7PCYA

The crystal structure of plastocyanin from a green alga, enteromorpha prolifera
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
b'AAIVKLGGDDGSLAFVPNNITVGAGESIEFINNAGFPHNIVFDEDAVPAGVDADAISAEDYLNSKGQTVVRKLTTPGTYGVYCDPHSGAGMKMTITVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title Crystal structure of plastocyanin from a green alga, Enteromorpha prolifera.
pubmed doi rcsb
source organism Ulva prolifera
molecule tags Electron transport protein
total genus 24
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1989-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 7pcyA00
3NJNA 1A3ZA 1JXDA 2BW4A 2FT8A 3RYMA 1JZHA 4M3HA 1OE2A 4HZ1A 3GDCA 3DKHA 1ETJA 5B7FA 3NSCA 3TASA 1OCRB 3AZUA 1PNDA 3CG8A 1JZGA 1GY2A 1NTDA 3EH4B 4JHUA 1KCWA 4GY4A 3FYIB 1CUOA 1PNCA 3FQ1A 4HCGA 3FPXA 4YSAA 2TSAA 3CDZB 2WO2B 2FQFA 1NIDA 3ZIYA 1BQRA 1KV7A 4A2EA 1A65A 4WKXA 3X1GA 4N8UA 3D12B 2ZONA 5I5MA 2QDVA 2HRGA 2YAHA 2HRHA 3ASOB 4F2EA 3OD3A 4KO7A 1T5KA 2BHFA 4BDVB 1TU2A 3OQRA 3WG7B 1OCCB 3N2JA 3X1NA 3T6XA 3EF4A 3WI9A 4DP8X 2PP7A 4DP1X 1XMEB 2HX7A 3KW7A 3PPSA 1X9RA 1NWPA 2XWZA 5TK2A 2HZHA 5FC9A 5B3SB 2IAAC 1ZDQA 4M4RB 1NIFA 4UAHA 2YXWA 3DIVA 1NINA 1NPJA 3WKQA 1W8EA 2H5UA 2EIJB 1KDIA 1WA0X 1PZCA 2J55A 1R1CA 3FU7A 2VMJA 2BP8B 2A3TA 2IDUA 2VW6A 3AG1B 2GBAA 2BP0A 2PLTA 3NSFA 3GXUB 4A68A 1NIBA 3AG3B 4DPBX 4A2FA 3IN2A 5PAZA 5B1BB 1AZRA 1RKRA 2MRYA 2EILB 4FA7B 1ZPUA 5I6OA 3NYKA 2XUWA 4BXVA 1A8ZA 1GYCA 3UGEA 3X2QB 4NB7A 3QJUB 1PF3A 1IC0A 1E67A 4YL4A 2UXTA 4BXSV 4F7KA 1L9PA 2RACA 3IN0A 2YAFA 1PLBA 2HXAA 3UABA 4YVUA 3ABKB 4HCFA 1AZNA 3NJKA 4A67A 3CVCA 2Y69B 1XB3A 4JKNA 1J9TA 2EIKB 2GSMB 4BWUA 1MZYA 4PAZA 4A2DA 1X9UA 4AKQA 3NSYA 1WAEA 3WNJA 1FFTB 3HB3B 5LDUA 3QJSB 2XU9A 4CSPA 3ABLB 4KNUA 4YSRA 1ID2A 5B7MA 2N0MA 1JZIA 1FA4A 1ZIAA 3H4FA 4MFHA 4AX3A 4E9TA 1TKWA 2OV0A 2VM3A 4DP0X 3SQRA 1YLBB 4BWWA 5F7AA 1A4CA 3OMNB 2X88A 1N68A 4AKPA 2VW4A 2H47C 3CVBA 3AW5A 1XB6A 3CZUB 1AS6A 2FQDA 5IY5B 4YSTA 1ILSA 5B7EA 7PAZA 4KOBA 2DWSA 2H3XC 3PXLA 3X1FA 1SHXA 2CBPA 2ZOOA 3GYRA 3T6WA 1W6WA 1QLEB 1ZIBA 4YSEA 3NJGA 4A2GA 5AFAA 4X4KA 3AY2A 3SBRA 2IDQA 2JFCA 4RH4A 2B08A 2P80A 1A4BA 6PCYA 3TA4D 3QJVB 4GP8B 1ET5A 2I85A 1BQ5A 1ET8A 2IDSA 3ZX1A 4G7SB 3FS9A 2EINB 4GYBA 3X1BA 6PAZA 1TEFA 1ET7A 2YQBA 4E9RA 2BW5A 2TSBA 2QPEB 3H56A 3C75A 5D4JA 3UADA 2PPFA 5AZUA 2GI0A 4Q89A 1HFUA 1JOIA 1J5DA 2FT7A 1GR7A 1OE3A 3ERXA 4NERA 1BYPA 1BQKA 2BWDA 1BXVA 2IH9A 1PMYA 1AZCA 1IUZA 2Q9OA 1CURA 3FU9A 3CDZA 3T6VA 2DYSB 1SFDA 3S3DB 3UACA 2R7EA 2BO0A 1QHQA 2P80D 2J56A 3HEIB 4YVNA 4KNSA 2CALA 3QJTB 1UATA 2PCYA 1PLCA 1AQ8A 1JXGA 2PPEA 4WTQA 3FQ2A 3OMAB 1RZPA 3QPKA 4KO6A 3PAZA 4BDVA 1ADWA 2VW7A 4DP7X 2FT6A 4YSSA 1M57B 1WA1X 2PPAA 1AAJA 4JHVA 4DPAX 4YSUA 2LLNA 1GS8A 1JVLA 2FNWA 4PCYA 2HX8A 3WIAA 1BAWA 3FSZA 1GW0A 4E9VA 2FQGA 3TU6A 3TBBA 1SNRA 2E86A 1IBZA 3NJFA 1JVOA 2DYRB 4BK5C 1V54B 2HX9A 3FPYA 5ANHA 1AG0A 4A2HA 1AIZA 3JTBA 1WS7A 5I6LA 2YAQA 1JXFA 3ABMB 2YAOA 3UAEA 2BZCA 5B1JC 1L9QA 2OCCB 2BP8A 3X1EA 1GS7A 2MTAA 4GP4B 4HIPA 2VSKB 1E5YA 3ZBMA 1J9QA 2QDWA 2VSMB 1E30A 1GSKA 1F56A 1PZAA 2WO3B 3S8FB 3QJQB 1AACA 4HAKA 5D4HA 2PPCA 2QT6A 2AFNA 1BXAA 1E65A 1L9OA 2Q5BA 3NSDA 4KO9A 2JXMA 3FYEB 4QKTA 2XXFA 3KW8A 1J9RA 2J57A 2X87A 5D4IA 1ASQA 4BWTA 1AR1B 2XYBA 1WA2X 3U25A 1AOZA 4G72B 2CJ3A 5F7BA 3L45A 1SDDB 2VN3A 3FSVA 2XVBA 9PCYA 2JKWA 1DYZA 3EH5B 1SHWA 1MG3C 1B3IA 1SFHA 1URIA 3T71A 3NP3A 3TBCA 4E9YA 1HAUA 1M56B 1CC3A 4N4YB 1EZLA 5B1AB 1NIEA 2AZAA 2I7SA 3NJMA 1KBWA 2DV6A 2B3IA 4G71B 4AKOA 4EF3A 1L9TA 3WKPA 3MBWB 1TEGA 1SJMA 2FQEA 4P5RA 3IE9A 3ABGA 1SF3A 4L0PB 1NZRA 1IBYA 4AZUA 4DP5X 1PY0A 2UX6A 2Y1AA 4GP5B 4UANA 1I53A 4HCIA 1IKOP 4HHWA 4NAJA 3S8GB 5I5IA 5I26A 2UX7A 2XX1A 3NJIA 5B1KA 5I5JA 3WNIA 2ZXWB 1XB8A 2AANA 2GHZA 2YXVA 2AZUA 2BWIA 1JZFA 1V55B 2YAMA 2UXGA 2XV2A 1BYOA 2GIMA 3UAAA 3CVDA 3V9CA 4QLWA 4DP9X 1PZBA 4W9ZA 2IH8A 2OJ1A 1NICA 2ZWNA 2BZ7A 1KDJA 2QPDB 3JT2A 4DP6X 2R7EB 4E9WA 2PPDA 4W1TA 3FQYA 2XLLA 3NT0A 3G5WA 1EHKB 4K9JA 1QNIA 7PCYA 1NIAA 3V9EA 2CAKA 2CCWA 1HAWA 3FU7B 1MZZA 2DWTA 3NP4A 4HHGA 3PAVA 4F2FA 2XXGA 2BP0B 1MDAA 3OM3B 1NWOA 2XV3A 3ASNB 4YSPA 4DP2X 1ZV2A 2FWLB 4P5SA 1N70A 2UXVA 1BXUA 2PP8A 3IEAA 2YAPA 4A66A 3N55A 1FWXA 8PAZA 2UXFA 3PAUA 2XV0A 5E9NA 2EIMB 2PCFA 3NJHA 5TK4A 1BEXA 1MG2C 1ASPA 2DY2A 2IWKA 2GC4C 1L9SA 3T6ZA 2AVFA 4DPCX 1OV8A 1E5ZA 4UF7C 3S3BB 1NDTA 1RZQA 5I6PA 1J5CA 5I6NA 1AS8A 3FSWA 1PLAA 1A4AA 1KCBA 4FAAB 1SF5A 2W88A 3SBQA 3SBPA 1ILUA 4E9QA 3DTUB 1PCSA 1ASOA 1WS8A 1RCYA 1OF0A 4E9SA 1JZEA 1AS7A 1OCOB 2WSDA 2IWEA 2IDTA 1J9SA 3EHBB 4Q8BA 4G70B 3S3CB 5EHFA 4DP4X 5I28A 1W6LA 5I6KA 4G7RB 3AG4B 5B1JA 3T9WA 5A7EA 2PP9A 3PLYA 2CUAA 2VM4A 3FU8A 2YARA 1M9WA 4TXVB 2GB2A 5PCYA 4CSZA 1AANA 2I7OA 1GY1A 1OE1A 3OMIB 3AG2B 3BVDB 1ZDSA 3FSAA 4HALA 1AZUA 3QQXA 2NRDA 3FT0A 3MX0B 1CYWA 3EH3B 2YAEA 3NJJA 4ENZA 4AI7A 3H4HA 1KGYE 1GS6X 2W8CA 1JERA 1OOWA 1AG6A 4KO5A 1KBVA 4KOCA 3PCYA 4G7QB 2XX0A 1L9RA 2J5WA 3NJLA 1KYAA 1DZ0A 1V10A 3BQVA 4ZK8A 1OCZB 2FJSA 2HLEB 1VLXA 5AKRA 4YSDA 3IBOA 3QJRB 4YSCA 1NPNA 2IDFA 4GXFA 3ZDWA 1AZBA 2IWFA 4KNTA 4E9XA 1CYXA 4YSOA 2GC7C 1PAZA 2FTAA 4YSQA 5I6MA 1SDDA 1JZJA
