7PCYA

The crystal structure of plastocyanin from a green alga, enteromorpha prolifera
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
AAIVKLGGDDGSLAFVPNNITVGAGESIEFINNAGFPHNIVFDEDAVPAGVDADAISAEDYLNSKGQTVVRKLTTPGTYGVYCDPHSGAGMKMTITVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title Crystal structure of plastocyanin from a green alga, Enteromorpha prolifera.
pubmed doi rcsb
source organism Ulva prolifera
molecule tags Electron transport protein
total genus 24
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1989-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 7pcyA00
1ZIAA 4UF7C 3UAEA 4G71B 1RZQA 1W8EA 4YSRA 1L9TA 2VW6A 1AS6A 2BHFA 1IBYA 1GS8A 2DV6A 1AANA 2EIJB 4Q8BA 2MTAA 1ASQA 1MZYA 4DP8X 1PZAA 1BYPA 5F7AA 5B1BB 2VM3A 1SFDA 5E9NA 3NT0A 1T5KA 2YAQA 1V54B 1FFTB 3H4FA 3PAUA 3FQ2A 1SNRA 2FJSA 2WO3B 2WO2B 5I5JA 2AZUA 2IWFA 4W9ZA 4G72B 1ET7A 3PCYA 3EF4A 5I6OA 4A66A 4X4KA 2AVFA 4P5SA 1GYCA 3QPKA 4KO6A 6PCYA 5PCYA 5B3SB 2FNWA 5FC9A 3QJQB 1M9WA 2DWSA 2HX7A 1AS7A 2PLTA 4YSAA 4A2FA 4GYBA 2NRDA 1L9RA 2DY2A 1L9PA 3IEAA 1BXUA 3BQVA 4N8UA 2WSDA 1AZCA 3ZX1A 2IDUA 2W88A 4AX3A 2JKWA 1AS8A 1A4CA 1BQKA 9PCYA 2UX7A 2GC7C 2IDSA 1F56A 1L9OA 2Y1AA 4WTQA 1J9RA 2PPEA 4AKPA 2FQFA 1N70A 3NJNA 1A4BA 3OQRA 4YSTA 2QPDB 2JXMA 4ZK8A 4DP1X 1NDTA 4DP0X 1HFUA 1MDAA 4N4YB 4A2HA 5I5MA 1BXVA 3CZUB 2PP9A 4UAHA 1KDIA 1SHXA 1E67A 1HAUA 2VM4A 2B3IA 1CYXA 7PCYA 1ZIBA 2XU9A 2HXAA 1PCSA 3DIVA 3BVDB 3NSDA 2PPCA 3ASOB 2FQDA 5B1JC 2I7OA 1ZDSA 1CUOA 2QT6A 2R7EB 3TBCA 3H4HA 5B7FA 1GS6X 3FPYA 1AZBA 5D4JA 2XXGA 5AZUA 4DPAX 1PAZA 2VMJA 3X1GA 1PNDA 4YVUA 1J9TA 1L9QA 2H47C 3IE9A 3AG2B 2J57A 1XB6A 4GP8B 2UXFA 4A68A 2GHZA 3FSWA 3PAZA 4PCYA 2IH9A 1L9SA 3DKHA 2X87A 1KYAA 2EIMB 2FT8A 2XWZA 1QLEB 1PZBA 4GP4B 1OCCB 1IKOP 3IBOA 1AIZA 1TKWA 2EIKB 3ASNB 1GY2A 4KOBA 4AKQA 1OE1A 1PLCA 1XB8A 3UGEA 4G7QB 4HALA 3FPXA 4BWTA 3T71A 4DP4X 1V10A 5I6KA 3T9WA 1IBZA 3HEIB 1ZPUA 1R1CA 3JT2A 3PXLA 2DYRB 4YL4A 2CALA 3AZUA 4F7KA 4YSQA 2IDTA 4HAKA 3UABA 1DZ0A 3FYIB 2IAAC 4WKXA 4DP5X 3FSAA 8PAZA 2UXTA 1AOZA 4KO9A 1WA0X 4CSZA 1NWPA 1ASOA 2MRYA 4KNUA 5I6PA 1WA2X 2YAEA 2J5WA 1OCZB 1ILSA 1W6WA 2CAKA 5TK2A 3CDZA 4YVNA 3WNIA 1QNIA 4KO7A 3FQ1A 1E5YA 3NJMA 1J9SA 1AG0A 4UANA 3H56A 1TEFA 5AFAA 3WNJA 1ETJA 4E9SA 1ASPA 5B1AB 4DP9X 2BO0A 1SDDA 3WG7B 4DP7X 2BWIA 2OCCB 2YAFA 4Q89A 3CG8A 3FU8A 2DWTA 4ENZA 1X9UA 3G5WA 1ET8A 3V9CA 3ERXA 2J56A 4DP6X 1ZV2A 4QKTA 2FWLB 1E5ZA 1WS7A 2BZ7A 2R7EA 1AR1B 2ZOOA 5I5IA 1JOIA 1NWOA 5B1KA 5IY5B 2QDVA 2HX9A 3AG1B 1SF5A 1NTDA 5I6LA 2B08A 3OMAB 1RKRA 3D12B 3FU9A 1W6LA 1JXFA 3MBWB 2BZCA 1M56B 2QDWA 3AW5A 4E9XA 1E30A 2HRGA 2Y69B 2H3XC 6PAZA 1KCBA 3FYEB 1NIFA 5EHFA 1JXDA 3CDZB 1NPNA 2BWDA 4F2EA 1KBWA 2GB2A 3NSFA 2VN3A 3GDCA 1WA1X 4DPBX 2H5UA 2YAOA 4YSCA 3S8GB 3EHBB 1AQ8A 1NIBA 2HZHA 1J5DA 3NJFA 1KDJA 2HRHA 3PPSA 1PZCA 2IWKA 2AZAA 2IDQA 1SDDB 2GIMA 4E9QA 3AG3B 3SBPA 4BXVA 2OJ1A 1CURA 4HHWA 1YLBB 1NICA 4GXFA 5B1JA 2Q5BA 3RYMA 2J55A 5A7EA 2AANA 4HCIA 1M57B 2GBAA 2I7SA 2CBPA 1A65A 1BYOA 3FSZA 1NIEA 3IN2A 1DYZA 3NSCA 2JFCA 3EH3B 1KBVA 2YAPA 1JVOA 4BK5C 2A3TA 1A8ZA 3QJRB 3JTBA 3FS9A 3S3CB 3L45A 3WKQA 2UX6A 4YSOA 1NIAA 1NPJA 4KNTA 4QLWA 4JKNA 5LDUA 1VLXA 1PLAA 3FSVA 4DPCX 5D4HA 5TK4A 2YAMA 2E86A 4HCFA 3QJSB 3U25A 4A67A 3OM3B 4GP5B 1XMEB 1AG6A 5B7EA 1WAEA 3X1EA 2IDFA 1BQRA 3TBBA 2QPEB 4BWUA 2FT6A 2IWEA 4G7RB 1JZGA 1FA4A 2N0MA 1NZRA 3ZBMA 1OCOB 3AG4B 2XV2A 2CCWA 1MG3C 1OOWA 1AZNA 1PLBA 3WKPA 1KV7A 2PP8A 1TU2A 3OMIB 3EH5B 4HIPA 1SJMA 1X9RA 2P80D 1RCYA 3EH4B 3NJKA 4FA7B 2XYBA 4E9RA 3ABKB 2GI0A 3WIAA 1SHWA 4YSSA 4HCGA 3UACA 1E65A 4CSPA 1JVLA 3FT0A 1ILUA 1OCRB 2FTAA 4AKOA 2Q9OA 2AFNA 4M3HA 4PAZA 4A2GA 2VSMB 2XLLA 3GYRA 2CJ3A 4BXSV 2DYSB 4G7SB 2PP7A 2X88A 3V9EA 5F7BA 1CC3A 5ANHA 4L0PB 1AAJA 3NJIA 2XX0A 4KO5A 1BAWA 1A4AA 1EZLA 1ID2A 3NJGA 3T6ZA 4HZ1A 3SBRA 1ADWA 3SQRA 3UADA 3QJUB 4YSDA 3X1BA 3NSYA 3NJJA 3S3DB 1PY0A 1SFHA 