA1A 3O6ML 5GS1A 1S3KL 3FRUA 3UOAB 5FKAB 4DN3H 2X87A 3MA9L 4N2EA 2NUTB 4P23B 3E6FB 2VDKL 2EIKB 1AMYA 4AJVA 4YHNB 4JKPH 3EUUA 3CFUA 4LRIA 1XD1A 1VCAA 1F4XL 4JY4A 5BOZG 4HIIA 1Y6KR 5I6NA 4QNPE 1RIVL 4K7PL 5JUEH 1CDYA 4U33A 1DFBL 4G7YH 5DRXB 3FQNB 4HH9A 1S8DB 3ML9A 4KC3B 4NO3A 4WU7B 1CI3M 1NCCL 4I3SH 3NESA 4Z8FH 4PRPD 4DPCX 3O8XD 5KVEL 2X89A 1TTGA 1NBQA 3GLAA 3JQOB 5C92A 4MJIA 5SV3A 5FYKL 4TXVB 5CGYD 3SDDC 3FUEA 2LTQC 2IBBA 5C07A 3VXRA 2OMZA 5D7KE 5CEXB 4BDVB 4X42A 1NEPA 2FJSA 3HFMH 2R8SH 2R1WB 3OKYA 1JWMA 2NZ9C 3DHJA 4KKAC 1WUZA 5LLIC 5A3ID 2B9BA 1R3LB 3T0EC 1MVFA 1S3KH 1C16A 1OKEA 2JKRM 3M46A 1A7NH 2FR4A 5CO1A 5E7FA 1S9WA 2EEFA 3L5HA 5KN5A 1IC1A 5DTFB 7FABL 1J9CT 3C5ZB 4E2OA 3TBYA 5LAXB 2F5AH 1I9JH 5I8EB 3HOGA 2IMMA 5AOLA 4MJID 1MRDH 3D9AL 4ELKB 4POYA 2E76C 3NDYE 1E28B 1S9XB 5AENA 3TO2B 2CDFA 2HVJB 5B3JE 1FGVH 3FNKA 5EOQH 1GZHC 2W0LA 1AS8A 1VGKB 3MJ8B 3NGBC 3QULB 3BAEH 4PD4J 1JE6A 1MWAL 1TYRA 4O02A 1N6UA 5FGCE 4L8DA 1CYXA 3UJIH 3BH8A 2HN7B 1SDDB 3ZYOA 2GVYA 3UJJH 4G9FA 5IEHA 3C5ZC 1XL6A 4QTHA 2HJFB 3SYPA 3HAEA 3DOIA 1SXZA 4U1IB 1RV6X 1TCRB 3MNWA 4UQBA 5D7KD 1J8KA 4ES9A 4AL8C 1ZXKA 4JFQA 4QXWA 2AJVL 1DBML 3AZUA 2IJ0C 1TZAA 2IPTL 1S9VA 3EGXA 2D7OA 3H7LA 4KX9A 5CCJA 1KC5H 1K4CB 1X5HA 1CK0H 3UYRH 4DP5X 3KZ8A 4WI5A 1J9TA 5D70H 1ZT7B 3GMPB 3QWQB 5DQDH 4YHIA 4PS8A 5I6XC 5I1HL 4X4YA 4MZIA 5DC4B 5GZOA 3ULUE 1OCOB 5D93C 2OMTA 3VACA 3CN0A 1IKFL 1TKWA 3T65B 2WO3B 2NY3C 5KTEH 1F4YH 4TNWF 5EN2B 4M6ML 5JHAA 3NJKA 4RSVA 3N9GH 5GSRA 2FNWA 5I1DA 2X4UA 2FEDD 4G6JH 4RVBA 3ARGD 1KCVL 3VSVA 2AXGB 3V6ZA 4HOMA 4L0PB 1ETA1 3KPMA 2HMIC 4M7JL 1WICA 2IOIA 3BO8A 3R06B 1BQRA 1UM6L 1EWHA 4N9GA 5E6YA 1ET8A 1X5JA 3CVCA 3L7EA 3KVPA 5AKTA 4ALAL 4UM9B 1IIIA 4LPXA 4JFEE 2Z31C 