chains in the Genus database with same CATH superfamily
5I1CH 1M42A 3FULA 4XXDA 3U4AA 1SY6A 5D70H 2BSTB 4PFEA 3MMEB 1LQSR 4A6YL 1M6OA 2GBUA 4WO0A 4YHOH 4HJ0C 2DICA 2Y3AA 1A3LH 5EU5B 4AXWA 2NY7H 3FMGL 2W9LA 3K3QA 4OQ1A 3CDZB 3LRHA 1HOEA 1W0WB 3FZUD 2CG9X 2WQVA 1TJHL 1UVQB 4LAQL 3L48A 3G9VA 2RD0A 3D69A 3ATAA 4MB3A 4F7PA 5IQ7H 4ZW8A 3MNZB 3IGUA 2VLJB 2JQAA 4NXSA 1F45A 5CS7A 2ZPKL 3SCMB 2XHNA 2P43B 1IJ9A 4EIUA 1A7PH 1E6JL 4I3SH 3OD3A 3VYOA 1T5KA 2BHFA 2YN5A 5HI3D 2J6EL 2JK5B 5MI0B 3VFWB 5T5NG 1IU1A 1KJ2L 3DX7A 3H53A 4PRAA 1FV1B 5DMIH 5EIVA 1I4FB 5KSBA 3PDDA 4GXUN 5ADPL 3B37A 1U91A 1R34A 3RDTC 3SPIA 1ETA1 3MLWL 3MUZ1 4Z18A 3T08A 3NSJA 4FYRA 4AGOA 1ZA3B 3HHSA 3HR6A 2H26A 2O4EA 4QOKD 3VJ6A 3PNWA 3TVMB 1LDPL 3QPQD 3FQNA 4F9LA 4KH9A 2X28A 4NGHH 2R0LH 1CBJA 3QNYA 2TAAA 5AVZB 4X7FC 1I3GL 3HG1A 4CKVX 3VXPB 3QW9A 4AMKH 4HFWB 1T6WA 2YD4A 3BW9B 3FT3B 4NUGL 4PP2B 1KEMH 4CKQA 5D6DC 1EO8L 1P6AB 1CDIA 2A4CA 4JMXA 4ODXA 2EE9A 5EO1B 5I6OA 4BXVA 4YDIH 4X4YB 2R23B 3MCKB 1T80A 4PV8A 4ZMYA 3KCWA 4GG6A 3OXSA 3MRIA 1RL1A 4PREA 3VFGH 4IKKA 3KR3L 4MCZA 4K3DL 4IDJH 4N2IA 3HMXA 3F5WA 4P48A 1CXIA 2MSPA 1GMIA 1I8AA 3MNVB 3U6RA 2O5XL 3DETD 3GEFA 3VXRE 5F3BA 3Q1EA 3QO1A 1HINH 3WTXA 1FN4B 3RUGF 2VAAA 4KJQC 1YQVL 1WHPA 3VCLB 3EBHA 4XB7A 2IEPA 2OMXB 4DOHE 1MI5B 3O3EB 5D8JH 2YO3A 4U3HA 2WZ0A 4PJDB 3C08L 4B5EA 1E6OL 2KH2B 1AJ7L 4LLYB 4JKPH 3BSGA 4Z7VE 1UKQA 3RIFK 1T1WA 3T4AA 2VO5A 5IQNA 1I9RH 4ZFOA 2P46B 2YRLA 3WNJA 3FQ4A 5LDUA 3NCXA 5LHDA 1PDKA 3DVGA 4OI9A 3N40F 4GFXA 1TSRA 1A6TA 4OUUB 4PW3A 4PVMA 4ZG1A 1BV8A 4KQ4L 2B1AL 4G80A 4DWHA 3RPIA 5B7MA 1E4WH 3DRTB 3GGWA 1ES0B 4UAOB 4UQIM 5AB9A 2J8UF 2L8AA 4IK6A 1PU0A 5K5YA 1VKXB 2NR6C 1OGAA 4G8EB 2XBTA 4MD5B 1CGSH 2BJML 3DECA 3QNZB 4NKIL 1N4XH 4OZ4B 4RISH 2VW4A 3GIZH 2HTLC 3CFEB 4HJ1A 4C4KO 4FF9A 4PGEB 1UXLA 4L9LB 4N2EA 2FQDA 2YS4A 2G3NA 3F7RA 4GIOA 4QNPF 4KAQH 2P5EB 4HD5A 5JHLL 2GTZB 1G5AA 1FAIH 4GAFB 3VGBA 5E08L 4IHBA 3QJXA 4FTVD 5GS2H 1EZVX 2R15A 2UY6A 3C6LC 1IEBA 4HKZA 4F8TA 1DQDH 5E95B 3L1GA 4L4VB 1TOXA 3TX4A 1DCEA 2WXPA 1DQKA 3NIFB 4RCAA 5GZOC 2NW2A 4PSRA 3TA4D 1JV5A 5J57B 2I85A 2NX5A 4C59B 5TD4A 4HIJA 3Q6FB 4JN1H 2OYMA 2XPYA 1C08A 1Z9SB 3NPZB 1ET7A 1BQHA 3UAJA 1IILE 3LSOA 4MMXB 5EZJA 2CLZB 3L8QA 4X4XA 3CC5A 1CIDA 5C0CB 5LCVA 1BZOA 4N6RB 4DZBB 4ELME 2Y25A 3VD7A 2E4TA 2A9NL 1UG9A 1G7IA 4F15C 2OBGA 3DV4B 3SKOB 5KANI 3MACL 2JKXA 1RJLB 3D2UD 1IUZA 2Q9OA 1XR9B 3B7TA 3EYOB 3R19A 3HC0A 4UDUB 4ZTOH 4HK3N 4R97C 2CIKA 1K8DB 4LLDA 4B5ZA 4FQ2L 4GAGL 3S4SB 2N3JA 5HGAA 1Q90A 1HH9B 3KNBB 4N2NA 1YEDA 4XWOC 3AAZB 3M1OA 2Z8SA 5DJXB 1HHGB 1RLWA 3BAEH 1A7NH 3HAEA 5JO5B 4WTZG 2QQLH 1QD0A 4ZQKA 4P4KB 3WDJA 2LOEA 1MVYA 5GS0C 1JNHA 2AAVA 4F7TB 4Y4FD 4HUUA 3FUNA 1CGWA 5I0VA 3VXUA 5HYJD 3NCYP 5KTEL 3RPKA 2JB6A 3FQ2A 1RZPA 2GPZA 4X9IA 1B2WL 3PAZA 4FNSA 4PRHB 5JW3L 1THAA 1F8TH 3U9UA 3RNKA 3MJ8B 3CK0H 2JMRA 3Q13A 1MF2L 3HI5H 2H6PA 4NO5A 4DPRA 4N68A 1YC7A 2X4QA 1TTRA 4NENA 4U1SA 4GG8B 3L5HA 1EEYA 4LRIA 3BUQA 3FO2B 1KFGA 3EFDH 3D1MC 3RVWD 1FO0B 2B20A 2EYRA 1JVOA 3RWDA 3RVUD 4OZIB 1V54B 3T65A 1NQBA 2AJUH 3BYTA 4NQXA 5F96L 3JV6B 4U1JA 4LEOA 4OZGF 5I6LA 4OF7A 1DBAL 5KS9F 2JKLA 3UAEA 5LXGL 5J3HC 5E6SB 4GKLA 2DQIH 3QT2A 4HMCA 3KE0A 5FR3A 1C7SA 3EO1B 4HIXL 4YH6A 3ZZLA 2YSSB 4Z77B 4XP1H 1BZ9B 5HHNA 2AJZA 1YAZA 4S1SL 1OL0A 4IKJA 1ZRUA 3HE6C 4GSDH 2B8OT 5E94A 1HK6A 4EUPG 5L9DH 3AXLB 1RVFH 3RIKA 4OVUA 2YA2A 4OV5A 3C9NB 1Z5HA 3D3VD 4WUUE 3VD5A 2VYRE 3IFLL 2CMRH 3MR9B 4CVUA 2Z92A 3L45A 4P46B 2RAMA 3HC2A 2XIDA 4KJYA 2WSPA 4H44C 3UTTE 3SY0B 1NM4A 2WP3O 2R2EB 3W9DA 4KKQA 4R7VA 1MG3C 1AQDA 3ATFA 5HTSA 2XXCB 2QKSA 1P1VA 1BG1A 1VERA 5BS0B 2R1XA 4Z23A 3ARDA 4OUOA 2J3SA 1WZLA 4DCQB 4IRJB 2YUWA 2ARWA 2QSVA 1HAUA 3LRSA 2F08A 4Y5XA 2EEBA 4WVRA 1NIEA 4LPCA 4Q0XL 1E9QB 5KVMC 3P0VH 1FLRH 2DEYX 3QARA 3LQAL 3FRPG 4OZHE 5AKVA 2VDNB 2VLRD 5TE4H 3BP4A 3QFDA 3I6LE 2OP4L 3RVVC 4JR9L 3WY1A 4TNGA 4KFZC 3EYFA 5ID0A 4LFHG 2UX6A 5EIQA 5T33L 2E27L 4X9GA 5FYKU 2UUDH 1IKOP 2OX5B 4HIHB 1BOGA 4OJAA 4QHNA 4GRLC 5I66A 3PWVA 1KYFA 1UWEL 1HL5A 1XB8A 3QDGA 4NBXB 5GGSA 4G6JL 4KROB 4AGMA 2CLVA 1B2YA 2APFA 1L3WA 1Y1UA 2XWDA 4KDTA 4WHTA 1ZE3H 3BWZA 5JOFB 3Q8FA 4K5OA 3S5LB 4QRUA 4P8QA 1HESA 3QNXA 3WDIA 5FLVA 1VRSA 3JWDC 5DLMH 4DKEL 1T7ZA 1A8JH 1RZIA 3PWNB 2OMTA 5F6IB 2ERJC 3FU6A 4YHMH 4AH2A 4M1GH 4LNRB 1KLUB 3HFMH 1MFNA 1CF1A 1NWOA 4FQCL 2R0KL 4NO2B 5DGQA 4QXUL 1I85C 3NVQA 1DQTA 4OLXL 4NAQA 1N70A 3CZLA 4G8GD 4JFHD 4N2GA 3UGUA 1EFXA 4GAYA 4HZLA 2X9ZA 5C0JB 3RTLA 2XN0A 3QIWD 3QCUH 1HS6A 2WHVA 3MLVL 3L9RA 5L2KD 2VDPL 3V0EA 4RSVA 1NFAA 4IRJD 2B1OA 3VX0A 4TULH 4F57H 1G6RA 2HLFD 5CFHA 2MNJB 2HG5B 5EF2A 3U4EB 4LCUA 4W4OA 1NGWA 2HVJA 4ACTA 3DXAD 3L4VA 1N7MH 5LUMA 4KTDH 2WQXA 2UVEA 1T21B 4XN8A 3UTPD 2EZ0C 1A4AA 3DMMB 1XIWD 4MCNA 5D7IB 2F15A 1SF5A 3RJOA 3SBQA 5B4MC 4UT9H 2WJ5A 4XAWH 1C1EL 5F9AC 1NUNB 2YZ1A 4UIKL 4OZFH 4JM2D 3CN3A 4YBLC 4P23D 4YHYC 4MAYA 5EZLB 2W5PA 1EHAA 1XGYL 3CD4A 3ARZA 3S3CB 1R5VB 4G7VL 4WFED 5EN3A 3VD0A 2V2WB 1URLA 5DD0L 5A7EA 