3SBQA 4KNSA 5D4IA 5I28A 1JERA 1IUZA 2EINB 1GW0A 3S8FB 2XX1A 3GXUB 3QJTB 2BP0A 2GC4C 1AZUA 4YSPA 4FAAB 1BEXA 4YSUA 2HX8A 5I26A 2YAHA 3S3BB 7PAZA 1JZIA 2VW4A 1V55B 3ABLB 3AY2A 3DTUB 3KW7A 2PCYA 3FU7B 2IH8A 3C75A 4E9TA 3NJHA 2VSKB 3NYKA 3T6WA 3PAVA 1AZRA 1FWXA 2GSMB 1EHKB 1GS7A 1PNCA 2PCFA 1OF0A 1URIA 1BXAA 2RACA 3QJVB 4JHVA 3ZIYA 1J5CA 2EILB 4A2EA 2OV0A 3OMNB 4F2FA 5I6NA 4BWWA 2YQBA 1TEGA 1JZFA 1CYWA 2UXGA 4A2DA 1J9QA 2FT7A 2BP8A 4RH4A 1OE2A 2VW7A 4TXVB 1KGYE 4NB7A 4BDVA 4E9WA 1GSKA 1HAWA 1RZPA 4YSEA 3KW8A 3T6XA 4NAJA 2XUWA 2BW5A 2FQGA 2XV3A 3N2JA 1OE3A 1JXGA 1GY1A 4KOCA 1GR7A 3T6VA 2I85A 3OD3A 2YXVA 5AKRA 3NJLA 4M4RB 1JZHA 2BP0B 2CUAA 4MFHA 3CVCA 4DP2X 3X1NA 1OV8A 2P80A 1SF3A 1QHQA 4E9YA 4JHUA 3N55A 1A3ZA 3HB3B 3TU6A 3ABMB 1WS8A 2BW4A 1ET5A 4GY4A 2XVBA 4E9VA 1UATA 1MG2C 2PPFA 3IN0A 1NINA 4EF3A 2ZXWB 2TSAA 2BP8B 5B7MA 4HHGA 1JZEA 1MZZA 3TASA 1PF3A 2LLNA 2YARA 3NP4A 3ABGA 2TSBA 1N68A 3CVBA 3ZDWA 3NP3A 2ZWNA 4AZUA 4BDVB 3CVDA 4P5RA 2ZONA 3TA4D 2UXVA 3UAAA 1BQ5A 2YXWA 2PPDA 3WI9A 3FQYA 3FU7A 3QQXA 5I6MA 5PAZA 1KCWA 1AACA 4G70B 2XXFA 1PMYA 2FQEA 1XB3A 3PLYA 1ZDQA 4AI7A 4K9JA 1JZJA 2W8CA 4W1TA 2HLEB 1IC0A 2XV0A 3X1FA 2PPAA 3X2QB 1B3IA 3MX0B 1NIDA 4NERA 1I53A
chains in the Genus database with same CATH superfamily
4RAVA 1RD6A 5E94B 2H3NA 2OMYB 5DR5L 3NFSL 3U2SA 2VW6A 5E2VH 5IFJB 1YEKL 3QIBC 2QVKA 3QUHA 2DQMA 5I18L 2VIRA 2HPOA 5JQIB 4N3UA 3U4KA 3P2BA 2K8QA 3DSNA 3KBEA 1S9VA 4JEGB 2ZIDA 3VXUD 1H5BC 5EBWB 8CGTA 2VM3A 5IHLB 4BZ2A 3F7PC 1YEIH 1SFDA 1ZY9A 3C5ZD 4LPWA 1I82A 3W39B 2WBJC 2D03H 1FFTB 1EEYB 3EUDA 2Q7AA 1CI3M 3ARUA 3CFNA 5EA0L 5GPRA 5JLZB 4Q14A 3MLVL 3RY4A 1D9KD 4KK5D 3MJGX 3Q9PA 3BAXA 2KDYA 3ZE1E 5KYYB 3EJJX 4PYHA 4P3DB 5E1QA 3QQ3A 1AR1D 3QWOA 1KGCE 2C4FU 1S2EA 4AYGA 3IAPA 4N0UE 4HZLB 4NKOB 2PR9A 3SCMA 3GS4A 1X5YA 5D2NA 5J06A 3LQAC 5KVEL 3DYOA 4PJBE 1MQ8A 5FYLE 4QHNB 4FTDA 1IJNA 2XNAB 1JGDA 3CFQA 1BVNP 3FN3A 4IRJA 4Z6AT 4KKAD 3MV8A 1HCFX 1YEFH 1JV5A 1YMMA 3HG1E 1AIFB 3BLPX 3BOVA 5EOQL 2XBDA 1YDPA 1UJTA 3MMEB 5IB4A 1HNGA 2JTDA 2WSDA 2AAAA 4U05A 2YMTA 1F02I 4ORZC 4PY7A 2Y6SD 2CNZA 1AQKH 3L5XH 2Y1VA 5F1IA 3SDXB 4R97C 5BZWB 1XL6A 2P7TB 3KCWA 3JYBA 3ZL4L 3WEXA 1IRAY 3EFDL 2DQGL 4K0OA 4RFNB 4ZNCD 5C3TA 4JN2B 4HUVB 2VDPL 4N86A 3WLBA 2ALWA 3K3QA 15C8L 3AJ7A 3OBAA 1HNYA 1MCNA 1T66C 4MSWB 5CINH 3HE7C 4O5LL 4AIZB 2E27L 1JN6B 4P57B 3PHAA 4Y89A 4FFYL 3R1GH 1E67A 1MJUH 1S7UA 1U2YA 1QR4A 3MPCA 4HJIA 4W4OA 1M4KA 2VZVA 4WJKB 7PCYA 3NQIA 4N85A 3RGVA 4UOW0 4AV4A 5IMLB 3MUGB 2HXAA 1FHGA 1O6SA 2CZNA 1GGUA 3SB3A 2VO8A 4ANVA 2IFFL 2R7EB 1N2RA 2A73A 1EZVX 4HULB 4TTDD 2ENPA 1G6RL 2JTYA 3D18B 1LE5B 2A77L 3EFOB 2WWOA 5C0GA 2A5UA 1SDAB 3P73A 1CS6A 4F8NA 4X7TA 4XX5A 1SEBB 3SKJL 2AABH 2IQ9L 4Y16C 4PJ5B 3KPTA 2ZAIA 4GP8B 4K3JL 3MREA 2GHZA 1FDLL 3MRDB 3EIFA 5D7KD 5E5MA 4G7VL 2EIMB 3CVHB 4N0RA 2A6DB 2YS4A 4PYGA 5IJKA 1F8TL 2MOQA 5I8EB 4KK9C 3R7QA 4S11A 1U8MB 3TCLB 4JY5L 3SE8H 4QT5B 4OLYH 2D7QA 5EFIB 1KCLA 3CSBA 4NJ9L 3PNWA 1V10A 3V4PB 3EBIA 3HEIB 3WHXB 1YC8A 4TL4A 5F6IC 2PW2B 2V5TA 4MZIA 4S10A 1FFPB 5FLUA 1JTPA 1CT8B 3P30L 3HPJB 5ESQA 1DZ0A 4H8WH 1BZ7B 2GUOA 3T65A 2AS5M 3ESNA 4OFVA 3GKWH 2X1WL 3L3GB 4JFEB 3AGWA 2J5WA 4HKJA 3OJDB 1OALA 5KSVB 3QUZB 4W9EC 1WPCA 4FQQA 4MHHG 4GW1B 4NT6B 3LZFL 2P5EB 2CR0A 2YR3A 3CTTA 1AG0A 3AAZB 3BFOA 2I5YH 5KZCB 5AFAA 3ARGA 3CHRA 2OI9C 2YQ3A 3BKYL 4DTGL 4JZJB 3TZVA 1E9OB 5F3BA 5GQBA 4KUCF 4S1SH 3TEWA 3L1EA 4PRBA 1U2HA 3QJXA 4U1MA 1Q94A 4M1CC 4ZW3A 1DQJA 3NIFF 3R19A 4ENZA 5L2KD 4EI6A 4FI7A 3M8OL 3P4MB 5F1KC 3NA9L 1ZTMA 3WS3B 1C16B 3WJLC 4AG4H 4NNYA 3BVNB 5DVLA 2J56A 2JK5A 3WS6C 3VG9B 2VDMH 3BVXA 1BFVH 2YMOA 4X2UA 4X98A 4FE9A 4MRCA 1T5WB 3BESR 5FKAA 5MENB 1X7QB 2CWRA 2HX9A 2Z0BA 1CZ8L 3QDJE 3N42B 1CBJA 2ADFL 3CFUA 3D2UB 3L3OA 4JQVC 1HSAB 3MV11 2GJ6D 4R0LA 3VWJA 3H9ZA 3OMAB 1HE8A 3FU9A 4XNUL 1MFDL 2DYPA 5IK3B 5T5FA 1UH4A 1QI4A 1OAXL 4NI3A 5AG9A 1P69B 2VABA 3I9GH 3ZKXB 