3RUGF 3L2LA 2Z8WC 3U4BL 5D7JA 1EGJA 4OCNC 3L8QA 2YAOA 2ZOLB 3CFBA 3WUZA 5I9QC 2B14A 4KJPD 1AAJA 3VI4B 3GO1H 1WZMA 3MV7B 1A65A 3FH8A 4MJ5A 1HH9B 4Y2LA 4FQLH 3QJQB 5I16B 3X1EA 2QQNL 3ISYA 3LMJH 4Z3HA 5LGKA 2ZUVA 2Y36H 3NCEB 2A9BA 4PV8A 5I17B 3T8XB 2ZF8A 4LAQH 4NHUA 1F8TH 1ZWIB 1HTYA 3ASWA 5LBSA 2BY3A 4K5PA 2QPDB 4XP1H 1AR1D 5EV7A 2GJ6D 3LQAH 5IB3A 3SGJA 1HNYA 2VNCA 1THCA 4XXCA 4U49A 4O02B 4M6OH 3MR9B 3MRGA 1NGXA 3EYUH 3B9EA 1ZTXL 1IARB 4GW5A 4QRUA 1YYML 1P4BL 2HJFA 4OQTA 5FCUL 5ACMA 1KPVA 3PABA 2H2SD 2WCGA 3GHEL 3IDIA 4EAEA 3L1EA 3L6FA 3DHUA 3OL2A 3BOVA 3REWB 3J07A 4QI3A 2YS4A 4LLVB 4EF3A 1T4KA 4JW3A 4AIZA 3RZCD 4W9LC 5JZ7D 3FC8A 4L3EB 1I8IB 5ESQB 2QR0A 4TSCH 4TL5A 3MUZ1 3SQBA 2Y36L 3ARTA 2Q76A 1FJ1B 2XG4B 2R59A 3X1BA 1RZJH 4GIOA 4JX0A 5CJQH 4ZSOB 4IOSD 2XIIA 3LZQA 5EZOH 2EEAA 2ZUXA 3FO2A 4X5WA 2EE2A 3IFPB 5I0WA 2M83A 2OK0L 4MD0A 3QHZL 1XIWD 2F1AA 1NZRA 2J57A 5IUCA 1WAEA 3MV9E 4TMPA 2MKLC 4XPTL 4FMFA 2OMUA 3PAUA 4KH2A 4YHML 3D06A 4U1NA 3SGDI 3WMSA 3I9PA 3TF7C 3QDJB 2YGOA 4WTZA 2ZUYA 2J43A 4KVNL 1EK3A 1NAKL 2OMVB 5ANHA 4FNLL 3T04D 5KS9F 1QSEA 4OZFH 1Q1JL 2I5YL 3CFNA 3CQPA 3VCLB 2IFFL 4LCCB 4Y5XC 5HDRA 3MV01 4FI8A 1J9RA 4PLKD 3B7UX 2XN0A 3PQYA 2B4CH 3HB3D 3LZLA 4LESA 3LN5B 5KYWA 3VXUE 4JPWH 3EO1B 4HG4K 4YSUA 3TURA 5HI4C 3SKJL 1EAOA 2H32A 1CE6A 1S3RA 2L7EA 1T0MB 2JQMA 3HCVB 1TG8A 5K33A 2HT2D 4AC4A 3DC0A 4GRLB 3DRQA 2J1XA 3T71A 1LNUB 4JQXA 2XV3A 4B9GA 2YAFA 4PRBB 5AOZA 4RRPA 4APQD 1J5IA 3ZL4H 2NY4C 3TZVD 3FMGH 5ICYB 4CBPA 1I8LC 5A6IA 3VRIA 3MGAA 2DH3A 2E56A 4PJBF 2VLRB 4R26L 1YEGH 3K6FA 5BMFL 4IRSD 4O4YL 2JI1A 4Z0BL 6FABH 2ATKA 1ERNA 3L81A 4K3GA 4FQCL 1GTNA 2VITB 1ITBB 2IFFH 3MRHB 1O9WA 4XNZC 1ZK9A 5D6CA 4IOIB 3KH4A 4A55A 1SLVA 3FB6A 2D2OA 3H9SB 