1LWHA 1FNLA 1E40A 1EV2E 1EH9A 1OTUD 1UYWH 2DBLL 3BOVA 4WW2A 1HCYA 3IJYB 1RP8A 5JIPA 4P3WA 1N5YL 2HT4C 5FK9B 3KM2A 4HJJL 4JZOA 4YQXH 1DANT 2VXQA 3OMIB 3F84A 4J8QA 4I18A 4R8WH 3JWOC 1ZT4B 3BWUF 3BVDB 3PV6B 3VXRB 3P69A 5T3XE 4HCRH 3E6FA 3S36X 1WV7T 2WCGA 1CYWA 4DOHB 4F8NA 5I2IA 2P8LB 3OWEA 3MHZA 1KELL 2OJZH 1FVEB 2D0FA 4M3KB 4YE4H 4Z7VB 1KB3A 2PNDA 1V7MH 3OB0K 1WCBB 3F04A 3QK0A 1KBGL 4L2YA 4F7EB 4IRSA 1HHJA 1IBGH 2IDFA 4BZ1L 2DJUA 2ZUSA 3CFKB 4MZ3A 3QZOA 4QHLB 5FYKD 2YQGA 4JFED 4YR6A 2A0LD 1KUMA 4H5SA 3SKJL 5IBUG 3BWUC 3DK0A 4NQDE 4K7PL 3DKHA 3WO4C 2YGQA 5EUKA 4OLYL 3T0XA 1DQJA 2IAND 1KCLA 3T0EE 4M7LH 1DDHB 5DWUH 1KXQA 4YSAA 3PP3K 2B0SH 1FH5L 3SDXA 2Q76A 3AQXA 3UP6A 3EOBA 4XN4A 1HWWA 5FM4A 1OLLA 4UV7L 3QHTC 3Q8BA 4U3XA 5AAMC 4LCWA 2VXVL 5H94A 1A1MB 2ADJA 5KYUB 3GZKA 3QUYC 2R4SH 3KXFE 3BSZL 5DEGB 3V6ZB 2RB8A 3TNNA 4R4NC 3Q2WA 1YMHB 2D2OA 5FUCE 1G87A 5HD8D 2ZCKL 4M6OH 1J5HA 4AQAA 4ODVH 2FD6L 1MW3A 4I2XA 4TTDC 2CA3A 4XZ4A 3FB8A 4OCWH 1WUNT 1JXKA 1UWGL 4HDIB 1XHHA 3MUJA 5FYJE 1BWWA 3FHAA 2WLNA 4WJ5B 2ICWB 3C60C 5D2NA 3RVXD 4KKPA 3LN4B 2JELL 5EWIL 5ICXA 5MEQA 4ZXBD 3RY5A 3U9WA 4IKNA 5C0DB 1T03H 5IFJA 5C9KA 5B3SB 4IBVA 1B6DA 1QSFA 3FOLB 1SBBA 2HJLA 1BJ1H 5EEWA 1J8HE 2HMIC 2BOCB 3JWDH 1R19A 4FNRA 1GGIH 2IDCA 3DTXA 4CN1A 2X4SA 2MWCA 4HEME 1CFVL 4WU5B 3MZTA 4LOFA 4FQLL 1ZTXL 3VA6A 3GMRB 4P5TC 5F1NB 5G4NA 1D5XA 2XWTB 2Q86A 1T66D 1CVSC 2KZBA 1QHOA 1EJOL 5F88B 1HI6A 3LDBB 4PJ8B 4N85A 4HU2A 4R90L 2UZPA 4YLQT 5TDPA 1KTKE 4R26L 1B0GB 2MQ0A 3DVNB 3NYKA 1RHHA 2IAMC 4G7YH 2NY6B 1CICC 4HJGA 3K8MA 5FO2A 4AENB 5EUOF 2O26U 2CA4A 5CBEA 3V8OA 8FABB 1WICA 1ZV5A 5FDYA 3WFEL 5I8KH 2J6EA 1OLZA 2ZP9A 1Z3RA 1E67A 2JJTA 2VM9A 1BFVL 2F8IA 3FO9B 1OWWA 5D5MF 4Y8DC 5TPWL 5KUMA 3VFSA 1J1OL 4X6BB 2EXTA 5TDOB 5D7LE 4WEBH 2B15A 3BWSA 3SEPA 4JNXA 3KPNB 2CRMA 4P3CH 2IPTL 2WCSA 5K39A 5T5FH 1ZHBA 3Q7JA 3LPOA 1P6WA 5I9QC 2DM7A 4PRBB 2GUOA 1FNGA 2GSMB 3VH8G 4FA6A 4FX5A 2JJWA 2A9AA 2FIKA 4FG6D 5F7DA 1YJDL 1K9TA 2RCSL 1MREH 4WHYH 5TF0A 5GSRB 1GVIA 3GBMH 5FOBB 1AKJB 4ZNEE 2YR3A 4JANB 4PJ9A 4YHZL 4JM4L 4RFNB 1X44A 4KTEL 3IK2A 3UMNA 3BHBA 5IEHB 3DBSA 2ODIA 5CJXA 1G1CA 4M56A 5EEYA 4O9HL 5AZEL 5JXAH 5E0FA 4AEIH 4IIQA 4XHJD 5FM5O 3V4PL 3BAXA 4GW1A 3VB9A 1M9SA 1AR1C 3OMNB 3B9DA 1WTLA 1Z5LA 4LHJB 1H5BA 1SEBB 1MVUA 2IPKB 4ZTPH 3LZRA 3P9LA 4U1KB 3ZHDA 5KVGH 3QIBC 5GSVB 1GJIA 2WLIB 4OCNC 1S4IA 3U0WL 4B50A 4KOBA 4GSRA 1LDSA 3PXLA 3MOBH 1JGLH 1VGKA 1QLRB 5KSBF 2XA8L 3B6SA 5A1AA 5BV7B 4UBDC 4CUCA 3HNTL 1NUGA 2W9DL 2GK0A 4P3DA 2LAAA 1ZHNA 2PMZA 4HX1A 4RMVA 1QBML 5C3LD 3I50H 1ECZA 5EO0A 1WAAA 3A0OA 4KKLD 4LKCA 5KYYA 3UTZB 1A47A 1LTXA 1CK0H 5E1GA 5EOCH 3WJMB 5GRVL 5CZXD 4BCYA 3HI6L 2E7CA 4NHCH 1OD7A 3DARA 3ML8A 5JIHA 1OP9A 2AP2A 3KLKA 1M71B 3P3UA 4R5VA 4WV1B 4EN3D 4UM9A 1CCZA 1X5HA 2CO7B 3T3PE 4JQIL 4MNQD 4ETYA 1UJ3B 3WUWA 4E9RA 5I18H 2BW5A 2XN9D 2OK0L 4OZHB 3ZHKA 2NXZC 1J8SA 1JHTB 4HYTB 4PJGE 1KXTA 3IDMB 1OB1B 1RULL 5CKGA 4GKOA 3QEQD 4ZFFB 1NDGA 4JFPA 1L4IA 3WOVA 4U0RC 1VAHA 4L8DB 3MV9D 2H4EA 2BLFA 3LS5H 3PABB 5JHLA 1NSNL 4GG6F 3NACL 4DW2L 2C1PA 4N22A 4YPGB 4EI6A 1YEGL 4NCC1 3U0TB 4P2RE 3SZKC 4N90E 4OFDA 4F9LC 3VXSA 5I1AB 3RY4A 1MCOL 3G6DH 2Y5TB 3G5VB 3ZE0F 3MREA 1H8SA 3GB7B 2PXYB 5C0AB 3IJEB 4U1MB 3DHJA 1TPXC 2VW7A 3QDMD 4DP7X 2C7UA 3MUHL 2ICCA 1IGTB 3NN8A 4GRMB 4WUUD 4HBCL 5HJGA 4YSSA 2QEJA 2QGEA 1I7UB 2HT2C 3ZL4H 4Z7OE 4RAVA 4ZMWA 1R0AL 3WIAA 3FSZA 1CLOH 4N9GA 3A6CL 1F97A 3B2UC 4R7XA 3UTTD 2H41A 4G1EA 4NDMA 1Q9KA 1P9MA 4J4PD 12E8H 4K5PA 3KJ6L 3SDCC 4DVBA 3L3OB 4L8CB 3BT2H 3CVHL 1WLHA 3SE9H 5I71C 3ZYZA 3ATEA 2YD6A 1JPTL 4X99A 3WNLA 3ESMA 5KJRL 4JFTA 3WV0A 2FR4B 3S3PA 2ZSVB 1DEDA 2BP8A 3S5YA 1G9HA 4LGPB 2ZUQC 2DIBA 2V8LA 4MAZA 1XO8A 3L3DA 4JVPA 4K23L 2X1QA 1ZOXA 4LF3A 4LSPH 4KRPB 1BYNA 4ONHB 2WO3B 5KAQF 3S8FB 3VFNB 1L5GB 1ECYA 4YHNA 2NQCA 3AACA 3H42H 2XVLA 4O02L 3IGAA 3UJJL 1DQQA 4IBWA 3VXMA 5I30H 5HHOE 2YD3A 3BMVA 3IU3A 2XXFA 4XCCH 1IGYA 3RVTC 2J57A 3LKQA 1ZLSL 4J5VA 3NPSB 1K72A 3L5XL 2HFFA 2DM2A 1U8NB 4N0YL 3U25A 5DMKB 5JR1H 5D4QA 5MEOB 5E8PB 1S5HA 2WNGA 4NPYA 5DUPL 3EFOB 1J1PH 2A9BA 4NQSA 4AC2A 4JQVA 4FDWA 2UWEB 1QKZL 4BKSC 2HKFH 3ETTA 3GSNL 4MKMA 5KJ7E 5HHMB 4OFKA 4RIRA 1JUFB 1OB0A 2AXHA 2E4FA 2VC2H 4WI4A 4X6FA 2WVTA 4M61B 3K2MC 4QI3A 1CFMA 2XVKA 3O0LA 4E9YA 3SE4C 5A3ID 3B9EA 1P2CA 1GJWA 3MRBA 3Q5YA 3ML9A 2ZP0T 3B2PA 4GIAA 1H19A 2JCCE 1T0MB 3HJ0A 4JHWH 3KS0J 1TTFA 4UQ2A 5CEZE 1NMBL 1FZJA 1T5WA 1QBAA 1FZOA 5AKTA 4JG1L 6CGTA 2EYSB 2EAEA 3F64A 3G5XA 4M7KH 3N42F 1A9VA 4O2EB 4QHUA 4LGRB 1B3JA 1RK1B 3CDGB 1G9ML 4OIIH 5FYJU 2Q3ZA 4RX4A 3VG0H 1KY6A 1HHIB 5DJYA 3UAJC 1IL1B 2ADYA 1D6VH 2AANA 1URZA 1MFAH 1MY7A 2Y23A 5GGRB 1SXBA 2EH7L 4PLKC 4WO4D 4PJBA 1SHMA 2YAMA 2XV2A 1J86A 2GIMA 2YQ3A 3HG2A 4U6VL 2WXIA 1P5VA 2BZ7A 1VPOH 4UV4L 3VMNA 3UPRA 2EXYC 3D9AL 1VEPA 3JT2A 4FJYA 4MNHA 1EIBA 4ZSOA 1E7VA 2NLJA 4NQDB 1IC5H 1GJUA 4PVLA 5DFWH 2BC4A 4WI6A 5JW4M 3QORB 3CFTA 3HN8A 2DQEL 4OT1H 4QF1B 5BJTA 1N6VA 5BRZE 3L4XA 2W91A 5I74C 3TP4A 2DWTA 4P2YA 2A9MH 2YHGA 3HZ3A 6FABL 1HX0A 1TITA 3PWLB 5EN2B 5D7KD 4ELDA 1JNLL 1JPFA 3TZVC 