5FOBB 4I5BB 4Z7QF 3L4VA 5ACZB 1HINH 4L4VA 2F74B 3IWVA 1NCJA 3VFNB 2BWDA 4FYQA 2YGVA 1LNUA 4FNSA 4YWGH 3GDCA 1I1RA 1BZ9B 1N9PA 2H5UA 2YAOA 2W81C 4YSCA 3EHBB 2GK2A 2BJML 4RBPH 4JFSA 1PKQB 1FYTA 3PIQB 4DZBA 3A67H 3K4AA 1SDDB 2IDQA 3EGSA 2LE9A 2BSTA 2CMRH 4KMTH 2BHYA 4UWQB 4KRNA 1G5GA 4P2QA 3C8KA 3S4SA 2P1YA 3QFDA 4DWHA 4GKZA 5KTEL 2CJTA 3WNKA 2GTZA 2FYYB 3P77B 1Z0NA 4RVBA 1I7RB 3F5WA 3JBG7 3CFTA 3D30A 3L9RA 1JVOA 2C3GA 5D7JA 1MUJB 4Y2OA 5GGSB 3RWCA 1T2XA 4TVPH 5C0IB 2NY2C 2AQRA 1OP5H 3QUML 2WWNA 3AITA 1P6WA 3B9EA 1VCBC 3TO4D 3OX8B 1UUNA 1VF5C 4ZAKA 1Y0LA 3EYUL 3WD5L 4KXDA 3DBXA 4PWIA 3U7WL 2Q76B 4LNVA 3GMPB 3DHUA 2VWEE 2ZQKA 3D05A 5IMOA 5JW3L 2VSCA 1PQZA 5CSBA 1BOGB 5IIEB 3TPUA 4U6YA 1FE8H 4NHUA 5AOJA 3F58H 1XCQB 5D96B 1I3GL 1ZCRA 4G5ZL 1S4IA 2WZAA 1QLEH 1FNAA 4OLWL 4FFWD 2K6WA 4M6OL 3H6AA 3BUPA 3QFJB 1CK0L 1HC1A 4W9FC 4YHML 3MHZA 3GSQA 5IJCC 3Q8BA 5FYKE 4FABH 3QHTC 3GXMA 1SXSA 2P80D 3BVUA 3AREC 1OGTA 1RIHL 5FOJA 3NJKA 3MUZ1 2HT2D 1IAIH 5HY9A 3WIAA 4NO5B 2K7PA 1L3WA 1AO7A 3FT9A 1X5AA 3INUH 2WQRA 5EG6C 4IRSA 4PREB 4LOFA 1JVLA 2W59A 4K23L 1DN0A 1M71A 2BVUA 2NXZD 1FC2D 2OMZA 5AW4B 1LMIA 5HI3C 4JRXE 3P4OA 4M48L 4ZPVB 4EXPX 5BS0B 1T89C 3DV6A 4JHAL 4KXBA 2FLBT 5D7SH 1QWUA 4XP6H 5TQ2L 1AJ7H 1MREL 4H5SB 3X3GL 4M8RA 5ITBL 5I6XB 1FFQA 4JPVL 3UTSA 3RGBA 2D0GA 2FYVA 3QFGA 2W60A 4Z8FH 1W80A 4YSDA 3RZCC 1RZFL 3N41F 5F8QC 3SPVA 5I1GL 3KBFA 2QL1A 3ECBA 3ZTJH 4KY2A 2CA4A 2NY5C 2WW8A 4FEIA 5E56A 4ZS6D 2EC9T 2XXCB 5D1XA 5L4MA 1QWHA 4U6XB 1HXKA 1QBBA 5F0JB 5E08H 1KXVA 1PJWA 5DHEA 5KS9A 5DJ8B 3W9EA 1QBLH 1B0IA 3BUBA 1DUYA 4M9PA 3NEOA 1ZVSA 2OCJA 3WY2A 5EU6B 3VXMB 2RACA 3QJVB 1IC5H 3E80A 3BQUC 4I2XA 3RFZB 4TOYH 4NSKA 4R8WL 3OB0K 1D6VH 3DX8A 4FNLL 2YD2A 3SDDA 2JCCA 3W9DB 1URLA 4IGBA 2ZUTA 1UXLA 5SWZB 4YXKH 4LXFA 1MEXH 2BPBA 2VMCA 3DIFB 1G9NH 1BG9A 3CDFA 1OT4A 1D7CA 5IT2H 1D5BA 3D39A 3FUNA 4XC1H 1OP3H 4AQ8C 1G5AA 1ESOA 1H15A 2ESVD 4JE4B 4M5TA 3RNKB 3DVFA 4NFCA 5HJGA 3TO2B 4QKXB 2BVPA 3DWTA 1IC7L 3T3PB 5KSAB 2FO1A 3NZUA 4ILDA 2XUWA 3IGAB 3TN0B 2CLZB 1X5JA 4HXBL 5BW7A 4KOCA 3EXLA 2FX8L 3RX7A 2J1ZA 3VI3E 1KN2L 4GBXB 4A6YL 5J13B 2R56H 4Y8AA 1QHOA 3ARYA 4L3CA 3ARBB 4YHNB 4XBGA 4KJPC 4ZDHB 1IM9A 2L8AA 5A16B 1KB5H 2G2RA 1ECZA 3N1PC 3LKRB 4IU3B 1VFBB 3E8UL 5T3XL 1QHQA 3RUGE 4JHUA 1WC7A 4HPYL 2B5IC 3DI2B 1QZNA 1KTDA 3CN1A 3KPSD 3L17A 1UGKA 5DFVC 4NFBA 1AD9B 1GCFA 3V0DA 1IKNA 4I18A 3LXUX 4JRYE 3FMGL 2EDJA 2ZOLB 3N9GH 3NIDF 3FB7B 4HEPA 3VXPB 4FQLH 1JHKH 2AEQL 3GSNB 4Y1AE 1MZZA 4NHCL 3DK2A 1VJSA 2H0JA 2J6EL 2YARA 4H1LA 3VCLB 1BJ8A 5I66A 1A7RL 1KYOK 4G9DA 4YJZL 3NFPB 5ANMB 3WMSA 4BK8A 4OLZH 1SYVA 2EO7A 3PHQB 2UXVA 2RALA 3QIWC 3CIQA 1KJ2H 1JGVH 2DQIH 4HUWB 4B9FA 5GZOD 3VX0A 2YD6A 3BEVB 1PX4A 4GIPD 4GW4A 3V6FA 2WXGA 3ZSSA 5LJYH 3CXHK 2H7WA 4PY8J 5CS7A 3B5TA 3I9PA 2BM3A 2ZUSA 2DKMA 2PTTB 3AB0B 4GIAA 1R3IL 3BH9B 4O9HH 3SJVB 1Y18A 5BZDB 4L1BA 1CB4A 4FYSA 1JZ3A 5EO1A 4K07A 5F96H 1KXTB 4IKJA 3UAEA 2VZ3A 3KR3L 3BKJL 1IEAB 4NC0B 2EYRA 4PY8I 3L3KA 3UJJL 4X50A 3NK3A 2J43A 2RHEA 3PWUA 4DW2L 4AK2A 5DMIL 4WHYH 1GXEA 2FJUB 4GQQA 3AS2A 3OJMB 3QPQC 3FHQA 2H2SC 3D08A 2ERJC 3P54A 4OZIE 3WAKA 3RTQD 5FCUL 1NGXB 4X6CF 2HJFB 3BFQG 4P9HH 4XNYH 3QNFA 3FU3A 5CEZH 1BMWA 3IMSA 1FZJB 4NGHH 1RJLB 3H4FA 3PAUA 3MGAA 3QWNA 5FXCH 3ZZLA 1E9PB 4U0RC 3CSGA 5AQ0A 1X9LA 3ZVVA 4UIKH 2MTPA 3INOA 4G72B 3UO1L 1MAJA 2QQNH 5E9DD 2BNUB 4KRPD 4L4TE 5BV7H 3G04B 3U6XS 3OKLA 1U8PB 3QH3B 4IIQA 2CHDA 1NGQH 3BJ91 3MA7A 2FNWA 3AU1B 3D85D 4ZMZA 5IZ7A 3M07A 3S8WA 5E8DL 2VQ1A 4Y2LA 1YAIA 2F5BL 4LRNL 1LK3H 3I6GA 1G0XA 1JV2A 1U92B 3UZQB 2FEEI 2ZNXA 4N5ED 1NMCB 4JAMA 5FS5A 3IEAA 4ZUVA 1I1AA 2A9NL 2HWZH 5J1AB 4EOWL 4WEMB 2AXHA 1RIUL 1PZUB 4RSYA 5DURB 3WBDA 4F7CA 4E68A 3J07A 4QCIB 2VDQH 3CK0L 2Q8AL 4DQAA 1H9DA 5E4IA 3WENA 4XN1A 4B53A 2Q86A 3SYOA 1KCSH 1QLFB 2R27A 3WFHB 3ZE0B 1G1KA 3OMZA 4D7BA 2I9TB 1IC4L 1DO5A 3ARDC 1E50A 3QYNA 3QCTH 2MCMA 5EC2B 4AITA 1ID5I 1WYJA 