4WO4A 3CX5J 1ZHKA 4N0CC 4HA1A 2BVOB 4HKZB 4I9XA 3MNMA 5IOKA 1LQBC 1KGYE 1F6AB 5EFIB 2DV6A 3B9KD 4M5TA 4UQAA 2NUPA 1FFNB 3CHSA 1KXVC 4AQ8A 2XWZA 1CVSC 5C0CB 1R4XA 1NGXB 3RL1B 1FNFA 2B08A 2BW5A 3BCFA 3LN9A 5IP4A 1KJ3L 1GRWA 2YKKA 4K3JH 2IH1B 3BH4A 1KCBA 2C9QA 5C7XL 3JWNE 12E8L 2WUCH 1E7UA 2QVIA 3H2WA 3T8VA 4PRAA 1RUML 2ITFA 5JNYB 3GSRA 2BSEA 1TJIH 1WYJA 1Z5HA 1B2WH 4QAWA 2A7BA 5AOMA 5HGHA 3O4LE 4AOFA 2JIXD 3IRCA 4GKNA 4GP4B 1FFPA 3OKMA 1BEYH 5C0JA 3O2WL 2WLMA 2PW2A 4HZAA 1CG9B 1MAKA 3BP5A 5ETUB 1WIOA 3NIDE 3OM3B 4PHZA 2YD0A 1Q0EA 1Q90A 2WIIA 1KMGA 4KGLA 5EU6D 1GZPA 2YZ1A 4I18A 5FFOA 1V05A 2HTKD 3VM5A 3TEYA 1TPXC 3BJLA 4J12A 2X4PB 3NCJL 1XR8A 4JZJB 1A6PA 2Y7NA 1LWJA 3H9SD 1G0XA 4KRPB 4L8CA 1UTDA 2DL2A 5GRZA 4WEMB 1MIEH 2ZCHH 2JTDA 1XO8A 4IRZH 3U9UA 3SODB 4MHHI 3DWTA 2BM3A 3ATBA 2QQLH 2O5YL 1GHFL 1QFWL 2E74C 2OMNA 2EC9T 1K72A 3CV5A 3O3EB 4KI5D 3N41B 5DK2B 5ID1B 4MNHB 2QLVB 3GSQB 3K2KA 1H3XA 4FG6D 5E94A 3VXMA 1WO2A 4PJ5B 4C56B 1KB5L 1AIFB 4XAKE 3IVKB 1U0QA 3DXAA 1FC2D 4X9BA 2J4WH 4QGTA 2R4RL 4N5EC 4B9IA 1SBSL 2WXKA 1JZGA 3L13A 5TDNA 4HIXH 1D7BA 1JWUB 5KSAA 3DMMC 4FF9A 5FO7B 4IRJA 2B9AA 1SJHA 4HXAH 1FO0A 4YO0B 4XBGB 2Y7QB 3Q8CA 4N2AA 3D52A 1T4WA 3FTUA 5ISZD 1M3JA 4Y7MA 4XNYL 2X2JA 1PSKH 1QBLH 1I7ZA 1AKJD 1C1EH 2H1PL 4YO0A 4DUVA 3QUMA 3CFJB 4N2NA 3X14A 2IWKA 1CU4L 4PRHA 3VWKA 3VWKD 3WFCH 3VTMA 2XQYG 3VQLA 1X5KA 4I7ZC 4FQXD 5AYUL 3MX0A 2BVTA 3HAEH 2L4OA 3RA7L 1BQLH 3NOIA 2G3ZA 4HUWA 4WI7A 5DD0H 3GPEA 4AGOA 4JDVB 5GS0D 2AEQH 1T89C 4YHYB 2ZP9A 3LCYA 2LFGA 3CFCH 4PW9A 1CXEA 1KC5L 1NDTA 3BLBA 4ZT1A 3GIVB 3BAXA 3L5WB 4JM4H 4WLCA 5T1LD 4PGBA 2RHEA 3MV9A 4B3EA 5FYLE 2V8LA 2A5UA 3Q8AA 5ICUA 1KCSH 2V0AA 4RX4A 1AD9A 2YGPA 1QSFD 1CFTA 3ZHFA 4FNSA 4I88A 3TBCA 1BZ