3SDAA 1DQLH 1YPZA 4JG0H 3QO0B 4MMYB 5D1ZA 4F7CB 4UIMB 3RL2A 4AEFA 3PY9A 2ZP8A 1G1OA 1AMYA 4LVHC 2XZCL 3KXFB 1FE8H 4WGVB 5ITFB 3HR5A 4LASH 4XMPL 1M2VA 3WNNA 4XVOA 1CFTB 1OP5K 2AV7A 4QHKI 5ICZA 1J8RA 4L37B 1OSZA 1CQYA 5MENA 3NCMA 1MFBH 5K9QG 4XBPB 1CT8A 1FGNL 4LRIC 5E03A 5IBLC 1SEQH 3QH3A 1HWGB 2DTMH 2L04A 4DT2A 4K73A 1D5BA 3AS1A 5T3XD 3WCYA 1NFDB 2IBZY 4FHJA 2N01B 3T3MF 3L3KB 2BSDA 1MHEA 2WSKA 5JNYA 2CDFA 3H7LA 3PJLA 1DQML 2XPZA 3CXHK 3ZYOA 3FH5A 1Q72H 4JPVH 1AR1B 2ADFL 2D3NA 3BP6A 3MU3A 2DS4A 4AGPA 1LP9F 1FYHB 3FTSA 3NABH 3SQBB 3DX6B 1I1AB 1TZHA 5ISZA 4PH8A 4BFOA 3EGDA 3UBGA 1XF1A 2ZWKA 5I1HL 3TN0B 3U4BH 5CD5D 5IEKB 3IDNB 5A6LA 5CUSH 3ZY7A 2YUZA 3HZMB 2X6VA 4GSUA 1NLBL 2LE9A 5IMKA 3HMXH 1ZS8A 1U8JA 1CDJA 3T9WA 5E1HB 3HBZA 4GB9A 2WBJB 3L4UA 3Q44A 1NGYA 4WF7A 4JY6A 1NCUA 3T0ED 3CUPB 4PYHA 1XD0A 4U2YA 2D31B 5T3ZH 2AK4A 4PRPE 4YAQA 2F19H 4O00A 4UYQA 4ONGL 4L5FH 3TLRA 3TWCH 4G43A 5J89A 1HIMH 2D3JA 3EADA 1FL3A 1QNZH 4LSDA 3ARYA 2VLKA 4A63A 4X6EA 3BCDA 5DZ9A 4PB0L 3II2A 4FKEA 4XMLL 2AK1H 4AI7A 5BRPA 3ARDC 3ZDXE 1DVSA 1NAML 4FLSA 4JPSA 2Y7SA 4RGNB 1JGVL 4Q4EA 5C7XH 4OGZA 4BSWA 5E1AA 3VFMA 4TUKH 2A6IA 3S4SG 1A6ZB 1G7HB 1ZTMA 1IM9A 2HTKD 3TBTB 3O9WD 4JFFD 5EEXA 2FGZA 4YIQB 1AC6A 3TESA 1ZGLB 3LNFA 2BVTA 5FYJD 1T0NA 4MGXA 1M1XA 3UCRA 3PL6A 3QRLA 2FT8A 3PGFL 3WIHL 1MQKH 1QQDB 4JCLA 1J8HD 3MRNB 3JVFC 4OCXH 3V0FA 4IKIA 3ZL2A 1G7MA 4OLWH 3LTVA 1ZVHA 3A23A 3AZUA 3CG8A 3CLFL 3MOAL 5DZJA 3BXNA 2BIOA 4YDVA 1SGKA 3FYIB 1CUOA 4FQIL 4YO0B 4I89A 5SWSD 1HOCA 1IAOA 3AU0A 1KV3A 3SPGA 4KDTC 4AIOA 1MSPA 3DV6B 4AJ0A 2CK0H 3LEXA 3GLDA 3NFSL 1DFBL 4YDKL 3NCEB 4C4BA 4Z3GA 3B3BA 1IKNC 1CG9B 3IWVA 4HXBH 5IJVB 1QO3A 2V7HA 5F2FA 1BVNP 3F58H 4IK7A 2JTDA 2XN2A 2VDML 4PJ6A 4FNQA 5CMAB 3V0WH 3D12B 3L3GB 1P7KB 5DA4A 3ZKSD 5I5MA 2Q8BH 3MA7A 4JCWA 5CN1A 1WIUA 3VSVA 3R06B 4ZUWA 2V3EA 4PWHA 3RDTB 1XGQB 5JYMA 2FWOB 2I60H 1VFOA 4X98B 5CP3A 4A7GA 1KYDA 4BZ1A 4MXVE 2UY7B 2GCYA 3JZYA 3ZQWA 1PQZB 1E2WA 5LCVH 3T3PB 2BDNL 3VWJA 3EYUH 4ZD3H 5D7LD 1EHLL 4MNGE 2ZOWA 4Z5RA 1EEQA 4LPUA 1AO7A 1BBJB 1H9VA 1MIMH 5J1AA 4MVBC 3DIVA 3DLQR 1K6QL 3O3UN 1XBRA 1R33A 1XCTA 3D8MA 3EH1A 4TSAH 1NFIA 4WEUD 1D5ZA 5GISL 2A3TA 3CGTA 4JPWH 4W4OC 4XVUC 4WW2F 2ESVE 3HAEH 4NZDA 2OMYA 4FG4A 5EA0L 5AYUH 2ZJSL 3EDFA 1NIBA 2XNAA 5AWNL 3OF6D 3W5MA 3MJ6A 4NRXB 2P8MA 2QVMA 5HY9A 3QEHA 5T1LB 1F3JA 2VQ1B 3PQYE 1FIEA 1NGZB 2VZUA 4H8WC 5D6CB 2BY2A 1MCDA 4FI7A 1DJHA 4S1DD 3I2CH 3BSZA 3HG5A 5KVGE 1RK0B 3UTQA 3EGXB 1TZGL 1UM4L 4FLQA 4Y1TA 1WIOA 1KNOB 1T89A 4JW3A 4LSSL 2ICWI 3KGUA 3B8YA 3GHEH 1J10A 1XAKA 3NIGE 2OXHA 4U6HB 4K8RD 3O4LE 3UABA 2FZ3B 1A9BB 3QUXC 4Z7OB 1VFAB 1JXJA 3O6LH 1NA8A 4M1DL 5EZOL 4OJFL 2G9KA 4GEIA 2WXLA 5AVWB 1B4RA 1WWAX 2EC9T 3ZIMA 3EJYC 2OQJA 2PO6A 2J71A 4DKFL 4WK4B 3WKYA 5JHDD 4I18C 2CPUA 1M3JA 1AR2A 3QWQB 2A4ZA 5L8JB 1UCBL 2MTPA 4CN6A 3RWCA 3GSXA 4J3SA 2Q8AH 1YN7A 4UZGA 3S5LG 1JRHH 1Y6NR 3N50A 5L0QC 2N0MA 2NUPA 4X9FA 3O3DA 4TQEH 2HA1A 5G2NA 4HG4K 3ULVF 3TO2B 2BNQD 4U4IA 2NTFA 4JRLA 4HKBA 5SX5H 1A4KB 4OLUL 4UTBL 3V6OC 4WTZA 2IGFL 3BP7B 2X88A 3WD5L 4PD4J 5IESH 5HHOB 4JO4H 2JCWA 2P45B 3UH8A 1NBYA 3OKLA 3C6LB 5L88H 3DHPA 5IB5B 3MO1B 3QS3A 4JFXA 3V5HB 4EI0A 1R3HB 3P30H 5DJ0A 2BOLA 2W07A 4P2RD 4JY4B 2CBPA 2DYPB 4YHPB 3MX0A 4HT1L 4QXTB 4N1HB 3I3EA 4JKLA 4C58B 2OL3A 2IDQA 4K2UL 4DVRH 2P80A 1SHSA 5DYFA 5LG1A 4PG9A 1A1OA 4P2OD 3ULVC 5JQHC 4PS3A 4RLDA 3ARQA 1WJ3A 2R1YA 4MQTB 4XCEA 3JV4B 2ZXEB 4KK9C 1TJMA 4F15B 2XTLA 1F18A 3C5SB 2D73A 5HGHA 3V4PA 5LVEA 3KWWA 2UYLB 4P57B 4ZPTB 4BHUI 4ANXA 3SE8H 3GO1H 2QTVA 1UKTA 1CWVA 5A40E 5IQ9B 1XH3A 5IHUH 3O6FA 3N6YA 4M7LT 3ARFB 2DQTH 2AGJH 4GAJH 3ULUL 4O2CA 1DVUA 2L7QA 2VXTL 2WOBA 3QQ4B 5E2UH 2ITCB 4R96B 4NQED 2WLMA 4Q6YA 1WDAA 3RJQB 1YEJH 2DMGA 4EUPA 2CHXA 4P2QD 1SFDA 2HFGL 3E9TA 2WWKT 1P4IH 1QHQA 3E7JA 3U7WH 4QGTA 3EKCA 3FTUA 3H9SB 2BP5M 2QSTA 4YVNA 5KSAC 4L1LA 2XG5A 3LD8C 2CALA 3TYGH 5FA3B 2NCMA 1J9CT 1MLCB 1UATA 1VB9A 4E5XB 1HEJC 2XQYK 3SYPA 4P5MA 4BDVA 4YXHH 3IDJA 1ED3A 2EH8L 1WYJA 4RA3A 2FT6A 4JQIA 3GI8H 4DK5A 2F74A 4YHLL 1MLBB 2F58H 4S0SD 4F92B 1HXMB 1U8LB 4JHVA 2FLRT 4I0CC 1GS8A 4Q2ZA 3QUZA 2EEFA 4YGVB 4UT6H 5DD5L 2ZCLL 1BBDL 2E86A 2JJTC 3O81A 2B59A 2N0KA 3FRPA 5BMFL 3FPYA 5T1DL 3JTBA 4Y9CA 3VFOB 4F8LA 1BZ7A 5ERWB 5IF0B 3QFJE 1VEOA 3FONA 2C3VA 3QE5A 5IOPA 1IGCL 1S5IL 3HE6B 3PHQB 3KPLB 2Z31A 3O3BB 1I7TB 2X0UA 3DRQB 2GQHA 4N2BA 4OAWA 3DX2A 3LV3B 1DE4B 4H8WH 1VFBA 2YPLE 4MX7A 4WWKA 1NJ9A 5BQ7A 4N9OB 3MBEA 1MHCB 2LVCA 3MLUL 2PCPA 4JPIA 1THCA 1VFUA 1TVHA 1JPGB 3NK4A 4NQCE 3TA3A 3TNMA 5C2UB 5JPMA 2I9LB 2QPFA 32C2A 5FO7A 1WA2X 4X7TA 5EOTB 3QRGH 5FO8A 2NZ9C 1NOAA 5TGBA 5JORA 1FYTA 1CLYL 4IIQC 4IS6B 4YWGL 1IQWL 2K78A 4AIZB 3CQPA 2WYTA 3QQ3B 5FKPA 1BZEA 1Q9LA 2OMZA 4EOWL 1DQVA 4ZO7A 3T0AA 4RGMC 4KGLA 1H3PH 4ETQA 4OV6F 5FAAA 1PAMA 2O5ZL 2W65A 5HJDA 4Y7MA 3JSSA 2VMCA 4L3CA 5BRZD 1GC1L 3GSRA 4PY8J 3FT4B 5E4EC 4UQAA 5D1QA 5DZOA 4PRPB 1M56B 3F12B 3VU1A 1CD8A 4MJIA 1PYWB 2G3MA 2B39A 2YUVA 3GS4A 2YWYA 4JG9A 2VUKA 5B8CA 4Y16B 1FFRA 2H2SD 4XVTH 2A1WL 4K3EL 1YMMB 4GRLB 1IV8A 4OFVA 3DOSA 4O02A 