3FTGB 2NY3C 2V0AA 2MIZA 4OT1H 2EH8L 2PYEB 3O8XD 1WV7T 2CG9X 2QELA 4F3FA 2WTOA 1I1CA 5E6ID 3KZ8A 4CSTA 2W9LA 4P0DA 2IALB 4XP5H 4GI6A 4NQEA 2OR7A 4WU7B 3NSDA 1BAGA 2YPVA 3ASOB 3G6JE 3Q6GL 5B1JC 3OHMB 2O4EA 3SN6N 3BDBA 4PS7A 2HP4A 4L3EA 3H54A 5TPWL 1P53A 4ZMWA 3SYQA 3RWFA 2G0KA 5B8CC 2VXVL 2D9CA 1PSKH 1CBVH 3PQYB 3VGFA 4WHCA 2Y06H 1FZOB 4JR9L 1JK8B 1AVAA 5ICYB 5A6MA 2K8MA 5E7BA 1EEUA 4PJEF 5HVHC 2W9DH 4DPRA 2X4TA 1KN4L 3EJTA 3PWPD 2R1YA 1XXDC 1J88A 4N3TA 4K9EC 2H1PL 1OHZA 4G3YL 1AFVH 2WKOF 1PG7X 5FX3A 1P4IH 1XD0A 4R4FL 3MTRA 4HS3B 1ZHNA 1XIWA 4JO5A 5DTFA 3WFZA 4NIYE 3GMRB 3L4YA 4LP8A 4AGNA 1ZPUA 1YY9D 2DQDH 5LCVH 1HWHB 5GJSL 1S7QB 2DYRB 4FKEA 1B9ZA 1AGFB 4YBHA 4XCEB 3FUJA 2HVJB 1Z1WA 4EI5A 1Z9LA 3GSXA 2OTWA 3QDGB 2UY7A 4GMSH 2IH3B 3EYOB 3LIZH 4FYTA 1PKOA 4NQVA 4OLVH 4OW6A 4RRPA 3V10A 3V52H 3MBED 4PJCA 2X3CA 4PP2B 3LS4H 3SDAB 1ILSA 1E7UA 2BRRL 2Z1KA 2L0DA 1A9EB 4HPHA 1A7OL 1P4BH 2FHFA 5ICZB 3KLAA 4EI0A 4GSRA 2FECI 3OGOE 3T0EC 1IE4A 1WFMA 2I07B 3IXAB 4X5WB 2FEDC 5FGSA 4HJUA 4OFYA 1UB6A 1PVHA 3NGBB 1S9XA 1SXCA 5IFHH 2IDCA 2VKWA 2ZP0T 4QTHB 1CDYA 1XR8B 1JGEB 4K71C 5AYUL 3SZKC 2ENSA 1SXBA 4QO1A 4HK3N 3VXRA 4L1SA 3ESOA 4BGLA 1RUAL 3CN2A 3FQWB 1CFTB 4JO1H 4XXDB 1S5HA 2LQRA 3RI5K 2MPAL 3EBGA 4O51B 4HETA 1T2QH 3ARFA 1FNEB 2BH0A 3IPBA 3OHXC 4QKTA 4R4BB 2AHIA 2R4RH 4BZ1A 2HMID 3EOBA 2ZOOA 5I5IA 2X89D 2C9AA 3TCTA 2NY4B 1PY4A 2C1PB 5GRVK 4Y5VA 1QFHA 3LV3B 5ABZA 5I30L 4ZTOH 3KPPB 4KDWA 2OZ4L 5HHOE 5DMJB 3NZ8B 3ZSTA 3GWJA 3P3SA 4NZFA 5TDOB 1EXUA 2R69L 1JPTH 1KCBA 1XFPA 2NY1D 2VMFA 2WXLA 2YUWA 4XPFH 4AYFB 4N9OB 3MLRL 3DO7A 3LAFA 2KBGA 1ZT1A 3IJ7A 1A3LL 2VR8A 5GGUB 4MAZA 3DMMC 5EUKA 1IGFH 3AQYA 1WCBA 3QORB 2YD9A 3ZMEA 1TG8A 1WFNA 1WK0A 2KZWA 1NIBA 3O45A 5EU4B 1KC5H 2HZHA 1J5DA 3CPUA 1GOGA 4YDJB 2IMMA 4AC4A 4L9LB 1PW3A 2NY7H 2ZKXA 3CX5J 4OJDH 5BCAA 3VDBA 5BMFL 5D71L 3BUYB 1HHGA 1V27A 1BFSA 2EDMA 3MRMB 4G6FB 3VFMA 4HCRH 4OKDA 2C3XA 1RZKL 2R9HC 3MLYH 3MXVH 4TNWF 3OSVA 5F0PB 4XAWL 4OQTL 1M57B 3GMNA 5TDNA 1RVFH 2XN1A 5T1KD 1QHPA 3NSCA 4HUUA 2X2UA 4EDXB 1ZMYA 1KBVA 1KMGA 1QR1A 4U1NA 3ILDA 4M3KB 4NKIH 4NQCD 1QO3B 4MMYA 2ZYHA 4P5TD 1WGOA 2AEPH 3BP6B 4F2ME 1DVUA 5BUAA 4PJDB 2IBZX 4GOSA 1MWAA 1XH3A 2VR5A 3H9HB 5D4HA 5JORB 1KSRA 5EEZA 2V2WB 2E86A 2E8YA 4U1JB 2ZP9A 4QRQA 2KPWA 5D7LE 5I74C 2Z64C 3HW7A 3WEBA 1K8IB 2V3FA 1KPVB 1VSCA 5C0JA 5DMYA 1T22B 4HH9B 5IB1A 4DKDC 2R83A 4OZHE 3BMWA 3L4TA 3G9AB 4BWUA 3HR5B 1YPZF 1Q0XL 2ID5A 3MLTB 2Z92B 1NZRA 1N0LA 4RGMB 3WIIH 3VB9A 1YVLA 3FB8A 4LLWA 3K2UH 4ZNEE 4ZUTB 5BQDA 5AAMA 3WN5A 2PP8A 4FI8A 5DGRA 4AENB 4HK0B 3MOAL 3QXTA 4XXCC 3UC0L 4UT9L 1ACCA 4B41A 1U8NB 4OGYL 2G60H 3PGCA 3Q8FA 4N8PA 2VZ1A 4I9XA 4ZFQA 2FZ3B 2V2XA 3AFLA 1RUQL 2HTKD 1TLMA 3FT3B 4UB0H 1QW9A 2NY6C 3DPBA 12E8H 3H85A 3KYNB 1LXMA 2YZ1A 1CGWA 4TULH 3L08A 1J5HA 3WO4C 1CXFA 3DSFH 4WW2B 1XGPA 3V9EA 1LO3H 1SOXA 1CICB 2HN7B 1U8CA 5E4OA 4KQ3H 3APMA 3L95B 3NJGA 3QJUB 3VQLA 1JGUH 5AVQB 2MCPL 1BVZA 3NSYA 4NBXB 1QFUL 3H3KA 3UBGA 2ZCKH 5HD8C 4PJ7A 4FULA 4KAQL 4PRHE 3I75A 3MRRB 4HEPG 1UENA 4MLIA 4QRTA 5GS2D 5LWYH 3SKOA 4L1HA 2E7LA 1I3UA 4UQDA 4H1LG 2PO6D 1TJIL 1JTOA 1WAPA 2AEOA 2XICA 3GMLB 5EPMB 1N18A 4E9TA 4Y4FA 1AGDB 3UPCA 4FNPA 1AZRA 2Y22A 3PG2A 1EHKB 4M6NH 5C0ND 4D2NA 5F71A 2XPGB 1LHZA 1WBXB 2GJJA 2KYIA 3MRIA 1K4DB 2P26A 3FT4A 3OMNB 4KHTH 5MI0C 5EWIH 1UXWB 1VFUA 1A6VH 2CK0L 3A4AA 3HE6D 4K3GA 3T2NH 4BWWA 2BFVL 4NO3A 5D5ME 5HYQA 1J0HA 2F58L 1JPEA 3A6CH 4DK6A 4E0RA 1CYWA 1JWSA 4IBYA 3RVUD 1J9QA 3KGTA 3SCMC 2IANA 4I88A 3RWGB 4AXWB 2C7UA 2DJ4A 1WHOA 4H20L 3VH8A 3VWKA 2W80C 3LKNB 3FC8A 1EHLL 2YEZB 3WHE0 2RMNA 4XAKE 1DN2A 4IOIB 1J8HA 4OIIH 4TLTA 5TQ0L 4AZ8A 4XX1E 3EOAA 3FUFA 2CLVA 3EGXA 1U95A 5CKGA 3FN9A 3QUXA 5FDYA 5IR1A 2HLAA 1NMBH 2O1AA 2UY6A 5BVPL 1B6DA 1GGCH 5J4MA 4XPGH 5EN2A 1LDPH 5IQLA 4P05A 4UM8B 4MFHA 1RV6X 2YZ8A 3NA4A 2EDDA 4PFEA 3DIDA 3RB5A 2YGOA 1RK7A 2K9UA 5E6RB 3OAUH 3HB3B 2C34A 4H8PA 1E0OB 3ARSA 