3ZDXB 2OMUB 5KYXA 1P1ZA 3AT8A 4NP4L 1FZMB 4D0CB 3GSUB 3S8GB 1W72B 5I8OH 1MJJA 5I1GH 1EHXA 4G11A 1RSYA 3K4DA 3WNIA 5DHVA 2GEQA 1SUJA 3A4DA 3CMOL 2FX9L 2WXNA 1YEEH 3QI9A 5KSUA 1JYNA 1PZBA 1FFOA 1WFNA 2CHZA 2ZWNA 5D55A 1MXGA 3AWGA 4J28A 3P4MA 4L8BB 4DP6X 4E9WA 2L3BA 1I8KA 1A64A 4M62H 2K6WA 3ULVH 3ZKND 3K4AA 2DQFB 3CV5A 4J6RL 2EC8A 1NOFA 4PJ5E 1MDAA 3HBGA 5D9SB 1YY8A 1S78C 2NY0D 5EG6C 1TFPA 4TVPH 5FYLL 2W38A 3PXJA 2EDRA 4JZNB 5I8EB 2VSDA 3MROB 4P5SA 5F8RC 5I1DB 4FQ1H 1QTYT 1I1CA 3N0PB 3IXAA 3HG3A 4D0BA 2IBBA 1FO0L 4A66A 3ZO9A 3UTSE 3TO4C 4WI2A 3C09C 4XCFH 5AOLA 4HUWA 3FHEA 5TFSL 3VFVA 3WMPA 2PR4L 4J3OG 2YD8A 4U1NB 2ATKA 1LO2L 2VT0A 3KDMA 5JYLA 1YN6A 5AD0B 1P9MC 1Y7VA 4CNIB 1KCRH 2EE6A 1IM3A 1L9SA 3VFTA 3DX9A 5J56B 2AI0L 2EIBA 4Y16D 4FABL 2CO3A 1U8HA 1KTLA 3FMGH 4N0CD 3GRBA 3FSOA 2F61A 4OF5A 3RGVC 3W0WE 1MJ7L 1PX4A 2WWNA 4YBLB 2W0KA 1HTYA 3ZU8A 3L95B 4LPXA 2JI3A 4F8PA 1LE9B 4OLVL 1D5RA 1TVBB 4LE8A 2VB5A 4M9PA 1EPFA 1JDCA 2OMVA 4DQOH 4NZTH 5DEZA 3H55A 3WXVL 1E6JH 5I19H 4PMFA 2BNUA 3HCVB 4Y4HA 2O5YL 4Q8BA 2MCAA 4G6FD 4G70B 5KN5A 2XQBH 1AFVH 3VU2A 4OI8A 3TS8A 2H2PD 5B1JA 3D0VA 1KPRA 1D9KD 4E0RA 4FL4C 3MRMB 1DJGA 1HKLL 4G8FB 3NIGB 4JJ5A 2CGRL 1IIKA 1NC4A 2I7OA 1V7NH 3E2HC 2V9UA 3O4LB 4JQVC 5I76A 4IBUA 5ENWB 3HMWH 1ZDSA 3SODB 3JYCA 2APBA 2V7NA 4LESA 5GQBA 1LO5A 4I0PA 3JV0A 1GGYA 5C92A 4PJBF 3H4HA 3LMJL 3LQZA 1L6PA 2VDNL 3PHOA 1JERA 4KO5A 4DESA 2AQ2A 5MERA 4U1HA 5GJSH 3CXDL 1EBAA 2AJYH 2OSLB 4XP5L 4RWYL 2C9AA 4I3RL 5AZ2H 3F85A 2GC7C 4YFLI 2CO4A 2XWJB 3LNHA 4OJDH 3KR3H 5BZWB 1R3IL 1E8XA 3R8QA 4XMTA 4UQ3B 3L9EA 1GYUA 1F86A 1YPZF 5I17B 1RZJL 3Q6GL 2DBJA 3IFOA 3QUKB 2V2XB 3E0GA 4AMXA 1YQVH 5G5DB 3T1FA 5DT1L 1KCWA 2WQSA 3SKUD 2WD0A 1CFQB 3L17A 1RIUL 1WBZA 4NZUL 2NW3A 1A6AA 3EOTL 3T09A 2ESVD 3HE7A 3FFCA 1E6OH 3HPJA 1AJ7H 5F89B 3DO4A 4XNDA 5CP7A 1C5CH 1OZUA 3PQYD 1SMDA 1BF8A 1WBXA 1NAMA 3S3SA 4QHMA 2BSEA 1PTZA 5CEXA 1G7LB 5BCAA 1PZ2A 5AOMA 5IT2L 3VI3A 1OAQH 2CHNA 2QDVA 4U3SA 1HILB 3WTYA 4JGMA 3BFOA 3C60B 2C3HA 3U36B 3I9IA 4NNPH 1U58A 2DQHL 3IGKA 2Z4QB 3WN5B 1U41A 3LN5B 2WMPA 4XNQA 3SDDC 4HUXB 4QRRE 1PIFA 5HJ3B 2NY3C 1NANH 2V5RA 3L1OL 3QULB 4JFDB 4PJHA 1UUSA 5EOQL 4JDTH 4OFIA 1PX3A 3WIHA 4B7IA 1Z1WA 1DN2A 4C47A 1ZEAL 5EF3A 4V2CB 4P5TB 3D85B 1B4JH 1K8IB 5T1MA 1R3KA 3ZJAA 2QFRA 3EYQD 5IHZA 5E08H 1PIGA 3FQTA 2C1OA 4KXCA 3PE9A 1ZWIB 1IGML 3WGUB 2DI9A 1PZ5A 2FB4L 3AG1B 3DPBB 2IAMB 2YMTA 3OKKB 2UZXA 2FEDC 4U0QB 3V95A 1N2RB 3AG3B 2Q87A 3IMBA 4K9EC 3GMPB 4D9QD 1N8ZB 4K5LA 1ZPUA 3NTCL 2P1YA 2D3VA 1DDTA 5LB1A 5T5NF 3WENA 3VSUA 2X1OA 1OALA 1U8IB 4O58L 1U0QA 3UROR 2VCOA 2DMHA 3HKZA 3GSVA 2BSBA 2DW5A 2UZYA 5EIIB 4IM8A 4OTXL 1UD4A 3K0YA 5I9QB 3BQUD 4NN5C 1MPAH 1E4KA 1UOWA 4KJPC 1KLGB 2VC2B 2WW8A 5EMYA 1FPTL 5LNEA 3QUMH 5KVDL 4IOIA 3BN9C 4PWIA 3G6AB 5EUOB 3K4ZA 1LK3L 3TTSA 1QRKA 3AM8A 5E4OA 4GAGH 1UM6L 1E8WA 4XVSH 2NTSP 2HJFB 5F7UA 4QTFA 4TVUA 4C57C 3QFJB 1HJCA 3ABLB 4KMTL 1ID2A 3ARSA 3L6FB 2ED7A 3M17A 2VISA 1X4ZA 3O2WH 3RKDC 2J43A 5JW3H 1NEPA 1N26A 4JN2A 2Q6WB 1TKWA 3WJJC 3BO8A 3QIBB 1OD9A 1MF2H 3RP1A 5K9KB 4NC1C 2H0EA 3LZOA 3PU7A 2NY4D 1AYOA 3QZLA 3PIQA 3RX9A 4NQCB 2H47C 5DD6A 3K7UA 1Z6JT 2P5WE 3MLRL 4F7MB 3DUUB 1S8DA 1SN2A 4P5KB 4M5SA 4WWOA 5ESVA 3OAUH 4A7GF 1OXYA 2DWSA 3K6SB 1OGTA 3CLEH 3PJSA 3QJOA 3W9EA 1EEZA 1GYAA 2VXUL 3OAYK 4NJAH 3D2TA 3UO1L 1QG3A 4PBDA 3B34A 3GJFA 4YX2L 3S37X 3NZ8A 3MCLH 4F7PB 4HIXH 4LRNH 3VWKA 1OK8A 4Q7DA 1A25A 2BVUA 4QCIA 3U30C 1GPOH 3VXQB 1OF2A 3WTSA 1RLBA 5E8DL 3E38A 1KF9B 1Q38A 3UAFA 1B88A 5MEPA 3IE4A 2NXZB 3H7BA 2VDRL 2MQ3A 1XVSA 4GLRH 3FO1A 3T2NL 4W81A 1KJVA 2E9GA 3OG6B 4GQ9H 3CZFA 4GI8A 4WQOA 4Q89A 1Y6KR 4OFPA 1F3DH 2BSTA 4N5ED 3MMEA 4PJFE 4EDWH 4GUCA 2DZEA 4KJWD 5EU5A 4HWUA 3FCGA 1V27A 4ONOA 3S98A 1H8LA 1FVCB 5ITBL 2Q0ZX 2XV6B 3LXUX 4R2GC 5EU7C 4P9MH 3CDZA 1W0WA 5LN8A 2ZT9C 5JW4Q 3OKDA 4I9WE 2OZ4L 1UVQA 4KHTL 1EZVY 2JKTM 4XPGL 2DKMA 3Q2LA 1C5BL 4HF5L 2A6JB 2KPWA 2YPLD 1MUJB 3MNZA 3P73A 1TPXB 2HAZA 2X3CA 4M8RA 4NO3B 3SCMA 1UZ6F 1UA3A 2PPEA 1KMGA 2BMKB 4QMEA 4WCYL 4NQCD 3VFWA 2DEXX 4ZFQA 2JK5A 1WP6A 4Y2OB 4PJ5B 5KBMA 4N20A 3SDCB 1FV1A 4BFGA 3PGDB 2Z1KA 1I4FA 3RY6A 4Y1AB 2FJFB 3OVUB 5I71B 3ARGB 1T7VA 2E27H 4HJUA 3IM1A 4XXCC 2B2XL 4JRXE 3HW7A 4BUGA 3J7HA 1ZA3A 1IBZA 1RURH 1CGUA 2DYRB 5ESQB 3TVMA 3DK2A 2ZUQB 4Y9BA 3D08A 4BELD 2DWXA 4FFWD 3UTSB 3VRLE 1ADQL 4PRIE 3WYRA 3ZE0B 2W60B 2K4AA 1HL8A 2A38A 3VXPA 4GP4B 3V6OE 1U95A 1BJ8A 4HFWA 4LVOB 3BW9A 3FT3A 4PP2A 4AWJC 1FHNA 4B9GA 4K9EH 1DBJL 5AB0A 3WS6A 5A2JH 1R47A 3QQ9C 5EO1A 4Q74A 5A2AA 4NN7C 5T1KB 3ZQ9A 3W0WB 4X4YA 2R23A 3MCKA 2RJMA 4DUXA 1S46A 1OAUL 2YKLH 2Z64C 2ADIB 4C83A 4HKJB 1QR4A 4G72B 1FN4A 4XCYB 5D2LE 3GNML 3VCLA 2APXA 3QXUA 3RDJA 2AXGB 5GS1C 2OMXA 1MI5A 3LHAA 3O3EA 2BVEA 1GOGA 1E42A 4PJDA 5BV7L 1DANU 2H6OA 3P0YH 4LLYA 2YD0A 3RTQC 2XBDA 3HC3H 4LLWB 2IV9A 3NCCB 4DTGL 5CCGE 2WWMD 1IQDA 5SV4A 1R5WB 2NX5B 3C2SA 5K59E 1A7BA 3C5ZD 4HIJB 3LEYH 3BLBA 4DFIA 3ARGD 4RAUB 3DRTA 1ES0A 3GLZA 3LYRA 2F6AA 4L3ED 4KZEH 3BD5A 5J1TC 2R39A 1VKXA 4GKNB 3DPDA 4G8EA 4MD5A 3K6OA 4MCYB 1EAOA 4EIGB 4GS7C 4FQQB 4UANA 5JA9A 4DGWC 4RZCB 3FU0A 3QNZA 1JYVA 4OZ4A 3CFEA 1NBVH 1PD0A 2FGWL 2AJ3B 4PGEA 5JQ6L 1HL4A 4L9LA 4LSRL 3PWPB 3GZOA 1NAKL 5DD0H 2P5EA 1JZFA 2DBLH 2GTZA 2X9WA 3UPCA 1B4LA 3PWUB 2VLME 3MODL 3QWRA 2CIKB 4P2CG 4Z76B 4J23A 1CB4A 4XC1H 4JFUA 3KGTA 4MKTA 3LKNB 1ACYL 3U46B 1CXEA 1YYLL 4L4VA 2X1XR 1JHLH 3EIFA 1BEYH 4NLAA 2DH3A 5D1XD 5C0BD 3TZVB 1NIAA 1UA6L 3O2VH 4Q9QL 4ZMQA 3OPZH 3VXUB 3Q6FA 3UEQA 2XXGA 5L4FA 4LQFH 4XP6L 5DMGC 1ZSHA 3GXDA 3OAWA 4LVHB 1FBIL 2VN6A 1Z9SA 3OPUA 4NWTH 3U9UB 1Q0XL 2FWLB 4MMXA 2EVJA 2CLZA 3WE6B 4EVNB 3DX8B 4APQC 5D71L 1HNYA 2H6PB 2RBLA 2V8MA 4GFTB 4IGBC 4N6RA 5C0CA 4DZBA 1EXUB 1Z0NA 2BNRE 1TLKA 3CHQA 3U48A 3PFUA 3H9YA 4ABUA 1WWBX 3NJHA 3DV4A 3SKOA 2I9TB 1RJLA 4UDUA 1XR9A 3EYOA 4UNTA 4WKZB 3O41B 4QRRB 1K8DA 3BPNC 3S4SA 5KVEL 1NCCL 3KNBA 3AAZA 3R1GL 5DJXA 1HHGA 5JO5A 2QHRL 4G6KH 3V6FB 4P4KA 2JE8A 1U8PB 3NFNB 1FH5H 3INUH 1KEGL 4QXGL 1YEHL 5H4YA 4JDVB 1HEZB 4F7TA 4LHUB 2B77A 4F3FB 1AYRA 3L4WA 1CE1L 2Y9RT 3GEWB 4PV9B 4DKTA 1CLCA 3H9HB 2N1KA 4PRHA 4WI7A 2Z31C 5B3JE 5I73C 3D39E 1PCSA 2A7BA 2VXVH 5ILTL 3V0DA 3N0AA 3MJ8A 5DF0A 2FBRA 5I1CL 1OF0A 1W0VB 4JZJC 3BSZH 3RHWK 5D70L 3MBEC 4GG8A 4OB5L 2QKIC 1IAIH 3FO2A 3CDFA 4YHOL 3RB7A 1FO0A 2QV4A 1RUKH 3FUKA 1A3LL 3RWFB 3ZKQD 2QVIA 4OZIA 1F5WA 3D4CA 4R0LC 4AQ8A 2NY7L 2PYEB 3JV6A 3ZVVA 1S7XB 2CLRB 2WWOA 1LP9B 4QAMB 1QP1A 3ARDB 3KYAA 3T2QA 1JFHA 5AVQB 4AK2A 5IQ7L 3P3TA 4Z77A 2YSSA 4C56B 1BZ9A 1YY9D 1CFVH 5CLYA 4BEIA 4LCYB 2C4XA 5AG9A 2HLAB 1F42A 3MV7E 3OKMB 4OJEH 5MHSD 1CDBA 3EF7A 2NOYA 1A7PL 2W8CA 4I3SL 2CGZA 4W9HC 1EWHA 3HB3C 3WY2A 1GGUA 4KUZL 1TQTA 4DO4A 1BA9A 3KH4A 5DMIL 1NBZB 4E41D 3AXLA 4BFIB 3PYCA 5BZZA 5EU3B 3IBOA 4Z7NE 2Z35B 5B8CC 3C9NA 3TJEH 5AB2A 1AZBA 1CYXA 1JNJA 3MR9A 4P46A 4ZAKC 5DXWA 2X4UB 1ODAA 2K0RA 3SY0A 2HYMA 1JZHA 4LLUB 2ZUWA 3GXPA 2R0LL 5E6ID 3GDCA 5DQ9B 5C3TA 1JL8A 1UD5A 2X6AA 5BS0A 1EDQA 1J0ZA 4AMKL 3WHXB 5MP6H 2IPTH 4DCQA 1KEML 3QI9C 2P5WB 4IRJA 3DX1A 3OAZK 1WTGT 1XGPB 1CDUA 3TONA 2OL3H 1E9QA 2APTA 1VCBC 1E3FA 1BQRA 1SXZA 4YDIL 1OT2A 1H6FA 4C8XA 4YDLC 2KS0A 3CXHJ 5J4MA 3DOHA 5ANME 3HI1B 5IJBC 4IDJL 5C0NC 1HYRC 3QQDB 3FT9A 4JM4H 3ZDZE 1MJ8H 2RIKA 3V79C 4HIHA 2OX5A 4M29A 3B7YA 1HINL 1OCCB 4FG0A 1WITA 2DM3A 4MRBA 3W3BA 4NZRL 5EZPA 3WI9A 4GO9A 4FZ8H 4UOQA 4EIZC 3MRJB 5D8JL 4DP1X 1LILA 1EA9C 4O2FB 5JOFA 1PZUB 1JD7A 4KWUA 3OJMB 3S5LA 3FB7B 3N1MC 3TGXA 2VN7A 1QI3A 3MJWA 3NCJL 2HVJB 2H5UA 3DC0A 1AP2B 4PJFB 4AVIA 1O9WA 4EUPH 3EXLA 2GJ6E 2J1ZA 4WLCA 5C8JB 3PWNA 2GG1A 4B7LA 1P69B 1YHPA 2W80C 2XA8H 4LSVH 4KDVA 4LNRA 1JP5A 1OVZA 1E4WL 1KLUA 3HNTH 4TSBH 3EBAA 2LTQC 3THMH 2P44B 4NO2A 4DPBX 4BUQA 5PAZA 4U49A 1CGSL 1PZDA 4IOSA 4RMWA 4KVCH 2NY1C 3ZKMD 5F3HB 1A66A 1N4XL 4CBPA 4RISL 3AWEA 3GIZL 4MS8C 5C0JA 2VZ1A 1PF3A 3QUXB 4WWID 4YL4A 5GRJH 1U8MB 2XACC 1RFDH 4KAQL 4AVKA 2OK0H 4WJKB 5H35B 2RACA 1FAIL 4FQJH 3VDCA 3P4LA 2E6PA 1H3WM 4EI5C 5F0MB 3MV01 2HG5A 2YLKA 1DVFD 1DQDL 3GTVA 4NQUA 4P59H 3U4EA 1GTFA 4BIKA 4I18B 4JRXB 3WY3A 4ILDA 2D7NA 4W9KC 3E6FB 3NACH 1UEMA 1JGDB 1T21A 1MCIA 5LO7A 2X2HA 4PAZA 3DMMA 4JN1L 5D7IA 5DR5H 5L0QB 3P2TA 3IJ7A 2CE6A 1ZLEA 2R2BB 1ZCRA 4OFYA 3V0VB 1MCOH 4YSRA 3E80A 1ZVYA 2NY5H 4XVJH 5TE7H 3V4LA 4G6AD 4JVUA 4L1DA 1VFMA 4HC1A 3N06B 4AGNA 3DOIA 4NO0B 1R5VA 2XA3A 2IADB 4AX3A 4HGMA 5IWLA 1ZSDB 4Z7NB 1FL5B 2V2WA 1KN4H 4PJAE 3B7RL 5CGTA 2I69A 5DTFA 3RIAK 4ZTOL 4L29B 1X5XA 4XCNB 3IJYA 1KPUB 4KI5F 5JUEL 5I1LB 3CVBA 5M94B 5FK9A 3VI3F 3KHOA 2Y2TA 1QFWM 4XAKE 1XH1A 1ZT4A 3VXRA 5EU6E 3PV6A 2QQLL 2P3YA 3C12A 2K45A 3Q0HA 3VE0B 2PW2B 4QRFA 4FCAA 3Q5TA 2F8XC 2YJLA 1M4KA 4PJHF 3VAEA 2P8LA 4B53A 4A2GA 2XXMB 3SBRA 2C8NA 1FVEA 3KZ8A 4RBPH 4TVSa 1F8TL 6PCYA 4Z7VA 2WLLA 2IDSA 1ET8A 1TO5A 1WCBA 3CK0L 4JO2H 3VFPB 4TOYH 1QLFB 2L7JA 3HI5L 4KKNA 4J3BA 3PGCB 3ECBB 4PCKA 1KN2L 3LIZH 3VQMA 4F7EA 4GBXD 1GGCH 1T2QH 4NQTA 3CFKA 3KS0H 3QNFA 4U7SA 4O02H 1OSPH 3EFDL 4QHLA 4KI5C 4Z1PA 3UJJH 3SDYH 2WC7A 3C75A 3KL3A 4OW6A 2AJUL 2E47A 2VDKB 4FMVA 1XL4A 1EJ6A 2DOCA 2KHAA 3B1UA 2Q10A 1FFNB 2GEEA 4B0MB 2W0PA 1BYPA 2NY2C 4PRID 4QO1B 1TYJA 4QUOA 1DDHA 4AV0A 5KSAB 4XP1L 3N41F 2X53A 2DYSB 4AQOA 1MNNA 2JKNA 3ESPA 3QDJB 4NP9A 1D5XB 4ORGA 2APSA 2FBJH 5F70A 4GSDL 5D7EA 4DGYH 4ZUTB 4GO6B 3OR7B 3BZ4B 5KYUA 3BISA 5DD3H 3BT0A 1A1MA 2RA1A 3QJTB 1SQMA 5L9DL 1RVFL 5DEGA 3V6ZA 5IJDC 4HBQA 1MY5A 3MRRB 1YMHA 4CL7A 1T0PB 2CMRL 3F7KA 3CE1A 3ARRA 2D9CA 3NH7H 4LIQH 4YSUA 4HDIA 2E46A 5FKAB 4A55A 4HG4J 1KCKA 5DQDH 4WJ5A 3UJTL 2ICWA 1G9MH 3LN4A 4G9FE 4YXKL 5C0DA 3VFSB 3FOLA 4ELMA 4BA8A 2BOCA 4H26B 4YN3A 2CSPA 4D8OA 1DBML 3G6JE 4WU5A 3EZ8A 4HJTA 4B41A 1MELA 2BX5A 3GMRA 5F1NA 3P0VL 2EDOA 1FLRL 1RZKC 2Y7QB 4E36A 3QR2A 5AVYB 2XWTA 3ZBMA 1JWSB 2DKUA 4J2XA 4G1MB 5TE4L 1VZGA 1QFHA 2QR0B 5F88A 4PJ8A 5DRWB 1B0GA 3DVNA 2QT6A 3KLAB 4AENA 8FABA 2Q5BA 4B95C 2F54D 1ESOA 1JNLH 4AYID 3GHBH 4QKTA 3FZUC 1QWUA 3VQ2C 2BS8A 3D39B 3NFPB 4I1RA 1DLHB 3FO9A 4HJIA 4EPSA 4Z3FA 4KXDA 3P9LB 4MS6A 4X6BA 3SYOA 3AGVA 5TDOA 4RGMB 4YC2C 1PKQE 1XR8B 3KPNA 5D7SH 5HHXH 9PCYA 2IH3B 1IKFH 4IJTA 5DLML 3RZCD 5E1IA 1ADQA 4DKAA 4PRBA 4X50A 4YHML 1S7SB 1QACA 4M1GL 4LEXH 