5LAXB 3EXJA 4ETQA 2Y5EA 1CE6B 1XD1A 3DV4A 1N0XL 1WS8A 3K8KA 5KVFH 4PN6A 1HILB 3BWAA 1GGBL 2YXFA 3JV5A 3AWGA 1MHCA 5HGHB 3HNVL 2CQVA 4PRPA 5AZEL 1I7ZB 3WY1A 3B9KC 1BX2B 4RFEA 1TYEB 2CHXA 4Z7WF 4D0CB 3QS2A 1PZ5A 5I1EL 3AUVA 4JO4H 3UCQA 4FQXC 4NZJA 1NM4A 4X6FB 2ZCHH 5F2FA 2BCKB 4ZOAA 3FO9A 4ZO6A 1CGSH 5ETUB 4PV9B 4WV1B 4G80B 5JW4N 3CVDA 3GDBA 4HFUL 4O00A 3VFVB 1T03H 4LSPH 3JT0A 1SMAA 3DUSB 4RQQB 3V0FA 4PJGF 5DD6B 3V0HA 2DD8H 3LRSA 2HVKB 3ARZA 1IGTB 4G8IB 3UYPA 3U48A 3ZQXA 4URKA 4FADA 4JFDE 4HSQA 1SLXA 4OD1H 3MZTA 4QDGA 3WE6B 1NPUA 2Y5TB 3BPNC 3FBQA 4JS7A 3WNNA 3RURA 3L3IB 4YDZA 4NPKA 3MYZA 5DGQA 4M7JH 3K72B 4HLZH 3PWJB 2DJMA 3ILEA 3U1SL 2Z8WC 5M7QA 4LE8A 3JV0A 5EEUA 5ALBH 5IEHB 3QUKB 4P46D 3G5XB 5G2NA 4XMKL 2ZOTA 3KGSA 3B8YA 4AVJA 4HX1B 3IS0X 4MJID 1F58L 4ZD3H 4YLCA 3A0OA 5KS9F 1LE9B 3OJ2C 1GKEA 4NUQA 5DJZA 1Q9WA 1X4XA 3VSUA 4FXLA 1C1EH 2MTAA 2XTSA 3CZEA 3H42H 1MI5D 4WY7L 4J3TA 1RPUA 3NT0A 1BD2B 4M8QA 5BV7B 4TUUA 3FQ2A 2F8VA 2JCCF 4LVHB 2FJSA 3W0WD 4LCIL 1GIGH 3SYCA 3LB6C 5D1QB 5D2LA 5JOPE 1A5FH 4MAYC 2OMVB 2V5SA 4CGUB 4ABWA 32C2A 1HCZA 3FQRB 3RDJA 1GYCA 3QPKA 2IPTL 5LNDA 1ADQA 2OXGB 3MGTB 3QJQB 3DHPA 4CN1A 4E5XA 3D1MC 5I2IA 2PLTA 3K0YA 5DHVH 1HKLH 2PXYA 5DUBA 4KJQC 2DEXX 3ZUCA 1UURA 2NNXA 2XG4B 1FUNA 1DSYA 1KEGL 3PDGA 5DI8A 4I48B 4N6RA 1WAAA 4D8OA 4GKNA 5JIDA 2VDQB 1N26A 1RZGB 5L6YH 3NPZB 4Z7OF 1ZJAA 1F18A 1BXUA 3BQVA 3O4LA 3HMWH 3MOBL 1FVCB 4OZGB 2WXNA 4N8VA 2R0LH 2JKWA 3JWNG 5DS1A 1OHQA 3LOWA 5I75B 5C0RL 4GG6F 1D5IH 1UVQA 5FYKU 2E9WA 1J9RA 4AKPA 5GRUH 2QVIA 3SY0A 3NJNA 1A4BA 5CP3A 1CTNA 2QPDB 4RRPG 4U2YA 4FG0A 4KRLB 2B0SL 1Q9LA 1CFSA 3CFMA 3MA9L 4B96A 4Y4KB 4TV3A 3FCTB 4NP4H 1MCDA 5AOZA 5DJ2A 4FQ1L 1Q4NX 4D3CL 1G84A 1O7VA 3QUYD 4XT1C 2O93L 3ET9F 5FUCC 1NC4D 3LN9A 2JH2A 3RBGA 1NCHA 3W2DL 3NCYP 4X7CC 5K9KB 2YD1A 1GAFH 1S9YB 1MFVA 3C6EA 1MFNA 1S6NA 2RQEA 3WDHA 4XE0A 3MYJB 3G5VB 1RJYA 3WFBH 2XTJB 2M1KA 3HC3H 4XPTH 4CADB 3I02A 1SVCP 4Y4HD 3PJNA 3FJTA 3OSKA 4MNQB 2NR6A 1UH3A 3C08H 4LKXB 3WCYA 4PJBA 4M62L 1UZ8A 1WH0A 3FU6A 4OZ4A 4Y5XB 3ECWA 3TL5A 4YAQA 1NDMB 2IH9A 4BZ2L 2QHLA 4XNAA 3DKHA 2I60H 3MRPA 1AGCA 5GRXG 3U30B 2AJSL 1G7MA 4GP4B 4KTEH 1QPXA 2AJVL 1BG1A 1IAIM 1MIMH 4UQIM 4X9IA 4FL4B 4LVOB 3JQOB 1XZ0B 2CDGB 2KKQA 3U0TA 2BSSA 3G7TA 1TQUA 4PCKA 3QG6B 2CRMA 4ALAC 1MRFL 5FB8A 1IKFH 3K8MA 4HALA 1AQHA 4KDTA 2BIOA 5JPNA 2AITA 1B0RA 2ATPA 1VACA 2ZWLT 2ZUUA 3IJEB 2YMXH 4YL4A 1LEKA 1FN4A 3W11C 2IDTA 5FECB 1KULA 4AEFA 1H8NA 1TDQA 4KKLD 4CRPA 2O6FA 2UXTA 4PRID 5I1CH 4KMQA 4XODA 4LASL 5JR1H 5KVGL 5E99L 2DBLL 1FPTH 1XAUA 2MRYA 1HHJB 3O3EB 3O6ML 4Q6KA 4UZGA 5EV7A 3UZVA 3HZMB 2QR0A 3VRLE 1T1XA 3ML9A 1EZSA 2PNDA 1FJ1A 2F1EA 4IRSC 4JFHE 4YPGB 3NAAL 3NACH 3QDME 1CLOH 1DVZA 1A6WH 3AUWB 4U1HA 3SD2A 2VXTL 1OAJA 1DJGA 4QHPA 3TEXA 1YMHB 4PI0A 3CFIC 1TZ8A 3QNXB 1OO2A 1F4XH 4YR6B 1MH5A 4LVNB 5CSZB 4OAWB 1XGRB 4YDVB 2A38A 3HUJF 4WHTB 3OC5A 3BAEH 3IGFA 1BF5A 3FULA 2ZAGA 4NQDA 5DRNA 1QRNA 3QIBD 2DQFB 4JANA 3V8OA 1KLGB 1D9KB 3KH3A 4B6ZA 4TNVK 2CDEA 4XC3L 1GMIA 3LQZA 2KLTA 4Y2DA 1AR1B 2LU7A 1AZVA 2P4AB 3KBPA 3DX7A 2AK1H 4UCFA 3OXSA 2QDVA 4G1EB 4NWTH 1KXVC 1A1NB 4FDWA 4UU9A 1PD0A 2WBJD 4F9PA 5AUMA 2PMZA 3IJHB 1YECL 3CFBB 1MHPL 1P7QD 4G6MH 3GZKA 5GGQL 1F6AB 1VA9A 2IOOA 1MJ8H 5I71C 1NDGB 1T3FB 2Y69B 4NIKB 4UILL 4PR5A 5D55A 3H9SE 5KOVC 4V1DE 3VXQA 4MS8C 2DJUA 2GKIA 3RL1A 3SDDC 2Y36H 1KBWA 4IGBC 2P5WE 2X40A 3V0EA 3V6OA 4PJ8C 4ELMA 5JDSB 1FSKC 3HAEA 4HJJH 3ULUF 4U49A 2BOCB 2ED6A 5CP7A 1RXLA 2HRHA 1NCBH 3QSKB 4AGLA 1QEWB 1M1XA 4R7NB 1KELH 1QD0A 4Q2ZB 5AALA 1NICA 1X4YA 3RYMA 1F13A 2JELL 2AANA 5ABAA 2OW7A 5IMKB 1W2KT 3ARRA 4FS0A 5F7HA 2GJZB 5BW7C 3N40F 4Q0XH 1NIEA 1T6VN 4N2OA 4YBLB 2HFGH 5AVUB 2ICWB 2X2HA 2IG2L 1CGTA 5GJTL 1C8PA 2C3VA 4BK5C 1IBFA 4PVMA 2J88L 4RA0C 1I8UA 3IJ8A 5GS0L 2WZ6A 1T66D 1ZS8A 2P8PB 1AD0B 1G7IA 2RQ8A 4M9OA 4MAUL 1PG7L 1I3RB 3HE7D 3QR0A 3EOYG 1YYLL 2JJSC 2VE6A 4AW7A 1UJ3B 3WFCH 