1MCPH 1IBBA 5CR1A 3HFML 2VQUA 1GZPB 2F7QA 1OP3K 5EULV 1CC3A 2BY0A 3U7YH 1DVZA 5GSRA 3ZR5A 5FOBA 5F7WC 1AD9B 1AKJA 1EZLA 4NEHB 4RFEB 4NUJB 5A2CA 4JANA 3QRFM 4WSGA 3QPQC 5IEHA 3D0AA 3MV7B 1W9XA 5CEZL 2BNRD 5EU7E 2HRLA 1IBYA 1MCHA 1OANA 4PWJA 1KIQB 1NCTA 1I53A 2HCZX 1SEBA 2IPKA 4LCIH 1XCQB 4TULL 4U1KA 1BXXA 2V9QA 2GHZA 5GSVA 2YXVA 2RQEA 2WLIA 3RIFF 1GZHA 3PFQA 2FX8H 5DS2A 5FECB 4BHUA 1V55B 4OQTL 1N7ML 1KCVH 5GS0L 5CJBA 5IROD 4ZMLA 1PFCA 2IH8A 5KEZA 1QLRA 4Y19D 4UNVA 4J4PA 4OLEA 5DFAA 2VE6B 5EIIG 4W1TA 3BX7C 4UT9L 1EHKB 4HIEB 4BA0A 3KD4A 4XAWL 3K2KA 3MDJA 3UTZA 1ZA6B 3WJMA 3FU7B 3R4RA 5DJDB 1HQ4A 2BVOB 4U1IB 4UOZA 2Y07H 4WV1A 1M71A 2OA9A 2BP0B 2NNXA 5AKSA 4ZMNA 5L8KB 3ULUF 2CO7A 3MFFB 3TO4B 1UJ3A 3C09B 1MW2A 4OZHA 1UYWL 1WFOA 3CDYA 1JHTA 3POCA 1VHPA 2YAPA 3MRHB 3WHE0 3IDMA 1FWXA 1OB1A 4G1EB 4YQXL 1G7QB 2B5IC 3QQNA 3ZDZB 3LCYA 3OSVA 5ACMA 4ZFFA 1WPCA 4UWQB 3B5HA 4R8WL 3UO8B 4L8DA 2F68X 3PGFH 4YE0A 3PABA 3WIHH 5EEUA 2VAJA 4HCRL 3QUMB 2CHDA 4YPGA 1U3JA 2C9PA 3RGVB 1AQHA 3DX4A 3WMQA 1WZKA 1YECH 5JIIA 3U0TA 1YG9A 3L5IA 2WAHA 5DRNB 5IR1B 2OJZL 4DSYA 4FQIH 4YE4L 1NDTA 5DVPA 5I6PA 4LP4A 4JFWA 5I1AA 1V7ML 4UOW0 2E0PA 1RZ8B 3BZFB 1C8QA 2Y5TA 3UYOD 3G5VA 1IBGL 5JXED 5FA4B 3I84A 1AXIB 3GB7A 2PXYA 4PJDF 4Q52A 5C0AA 2J1XA 3IJEA 5DUJA 1ASOA 4U1MA 5KZCD 5IGXH 1IGTA 4GRMA 5EO9B 4E9SA 2JLPA 1I7UA 5CLXA 3O3AB 2ZWZA 1NGXB 1OAXL 3KWXA 4S10A 4FL4B 2XICA 5E9AA 4P04A 2CRYA 4PWFA 1S5HB 4ZOBA 3MRLB 2B16A 3L3OA 1BM7A 3K1DA 4L8CA 2EVGA 4WHDA 1FNEA 5DWUL 2VM4A 5DFTA 2ZOUA 3KPOB 4TPRH 5FO9B 1EHLH 4TXVB 3LKPB 2DLGA 2FR4A 4UTBH 2ZSVA 1RZKH 5AYQA 2Y24A 1OW0A 4KH2A 1JGUH 4EQ2A 2EC9U 3MGOB 4POZD 3SN6N 2WNKA 2FJUB 3O6MH 4GSQA 2FEJA 5F71A 3VFNA 1L5GA 1MFUA 2VN5A 1GS6X 2X1WL 4S1QH 3UOAB 1FZJB 4M6OL 2ZJSH 5AWNH 4ODVL 5A43C 3BIAX 4OCWL 2ZAHA 2HLEB 4B9IA 1IC4H 5AKRA 3BH8B 1W72L 3QJRB 3NIFF 3CSYB 3KWVA 4KNTA 1IBHA 1U8NA 5DMKA 2EDEA 1T03L 5MEOA 3EDDA 3BVUA 4PGDB 1FG9C 4KJQD 5E8PA 4YSQA 1LYQA 3ZOAA 3CCHB 4PBVC 3EFOA 4Y4FC 1KTDB 3JWDL 2BW4A 3OLEA 1GGIL 2UWEA 3M46A 4KUCF 5ELIA 1XF2B 3UPRB 4BZ2A 1JUFA 1OCRB 2GJ6D 3QG7H 4M61A 1GY2A 3HLAB 2R9HD 1PNCA 4XN1A 4MXQD 1S7RB 4WNQB 1UT1A 1ETZB 3O11B 4RETB 4U33A 5ALCH 2MIZA 2KDYA 4UU9A 2EDBA 2VKXA 1NIDA 3EYSH 5EU6B 3M6DA 1T0MA 3S97C 4G7YL 3RVUC 3QJHB 4F24A 3Q9PA 4L4TE 1XH2A 3VFUB 3MC0A 3K72B 1D5IH 4LXFA 2EYSA 3MZGB 5DURB 2CJUH 4NN6B 3SDDB 5CJ8A 2NY3B 4O2EA 1RK1A 3CDGA 2G5BB 2IOMA 5F6HI 3MJ7B 1HHIA 1IL1A 4MMXC 4WEBL 1NEZB 2XG4B 4Y5YB 3T6XA 2RQ8A 1IX2A 1FFPB 4HKXB 5GGRA 1J11A 4PP1D 2WXMA 5T5FL 2IGFH 1F6AB 4GUPB 1O7SA 4F91B 4ZFZB 2GJPA 3KLSA 4M4RB 5SX4H 4AL8C 1YRKA 3KLLA 4NQDA 5JDJA 5GZOD 3VGAC 3KGSA 2KLRA 2VMDA 3B8SA 5DYOB 1MREL 3QORA 3QYNA 4ZW3A 3GBML 4QF1A 1L0PA 4QLRA 4RMQA 4B60A 4DNLA 1Z9PA 4OZIF 1SJEB 3MV8E 5IMOB 1RV6X 4GIPD 4Z95H 3BP6B 3NSFA 5EN2A 3PWLA 4QJ5B 5JXAL 4HUCA 4MQXD 1AZRA 1RKRA 3QO0A 4MMYA 2MRYA 4UIMA 3QCTH 2QZQA 1CJYA 3EGDB 3GM0A 4NI6A 5E9DE 5TE6H 1P0SE 5BOZG 3KXFA 4ZTPL 3IWUA 5ITFA 3X2QB 2IOIA 1TETL 4NN5B 5KVGL 4U1LB 1CVRA 1W0YT 1CFTA 3JWOL 3MUY1 4P99A 4L37A 4XBPA 1Q4NX 1TR7A 3MOBL 1JGLL 1T04B 2H6UA 4FHBD 3UX9B 4XAKD 1F0LA 1R75A 4G9FB 1NFDA 5CCHE 4JL1A 3VXTB 2ZQKA 3I50L 3L3KA 1X5JA 3AFLA 2LU3A 2ZAIA 1CK0L 4HGKC 1UGKA 4NHCL 4PCSA 4NT6B 4Z6AT 4MD4B 1CXKA 2DQ6A 3NSYA 1WAEA 4HEMA 2ZYRA 3G6JB 4WI8A 3QJSB 5I18L 3SQBA 3DX6A 1I1AA 4KNUA 4N5UA 2EEAA 1HDMB 2NMSA 1AGBB 3CH1B 3TN0A 5IEKA 3IDNA 4XI5D 3HZMA 2MQGA 1KGUA 3FHQA 2HKHH 4YHLH 5CIPB 5IREA 2WBJA 1A4CA 3LS5L 3GI9H 3CN2A 3MNMA 3V6BR 4MDRA 4N25A 3C5JA 5DD5H 4CSTA 2D31A 4HWZB 1CF8H 3QXTA 5CZKA 3BRDA 1FUNA 4OH2A 5T1DH 1PG7X 3MRPB 4Z7WE 3WTVA 1UWYA 2B9BA 2LU5A 4ZUSB 3QIWC 4XRCB 5FX3A 1M3IA 1KTJA 1U42A 3G6DL 3KBHE 3LKOB 1INQB 3DGGB 4H2CA 1WISA 3KH3A 4IRJC 1A4BA 4LIQE 3IS1X 3ZSSA 3ZR6A 4P9HH 3WLWD 2FO8A 2HLFC 3HZVB 4W6YB 3IAQA 3ZL4L 1A6ZA 1G7HA 1Y1DA 3D05A 2WY3B 3BGMB 3EHBD 3TBTA 2ZKMX 3MLUH 4YIQA 4ZNEA 1MAJA 1VGEH 1ZGLA 3MUGB 3DSFH 12E8L 2WN3A 3IETB 3BUPA 2DMCA 4HPHA 3BT2L 3BSHA 3K81A 3SE9L 5LXVA 1XIWC 4LARH 4LHUG 2GI0A 3BEVB 3VRJB 1QQDA 1AY1H 1QVOB 4R2GB 1GMEA 5C08D 1QSEE 3MRNA 1UD2A 3P2DA 2CO1A 2PCFB 2YRPA 3I85A 1BQKA 4JM2C 1XGUB 2R69H 4P23C 1CGTA 5C70A 2DJMA 3BD4A 3ARTA 4YO0A 3IJSB 4MA1B 1X9LA 4LSPL 3BPLC 3DV6A 1RMFH 3ARPA 3CSPA 3ZTEA 4MLIA 5KVFH 5JDSB 5A2KH 1TQSA 1CG9A 3O8XD 5IJVA 1OTUC 4D9LH 1TCMA 1GC1H 4KNSA 5CMAA 4FFVD 4GUQA 3L3GA 2XFXB 1NOLA 1P7KA 3NRQA 5I30L 4XCCL 2AEPH 3D33A 3R06A 4S11A 3OMAB 1EX0A 5JR1L 3RDTA 4CADB 1XGQA 2A1WH 2FWOA 4X98A 1PD6A 4OKVA 2O30A 1GGBH 2UY7A 5D7IF 1PQZA 1J1PL 4YL9A 5K33A 3PNRB 5C07E 1HCZA 4NP4H 5TDNB 2NYKA 1QTSA 4HFUH 2JV6A 1BAWA 3EUUA 2HKFL 4ENED 1IRAY 2OMWB 2KL6A 2VC2L 1BBJA 3MRGB 5DK0B 5I1JH 1OHQA 2FJGB 4KRNA 3CMOH 3LXBA 5IK3B 2FX9H 1AG0A 1SYSB 2K9UA 4PY7B 3WEBA 2LAGB 5D6DA 3UPAA 1I8MB 5FPIA 4WHCA 5IB4B 1JPSH 3TEUA 3EJCA 4JHWL 2J72A 2A0LC 1I31A 3OLDA 4NN7B 4Y2DD 3BIBX 4YOKA 4LCVA 3GMQB 4XBEH 1PZAA 2XIBA 4NRXA 2GITB 4WFHE 4BFBD 3QS2A 5T1LA 5DZVA 5DJ8B 2VQ1A 4LP8A 1TMQA 4M7KL 4FEIA 1NGZA 4N2KA 5D6CA 2AMGA 2MPAL 3CPLB 3VG0L 4OIIL 3WO3B 3EGXA 1GHFL 2JF1A 1NCAH 