3LNFA 4KKZA 4ZS7L 1YCSA 2QSVA 3M45A 1HK6A 4HIHB 3RPIA 1IKNC 4I18C 2CHNA 3ELAT 1NEPA 3Q8AA 2JQZA 4JX0A 1ORQB 1J5OH 2E7BA 5DK0B 1UD4A 1LQBC 4ADJA 2Y2YA 2NY0C 2D0FA 4G7RB 3D9AH 4A37A 1KG0B 3AG4B 2XWBA 3O6LL 4CGTA 1ZLSL 3VFUB 1QLRB 1HXMB 4JKMA 3K4ZA 4LEOB 1GYUA 3OMIB 4PJCF 1O6TA 4HIPA 1U8KB 2COVD 2JVUA 5ITFB 4Y16D 2UYLB 4LAQL 3GBNL 4Q9QL 4OCYL 3M17B 4WUUE 3GHBL 4IOFC 4HWEH 5DJCB 1IAOB 4GS7C 1SJEB 1TQBB 2VISB 1W16A 5ACLA 5GZNC 3BZDA 4XVJL 5D1ZI 1DQKA 1R3JA 5JHDA 2D3LA 4AYDC 1M53A 5C6TH 1K6QH 2VLRD 4IEFB 4KK9D 5T5FL 3RA7L 4HUKB 4AGPA 2GITB 4PJAF 4URTB 4GO8A 3QS3A 4FHJA 3THMH 5HDQL 4S2SA 3IU4L 5HYJE 1JNHB 5CGTA 5ID0B 2EDTA 3KPLA 1SOQA 1TJHH 1EBAA 4YPJA 3L13A 5DK2B 2FH8A 3L4WA 3CDYA 1GW0A 4JDTL 3OKEB 3ZKSD 3G3LA 4IJ3C 1TU2B 2NYYC 3GRWA 4BQCA 5E8OB 5JW5B 3FHEA 2HFEB 7PAZA 4YHKH 3ABLB 5I15L 4PUBH 1ZGLP 3K6FA 4W93A 5HPOA 3LXAA 3MRFB 5IHUL 2X4QB 1PNCA 1QI3A 3LRLA 4QAMB 3SEPA 1BXAA 4HWNA 4WO0A 3GGWB 3KYMB 3LCYA 4ODUA 4FYRA 3HCVA 2Q8BH 4OCXL 1GYAA 4YK4B 2ZX6A 4LIQL 1Q9KB 4M1CD 4QXTA 3I3BA 2EDFA 4QJ5B 4I1RA 2GJ6B 4EZMA 5C0BA 3PYCA 5MEPB 4BFOA 3GJFH 1L6PA 4OF8A 2OMWB 4EE2A 4AUYA 5CBAB 5I1AA 4ODSH 3AMLA 1HH9A 1IGYB 4L0YA 2DLFH 2DWYA 3WKYA 1A3RL 3GIZH 2BDNL 4ALAL 1FH5H 1FGVH 2NQDA 1R33A 1KEML 1KYOJ 3FXIC 5GSRB 2ZSVB 3AS1A 4JDEB 3ZYJA 1HAWA 2ADYA 4HXAL 1BECA 1DJHA 2B8OT 1R0AH 4QRRD 1KIPB 1J86A 2AXGA 4PWFA 1Z5HA 4GT0A 3QEQD 4JGNA 2V8LA 5CR1A 3ZT6A 3NJLA 3CXHJ 4PVNA 1EHXA 2BP0B 2H0FA 2XZQH 4GFXA 2H8PB 5IB5A 4WW1B 3HRPA 1A6AB 4E9YA 5KBDA 2R39A 5CD5C 1Z9SA 1YZZA 4JREB 2PCFB 3BLKA 5C08D 2P24A 4LQ1A 2N1TE 4CKVX 3RZWA 4GY4A 4PJHE 5E94A 3ULVF 1OL0A 1D7FA 1Z9MA 2OMYA 4DVRH 3MRQA 3MCLL 4G8GD 5IFJA 1G9ML 3PABA 4RGNB 4OFIA 2KL6A 3IKKA 3C2AH 3D52A 2SEBB 5SV4A 3NIFB 3NCMA 3TO4B 1MQKH 1NANH 1JD9A 4E5XG 2EAEA 5DQJA 3ARWA 1GC1L 5HI4C 5EBWA 5I1LB 3VVVA 1BP3B 2E74C 4XMVA 2AW2A 1I3VA 3MV9E 1EEYA 3KGUA 5DSCB 4BFKA 5ENWB 5L8JB 5JLZA 2NY2D 1IEBA 2ZJSH 3MROA 1YY8A 3KXFE 5KYYA 4GKLA 4P3DA 1H3UA 5C07D 3JXAA 3PP3K 5HPMB 4JO3L 1KCWA 2XXFA 4OIFA 1EEQA 1FCGA 1XGTB 4JM2C 1S5IH 3U0WL 2VZTA 1F11A 4HFWB 3U79A 5F9OL 4NLAA 2BP5M 5FO7B 4NKOA 3V2AR 4Z7QB 1G7PB 5BO1H 1QUNA 1NCAL 1I85C 4L5FL 4AV0A 3ECQA 1QWNA 1ZT4A 3DA0A 1DBJL 1LDSA 1RERA 2XWRA 2AI0H 2XNAA 4QHNA 4QPEA 1G7JA 3ZGIA 1I75A 4NN6B 4J4PD 1VERA 2YWYA 4BELD 1GSMA 4ZRGA 3HHRB 3EOTH 4UF7C 1MW3A 4ATWA 1AIFA 3VFTB 2P44B 3MMEA 2HVBA 3WFEH 2H0EA 2LFEA 4J3WA 4U1IB 3NPSB 3ARED 1KCUH 4R2GC 3ETSA 4NOFA 4XPBL 3S48A 1WFJA 5BZWA 5T5NG 2DV6A 4EI5C 2ATAA 4Q8BA 1B9KA 1JYXA 4JRYA 3LIUA 5EZOH 4JN2A 1R3HB 4KMLB 5B3JF 5C71A 4M4RA 5HI3D 1Z2KA 1UM4L 3LH2L 1JN6A 4AM0B 2B1HL 1MCWW 2A9MH 3C6SB 4P57A 1RZIB 5DHVB 2CLRA 2WXOA 3MLSH 3UCRA 4L18A 3TV3H 2CGRL 3SGEI 3Q5YA 3QCVL 2O5YH 2RA1A 3RZCD 2EADA 4F7EB 4R26H 3SBWA 2JKNA 2W9EL 4HHAB 1MY7A 5GS2H 4BHUA 4NP9A 4WDIB 4S0HA 1MRDH 5E8NB 3D18A 5J6HB 4UM9A 4O2EB 3EFOA 4OM1H 4M7KL 3L5JA 2A6JB 1T7ZA 2IH1B 5KVDH 3VXUE 4OJAA 1SEBA 2QFRA 3ZX1A 1S7XB 2WAHA 4PJ5A 4Z7VE 5FO8B 2BMKB 4G7YH 1NM9A 4AQEB 2IAMC 1W8NA 4NO0D 1Q1JH 2FD6H 2ESVB 5AOLA 2AEIT 5ISZB 3HNTL 3MRDA 3LDBB 4LLQB 3HBZA 5EF0A 1FBIL 1N70A 2B1OA 2DQJL 2XWEA 3CVHA 1DJIA 3KS0H 3B6SB 2A6DA 4F58L 3CPLB 2PCXA 8FABA 3IJSB 5I8EA 4ZK8A 1DL7H 4YNYB 3TCLA 1LILA 4K3DH 5JPMC 1MDAA 1OLLA 25C8H 1DE4A 5AKSA 1UA7A 4RSVA 3FH7A 1E8YA 4UIMA 2K0RA 4DGVH 4OZIA 4AEHH 2PP9A 4J3OG 2EIDA 3WHXA 2XIBA 1THCA 5GISL 4ABVA 3QRGL 2PW2A 4R3SB 1FFPA 4XNXH 2MJWA 1RZ8A 4FFZH 2DQ6A 5IBTH 4ZXBC 4FXKA 3D34A 1BZ7A 2BNRE 5HSFA 4OGQC 3RJDA 2FCBA 4LHUD 3L4ZA 3N41B 4MXWH 1NL0H 4AJVA 3MLUL 3L3GA 1U6AH 3B9VA 4RIRB 3OJDA 1MFAH 3QUZA 4M1DH 5KSVA 4X9GA 4KJPD 3MQIA 1L9QA 2W0FB 2Z4TA 3AG2B 4GW1A 4NT6A 3WMQA 1BQSA 2P5EA 3IFOA 3AAZA 3VD3A 5EU7E 5FHAH 2AMUA 3CN4A 5DFVD 4R4NC 3H1ZA 3Q5OA 3NCCB 3SDCB 2GTWB 1PD6A 3TFBA 1EJOL 2CBQA 4G6AC 2WLNA 4XN2A 4C54A 3HRZB 1QPKA 3HC0B 4WI9A 1TKWA 2EIKB 3ASNB 1GY2A 3P4MA 4N0YL 4YQXL 1ZE3C 2RFXB 1IO4C 4XVTL 1OP9A 3QXWA 