1KNOA 4PJ7E 4AY0A 1D6VL 1MFAL 1T20B 2V6HA 2DLHA 1EXGA 3KVPA 3O4OC 5AW9B 1JTPA 5GS1B 4U6HA 5ACLA 4Z7VF 1L0YA 2FZ3A 3Q2CA 3NCWA 4WU7B 1VPOL 1A9BA 3NAAH 5IWLC 2PWDA 1VFAA 5E0QA 4MWFB 1BFOB 4MZIA 5TFSH 1IC5L 3RTQB 1Z9OA 2QLYA 5C09D 5HD8C 4ZX5A 2D7MA 5DVLA 1NM9A 1SFHA 4KKCD 2A9ML 1YQ2A 5INDB 1ND0B 5B4MD 4FABH 4A2MA 1IZKA 2C4FT 1DQLL 2YMXH 3GMLB 4JG0L 1GRWA 3P40A 4Y5VC 1A6PA 4ZXBC 4YLCA 2O1AA 3J2PA 1MJ7H 4NNYB 4MB5A 1QFWH 1R5IB 2QADD 3GD1C 4GS7B 2DV6A 4XCEB 5TH2B 1FE8L 2IFGA 2ZCZA 3TO2A 5C71A 2Y7MA 4LASL 1A4KA 4CRPA 4RMTA 3UZQB 2VR9A 3AS2A 1OTTD 3BP7A 1MFBL 4GP5B 4LOVA 2XKNB 1SEQL 5HDOA 3GJEB 5HHOA 4ZX6A 2O5YH 1T66C 2DTML 4M9OA 2VQ4A 3C6LA 1P7QB 2KBGA 5IB5A 1WFIA 3MO1A 3V5HA 2ADGB 5GGQL 1R3HA 3REWB 4PJCE 3QZWB 5HDLA 2F5BL 1NICA 4JY4A 3LVTA 2DYPA 4YHPA 5BO0D 4QXTA 2ITFA 1S7UB 1Q72L 1GGTA 4JPVL 5AOZA 4M8VA 3MLTB 4OCRH 4WI9A 2VLLB 8CGTA 1UHVA 3OC5A 4LLMB 1ZGLM 3NABL 5IVZB 4ELMF 4F37F 4APQB 5J6GB 4F2FA 1MRFH 3UG4A 5D7JD 4IGBB 4U7KA 4YNYA 3SB3A 3U4BL 1TJGH 4AQZA 5CUSL 4CW1B 3JV4A 1NANI 2QGCA 2QQQA 2X89A 3HMXL 3TJHD 1MFMA 2X05A 3CC1A 4F5CE 4EZKA 4L4TB 2UXVA 1U2YA 3C5SA 4LDOB 3ISRA 5HHQB 4WENB 4BSJA 1XFPA 2UYLA 4FG6C 4P57A 4ZPTA 2J6WA 3BPNB 3VI4E 1BW8A 2X6MA 3B7UX 3PAUA 4I77H 5B39B 3ALPA 1JMZA 5T3ZL 2CJSA 5IQ9A 2F19L 2LU4A 1WD8A 3ARFA 5GZND 1HIML 3QQ4A 1QNZL 1MEXL 2ITCA 2IWKA 4R96A 5LGHH 4ZFGH 4N86A 4OQTA 4UTCA 2G5RA 2ID5A 3AGWA 2EDQA 3APCA 2AK1L 1XZWA 4XHJC 5IOPB 2KYIA 2Z91B 1MCWM 4I7ZC 4KX8A 4YEEA 5DT1H 1FIGH 3H9SA 1CDHA 4MTMA 5GJTH 3QUYD 3TXAA 5I73B 5C7XL 1HCVA 1E43A 2B1HH 1KCBA 1ORQB 4TUKL 2NT1A 4JZJB 1CIUA 4GI6A 4UM8B 3L16A 3LPPA 3U1SL 1A4JB 3MBEB 4D94A 3FB5B 4U6YB 1ILUA 5BRZA 3DTUB 4TTDD 2QKIB 2WZPD 3LDBC 4HS6B 1MLBA 25C8H 1HXMA 1U8LA 5KBPA 4HETA 4HPYL 1XDTT 4ODWB 4R0LB 1MQKL 5JQIB 1J9SA 1RH8A 4KKLC 4YGVA 4LLQB 4ODBD 2X2IA 3OB0H 1SJHB 5E9DB 5I6KA 5CZXC 3FXIC 2E7MA 1IGJB 1QRNE 4J3OF 4UINL 3COOA 4EN3C 1MRCH 1CGYA 1W91A 3ILPB 3QDGE 5EOQH 2NXYD 3B9KD 3D25B 1Q9LB 5FYKH 4ECNA 4CSZA 4HCRA 3VFOA 4ADIA 3IDIB 4GJTB 5IF0A 3AQDA 3KPSD 4HXBL 5ERWA 1G6VK 4KKAD 5I5RA 3VX1A 3E1ZA 3WUZA 4JKKA 3HE6A 3PHQA 4L05A 3KPLA 3V0WL 1I7TA 3DRQA 4HAFA 2L7EA 2NRDA 4BK4A 1T4WA 1RJCA 3NJJA 3LV3A 1DE4A 1IGMH 5KUKA 4YGAB 5LG6A 5B8CB 1MHCA 5FUZH 5IZ7A 3LZNA 3PP3H 3MKGA 4NSKB 4ZO8A 4KV5E 1GCFA 3R7QA 1IEHA 2WLHA 1JPGA 3KBEA 4JKMA 2FYYB 1VLXA 4MJHA 4WNSA 4ZAKB 5LCVL 5KYXB 3AU1B 3L4ZA 4HC1H 3EYUL 4ZD3L 1LEKB 2I9LA 4UQCA 4Y4KB 4URTB 5EOTA 1J88A 1MHPH 4N2FA 3X13B 4O58H 5DJZB 3P1VA 2ICEB 4F1SA 1FGVL 4IS6A 2XJKA 4AIZA 3VD3A 3QJZA 5T8IA 3QQ3A 3TV3L 5GXBB 3FTYA 4WTWA 4HZ1A 2WQAA 4TSAL 3TTYA 1ZK5A 1G4RA 3NSCA 4OZHF 4X5RA 4JPWL 2DWDB 1GZHC 3P9MB 2I26N 4GY4A 4X5LA 2IALB 5AYUL 2R4RH 3FT4A 3UYPB 4N8VB 4YDLB 4PRPA 3MV8D 4UB0H 3F12A 4BYHA 3QYMA 1T7WA 2BFVH 3IDYC 4J4PC 1PYWA 2EIEA 1UM6H 3CJJA 4JQXC 3I2CL 3S88H 4Z7WB 2AXJA 4H8QA 3ALXA 3BVXA 4NUMA 4Y16A 1YMMA 4GRLA 3Q9QA 4FQHB 1MWOA 1N67A 3GHEL 4OJCA 2OMUA 3CX5K 3NG5A 4D0CA 1FZMA 3ASOB 2FAUA 3VGHA 3GSUA 3N43B 3WNMA 2F5AH 4OCSH 4ZX3A 4S0TD 1W72A 4NC2B 1LL1A 4M8QB 1MHHB 1D6EA 5IVOA 1RI8A 3O6LL 5D96B 1SOXA 4DP8X 3VFVB 5IMLB 1LQBC 2PP7A 3ARBB 3WIIL 5ACZA 5CGMA 1XBDA 3JTSB 4MA3B 1E50A 3MLRH 4UAHA 3ZZ1A 2H3NB 4X7SH 4L8BA 2EDWA 3V4VB 4APXB 1QSEB 3SO3B 2LTQB 2CR6A 5I0ZA 1I85A 5DJAB 2DQFA 2MKWA 4JFOB 4JG5A 4PUBH 3M8OH 5C2BH 1TCRB 4K7PY 4Y4KD 2H3KA 2JVUA 4TQEL 2NY1B 4DGVH 3KPRE 4YX2H 1QSVA 3H0TB 5D9SA 1E3XA 1X5MA 3V5KB 3LS4H 4F2ME 4CMMB 4JZNA 5I8EA 3MROA 5I1DA 5IJCC 3O6KH 5E8DH 1FH2A 2E7HA 3BWAB 2XUWA 3FUDA 5E6RB 3TT1H 5IESL 4JO4L 5A3IC 1NCJA 1P4BL 4I0KA 4EI5B 3BPOC 1IC0A 3SPJA 5L88L 5AYTA 4BXSV 2OCFD 3DYPA 3MXWL 3G7TA 4ODHL 5BQDA 4U1NA 5C07B 5AD0A 3BVTA 4CNIA 2ZUTA 1IBDA 5HVFB 1IJNA 3UYRH 1FCGA 1MCWW 4DVRL 1J1XH 5I0WA 1V3MA 1T3FB 1KIPB 1A14H 3HJEA 2W92A 3SDXE 3L95A 1LE9A 4WO4C 3U0PB 1TVBA 5ILTH 5HYJE 2NUTB 2F7PA 2YOCA 2ESVA 5FW8A 2KQNA 2P9RA 4N2OA 1NDMB 3ABZA 1JZIA 1OKEA 3FO0L 3FRUB 4WCYH 3VYPA 2VOTA 3HCVA 3L4TA 3RWHA 3VD1A 1D7CA 3GO1L 3SE8L 3MSPA 3SZ6A 2Q3AA 4I2XE 4J3UA 5IHUL 2DQTL 2AGJL 4GAJL 4BWWA 5E2UL 4PJ7B 4J8RB 3MRMA 3VD2A 2R0ZH 1YEJL 4HWBH 4G8FA 2VL4A 1WT5C 3VTMA 5DZAA 4CVXB 1P4IL 3O4LA 3U7WL 5ENWA 2WNWA 1ADQH 3TYGL 3V0AC 2PUQT 4L1BA 4R7DB 5TQ0H 3N9GH 2ZOOA 4X0KB 3T6WA 3NEOA 3HPJB 2HVKB 1QBLH 3APNA 4YXHL 4A37A 4XBGB 4EAEA 5IB1B 3ALWA 3GI8L 2OSLA 4NKOB 1UXSB 4NKQB 4J3OH 1L7TH 3TV8A 4EZMA 3MXVH 3CZEA 3MTRA 3N1PC 1WIPA 3VH8B 3ZSTA 4J7RA 4UT6L 1OGAD 4HUVB 2XWJA 3ES6B 2LLGA 3F01A 1TNMA 3ZZSA 2NY2B 4A7QA 1KG0A 1TTUA 5BZWA 5AZUA 1VCAA 3KVQA 3DHUA 1JOIA 2GY7B 5I17A 1XD1A 5GIRB 2DQMA 3QUKA 1A2YB 4NERA 1JK9B 4QXWA 3GNMH 5G5DA 1J0HA 4TKWA 3LZFH 1TIUA 1CFQA 2YZ8A 5AAMA 2CIIB 1CURA 5CD5C 1UWFA 1TQUA 3UP1A 3NEEA 1HXYB 1T7XA 1U92B 4H8WL 1SMOA 3M1BB 3UACA 2VDOB 4PJCB 5FFOA 5F89A 3MJGX 4YBHA 2V5SA 2KLTA 4K3HA 4AUJA 5F7NC 3T0EC 2WUBH 3NEXA 1G7LA 4ESKA 3L9YA 5G4OA 1NFDF 2E74C 2VLRE 1HILA 4LGSB 1WGOA 5DO2D 3C60A 1ZV9A 3QRGL 2Y4SA 3U36A 3VTTA 4AVJA 4F93B 3WN5A 3LN5A 3N41B 2YEVB 4JFSA 1ZLUK 4HUXA 4DPAX 3DJRA 5DD1L 5HJ3A 1TMCB 3QULA 3ZE1E 4JFDA 2X4NB 2GJJA 2ZX8A 4Q58C 1P4