5LXGL 2MSPA 5I6KA 1RHHB 3QDHA 2DQCH 3CXDH 3EO9L 1T5WA 3X3FL 3HAEG 5L9DH 5K5YA 2DDQL 2AEWA 3BGAA 1U8QB 1EK3A 2YD4A 4RWHA 1HSAA 1SUHA 3QIWD 1BAFH 2CIIB 1AOZA 2FATL 2X12A 2E75C 5HDBE 3EO0B 2X4UB 2FJHB 4P2RB 1OCZB 5D7KE 4I0KA 5FOBA 4Z0BH 4AEIH 4X4YA 3WAJA 5EOQH 2F74A 3MN8A 5EBGA 5KSBF 3VFNA 2AQTA 1E5YA 2B14A 3DGGB 4UANA 1YJDL 4BUQA 1M1SA 3BN3B 2YD3A 3QGVA 3C5JA 1P5UC 1PKQA 3PIQA 5C7ZA 4LPUA 1H8OA 1IAKB 1ASPA 3Q6FB 3PJSB 3QJOA 2A0LC 5AVXB 1SDDA 5FM4A 3X14A 2HH0L 3CG8A 2EABA 2CXKA 5KJ4A 3TLRA 5IOPA 3BLBA 4XMLL 5CIPH 4H8QA 4HZAA 3GF8A 2VT0A 5BOJA 4X99A 3ZE0E 1XZWA 5D72L 3NIDB 1RZJH 1UFGA 1E5ZA 2FYYA 2H2SD 3ULUL 4U1KA 5E9DB 3P77A 3MRBB 1JUFB 4NPJA 4Z0XB 3SPIA 4X5XB 2YPVL 3EJQA 4PCSA 5BRZD 2P8MA 4J6RL 4IOSA 4XNZC 1MUJA 3DJ9A 2VXQA 2X4NB 3MRLB 5GGSA 3WIHL 2E7LC 5C0IA 1FNSL 1OZTG 1X7SA 3BEWB 1C5CL 4PU2A 3OZLA 3AW5A 2ZKHL 2HRGA 3OX8A 3QIUB 5CJQL 1DJWA 5IW6A 1V3MA 2XACC 5I1JL 3B7RL 1JXDA 2Q76A 3VX1A 1LO0L 2X4RA 1CD9B 3US9A 5JIQA 2GB2A 4U1GC 5L2KE 1U8HB 5IIEA 5T5NF 2ITDB 3VXSE 5HI5C 3VXTB 4V2CB 4UTBH 4XZUA 2EE3A 2ICES 4Y5YB 3ZE1F 5JUEL 4FMVA 1ZKAA 3QFJA 1E27A 5J9PA 4KKBC 4OUUB 4QAWA 1I1FB 3EG9A 1KPUB 3TVMB 1HEHC 3HMXA 2XQYG 4WJ5A 5DJYA 1MLBB 2AJYL 3V5HB 4NO5A 1QX1A 4MQSB 1CFVH 4BYHA 2QSTA 4PJBF 3JWOC 3QUXC 3FN0H 3LNHA 3O81A 3IN2A 1W91A 4PREA 3CV5A 5BNXD 4U3SB 3TYGL 2A3TA 4DKEL 1B2WL 4QHKJ 4ZPVA 5CWSB 2YPLD 4KX9A 5FFOA 3L45A 5BS0A 3ARDD 3WKQA 4YGVB 4X6CB 3QEUB 3ZYIA 1HHHB 1NOFA 1WZ1L 1IJ9A 1MCRA 3QHFH 2NY3D 4MLSA 1INDL 1OK0A 2GVYA 4JFFB 2C8NA 1D2PA 2DLEA 3OZ9L 4IKLA 2V8MA 1LJMA 4CDGC 3G6AA 3GNML 3QQDB 4MYPA 1K2DB 2J44A 5F70A 2B4CC 3PFUA 2DM2A 4QHKI 5HHOA 1ZLWK 3TBBA 1C12B 1B90A 1IAII 2FT6A 3APDA 4LSSH 3ZTCC 4TKWA 1S46A 2FX7H 4YXHL 2F7QA 3MV7B 1O5PA 2GUYA 3E6HB 4U6XA 1ZTXH 3KLHC 1MVFA 3K0WA 4EQ3A 1EGJH 1RU9H 1T6WA 3LPPA 1Z3GH 2NX5E 4OTXH 5B39A 2CCLA 2FHBA 3T4YA 2K4AA 4FTVD 5C0CB 3TV8A 1RCYA 3CHXA 3GTVA 2DQUH 3PV6B 4PJFB 5EU6A 4BZ1L 4J3OF 2ZOWA 4J1UB 2NNAB 5I1DB 1AHWC 4M5ZL 1G9HA 4FP8H 3LPWA 3ZKMC 3W9DA 3ARPA 1T0OA 2CJ3A 4U6HB 5EMYA 1CDCA 4BXSV 5SWZA 2DYSB 4TSBH 3S97C 4YN3A 4B0MB 3DIFA 5EZIL 2ADFH 5IP4A 2VLJB 2EYSB 2F8IA 2WUCH 2ZWZA 5HDLA 3BP5A 3MBEB 3NCJH 4YDLB 1QFWI 4XNUH 1AI1L 4F93B 3US0A 2MMXA 3L2MA 3RNKA 1PLGH 5E1IA 4MTMA 4QRPD 3T3ME 4EIGB 3ESMA 3WSQL 2CJSA 3CLEH 2ARJB 1A1OB 2JQAA 4HBCL 3V6ZB 5KSAA 3SGKC 3JZYA 5E4EB 1OM3L 1J8RA 1NGYB 5JNYA 1MKFA 3DRTB 3IGAA 5JQ6L 3TF7C 3DXAB 4TLKA 1TJGL 5L2JB 1JERA 1V7ML 3HLAB 2NSQA 4YHNA 5AVZB 2IXQA 3ARBA 3GXUB 5A16A 3IFPA 4FCHA 4O58H 1E2ZA 4U1LB 5DRXB 2YAHA 4IU3A 1VFBA 1JZIA 2QKIC 2X4SB 3QI9A 4KHXL 1CL7L 1DFBL 4B7IA 3E7JA 3T0ED 4CA4A 2APBA 2FEDD 4OCWL 4Z1PA 4K5PA 1UWXK 4ELMF 5IVXE 1AD9A 3F84A 2EKJA 4LSQH 4CN6A 1HCYA 3GJFB 1JFQL 3KD4A 5IW1A 5DS8B 1U0QA 2ZOLA 3BXNB 3KEDA 1L5GB 1UD5A 1XEDA 2J4WL 1MWAL 3RAJH 3GSNA 3D6GA 4JFYB 1GJWA 3VW3L 1E4WH 3BAYA 3IMUA 4L48A 3VCLA 1OB1A 2WLKA 4LBAA 2NY1B 1UD3A 1KGYE 3UIYA 1XF4A 5F9AC 3A4EA 3FFDB 3QWRA 4FNRA 4YS4A 2DOCA 1LO2H 1GSKA 5ANMA 1AMXA 3KW8A 4IKIA 3ULVL 4EZKA 3PHQA 3AQZA 1R24B 4WFED 1KZQA 1DVFC 1ZEAL 3DSNB 1GY1A 1RZ7L 4HUWA 2F1BA 4WI6A 2H1LM 4FC3E 3RX5A 1GR7A 1QSFD 2I85A 3GIVA 4UZSA 3GPSA 3PP4L 5C2BL 3F12B 2CUAA 4W9DC 4Z95L 3LQAH 3OAZK 1OXYA 4Q9BA 3OF6A 1DBAL 3DJZA 1F2QA 2PTTA 3DMMD 4PRHA 2BNQE 4NM4H 4BCZA 3QQ3B 5BZDA 4IDJL 1T4KB 4DOHE 4JKPH 5EEWA 3V0AC 1KXTA 4U2ZA 1IEAA 1U36A 2RGSA 4NQCB 5D2NB 5AVVB 1BZEA 3O6FC 3TIEB 4E41D 4TSCH 4XMUA 2R9HD 1NJ9A 4M48H 1I9JH 5E6UB 1B4JL 4KTDH 1ZLUK 1YMMB 4K73A 1A4KB 1YA5A 1G1OA 4JPVH 4LSVL 1NGXA 4G82A 2ZWNA 4U6TA 4ES8A 2WNKA 4NN7B 1RJLA 5KOMC 3TA4D 4HWBH 1E9PA 3NIGE 3BCFA 4LSRH 3KPSE 3HI6H 3MNVB 3ZMRA 1KY7A 4L29B 1SEQL 2BNUA 3G04A 3QH3A 4PRDA 1NCWL 5LGHL 1P84K 1XX9C 1L6ZA 1X6LA 4I4WA 4OUOA 3AU1A 4YUEH 4BD4A 1CF8L 3JWDC 4A7GF 3GHEL 2C3HA 2W8CA 4LSUH 1CD0A 3QRFM 1IC0A 3PV7A 1S7UB 2WQWA 3CQQA 3P9LB 1P6FA 4LCCC 1U92A 3UZQA 3R06B 2DWEB 1SLWA 5J1AA 1K3IA 4TTGA 3L7FA 2WQUA 1DLHB 1EO8L 4LLUA 2A73B 3CE1A 1BM3L 1JPFA 3DJRA 4QCIA 1ND0A 2AV7A 4ZFZA 3V4UL 4NRZB 4NNPH 3QDJD 1NAMH 3MJ8B 2NY6D 4PWGA 1XXFC 1QLFA 3RVWC 1JPSH 2VZUA 3WFHA 3IAGC 1DZBA 3MLWL 1BBDH 5F8RC 5E5MB 5EC2A 4MA1C 1DQDL 3GLAA 2QZ5A 4PHZA 4KI5F 1EFXA 4LOVA 1RUMH 2YKLL 4JMXA 1PPIA 2PYEA 4M1GL 4P5SA 5J6GB 5DZNA 3PHSA 5HTSA 6CGTA 4ZX6A 5CLTA 5IMMB 1OD7A 2DWSA 2R4SH 2VR3A 4GUOA 3MLXL 3ARXA 1F4WH 4Z18A 3CDGB 5HD8D 5MP6L 1ZPLA 2NRDA 2H45A 1SDYA 3C6LC 4FRWA 4OM0L 4Z3EA 5DZLA 3I50H 3DDGA 3JTTA 3BVTA 2WQAA 3CHSA 2N4IA 1YPZB 1U8JB 2VXSH 3HE6B 5HXMA 5ESQB 2CUIA 1LO4H 3PQYA 2O6CA 3D69B 1FZOA 2IDUA 3QG7H 5D4QA 2QFPA 5TE7H 1JK8A 3UFIA 2CR3A 4NZUH 4W9IC 4AX3A 3MJ7B 1JMXA 9PCYA 4YLBA 5DJAB 1QZ1A 1P4LB 3WEMA 1F56A 1L9OA 2WWMC 2EDHA 5LGJB 2APSA 4H2AA 5SWSE 4DCQB 4RBPK 4O02L 1NCGA 3VA6A 1HOEA 1LM8V 4TUJB 2Q7YB 3GBML 3ULSB 2X6CA 4ACTA 3ARGB 3DTXB 2XKSA 3HG2A 3TZVB 3SCMD 1SMOA 2YD0A 4HS3A 3FTVA 3BAKA 4PRBB 4U1MB 3GMRA 4DAGL 1DQJB 3OR6B 4YX2L 4IRJD 1S7QA 3L4CA 1MFEL 4ICXA 2NT0A 4TSAH 1BQUA 1AGFA 1ZA6B 4XCEA 1N7ML 2J8HA 5EZJA 2GBVA 1DSFH 2I7OA 2Y6TE 1ZDSA 3HFML 3QDGA 2IH3A 3EYOA 3QQ9C 2FUTA 5FKAB 2BIQA 2FEEL 5F1NB 1UWGL 4PP2A 4Q7DA 2XV6B 1OP5K 3SDAA 3ZHLA 3AQDA 5IBLC 2VMJA 3FRPB 1A9EA 4IDLA 3A6BL 5ICZA 3KR3H 1BXXA 3IE9A 5C0DB 1GW6A 1DBKH 3KPRE 3DVGB 5BVJB 2I07A 2JQMA 3IXAA 4X5WA 2BSCA 5EB9A 5ESAB 4AT6B 2G3NA 2GQHA 3CX2A 1YQ2A 1A14H 4TLUA 4OGAC 1KYAA 4JRXD 1JI2A 4QTHA 1XR8A 3VI3F 1JGEA 4TMPA 3LKPB 1I9IH 4X6EB 3EO1B 1JYVA 4XCFH 3POHA 1S9KC 4EEEA 2DRUA 2ZG2A 5T33H 4JPKL 4I1PA 1FYTB 3B9KD 4U33A 4XXDA 1AE6L 5ILTH 4PG2A 3ZZ1A 1FNEA 3FTYA 3RDTC 4FQCH 4FQXD 4FNQA 5F7DB 2NDGA 4LNRB 3P0YH 4BA8A 4IBTA 5J57B 4E9LA 2C1PA 3IFNL 4YH6A 2YJLA 3LV3A 2LT9A 4YHZL 4FG2A 4JFUA 4PB0H 1XWVA 2VJXA 3AVEA 4I77H 4XO8A 3BAWA 3NZ8A 4JMNA 1YEJH 3L9RB 5TDOA 3C5ZC 3P3UA 4AYFA 3S34L 4TUKH 1XH1A 3WNIA 4DEPB 3PWPE 4KVNL 2W65B 5GGUA 2X4PB 3FQ1A 4KK5C 4WWKB 1F00I 1KJ3H 1FIEA 3QORA 4ZAKB 5EU4A 2Q8AH 1YNLH 3TT3L 1GYVA 2XT1B 5CIPB 4LEXH 5GGVL 3PHOB 4HV8B 2D3JA 1S3RA 3VE0B 1OAKL 4UDUB 2NQCA 4YHLH 1F6LL 4LCWB 5A1AA 2YAFA 4Q89A 2G2NA 4ZTPL 3LRGA 4HU8A 4RMWA 3TPUB 1FYHB 3VGGA 4NHUB 5AENA 2NNRA 5IQNA 1KWGA 1B4RA 4FG4A 1RSYA 2WZPA 2GABA 1INEH 4OV6F 3GZQA 4HC1H 1IQDA 3PL6B 4Z7WB 5B38B 5B1KA 1JSYA 1MCJA 2WQVA 2A1WH 1JGIA 4CILA 1X5ZA 1OGTB 2HJKB 4HGWB 2P48B 1SF5A 1CLYL 5HY9B 1NTDA 1A22B 2MPVA 3APNA 2A83B 1AO7B 1B4LA 3BP6A 4FZEH 3GI9L 3MBWB 3LB6D 4PMFA 4KZEL 3H9HA 4D8PA 1YNTF 3CZJA 4MAYD 5B39G 1DN0B 1UM6L 1M71B 1VGKB 2VRQA 4U1JA 2OMZB 5DK3A 4KXAA 3S3JA 3QYMA 4NCC2 1EXHA 4PJGB 4OZIF 3P4OB 5EU7C 5FYLL 2NY5H 3CDZB 3HZVA 4F33A 3B2XA 3ZE2E 2P5PA 2IGFH 1T22A 4J8RB 5T1DL 3GTNA 4XP4H 1UH2A 4YE4H 2E7DA 3I6KB 1UCTA 4C59B 3HR5A 4I3RL 1M3JA 3MLTA 4KJQD 1T6BX 2Z92A 1JRHH 3RHWF 1NFDE 4P49A 2W60B 4BIKA 2KC0A 4NQXB 2GIMA 4E9QA 4ZUTA 2ZUYA 3ZR5A 1HI6B 4U3HA 2YOAA 4AENA 1L7IH 1T0MB 2BXZA 3E2HB 1I9EA 2AJUH 4HYTB 4WCYH 3ILQC 1JDCA 1OGAE 4B50A 3NRPA 5I8OL 1KY6A 2FZ3A 3PGDB 3NABL 3QUYB 3FT3A 5KS9B 5IBUG 4N2DA 3KM1A 3UTPE 1DUYB 3AT9A 3GO1L 2APVA 1NC4B 1J11A 2PWHA 3QJRB 2OJZH 3UP1A 4AJYV 5JIMA 1MIEH 2OAAA 3IRCA 3UXFA 2E9IA 2UX6A 4WW2A 3UG5A 2XWJB 1NCNA 3B2VH 1O7DE 1CICA 2JCCB 3L95A 4PJXE 1S78C 4ETYA 3LEVL 3HBGA 1TENA 1WZMA 1QSEE 3DUHA 4N8CH 3WKMH 2N7AA 2DQTH 3IWUA 3NZHL 4PSPA 3FKUS 1UZGA 4Y9GA 1GZHA 4C56E 3CGTA 1YEWA 4J3VA 4P2QD 1F97A 3K2MC 3ZBMA 3HZKB 2XV2A 1TETL 1K5NB 3H9SA 3MRRA 1RUPL 1VFAB 3FBKA 2OR9H 4HS8H 3LSOA 3U7AA 4MMZB 2X6MA 1SJHB 2VJ0A 3GXTA 1SJMA 5A2KH 2XSKA 4I3SL 3GMLA 5EPMA 4Z7OB 5DZ9A 3U4BH 1AGDA 4FA7B 3G6JF 3BZ4A 3GS0A 1I4FB 1LP9B 5FGCE 2XPGA 4TQEH 4XBGB 2PWDA 1QKZH 1M05B 2V9RA 5I5RA 2ZUVA 1ETA1 2G5BA 4GNKB 1UXWA 1M7IB 1CVRA 4OCSH 2H0PA 2Q9OA 4DQOH 4GG6B 5AW1B 1T83A 2R51A 2F53E 2H6UA 3VGHA 3GJEA 1OWRM 4AL8C 3DOSA 4PRIB 5GGRY 3AT8A 4L4TD 2BVTA 5CUSL 3RWGA 2OZ4H 3O3AB 4AXWA 5GHWH 3HJEA 2XJLA 4M6ML 3NJXA 3MLZL 2D8KA 5M94B 3T6ZA 1C5DA 5DS2A 2YEZA 3MRCB 2G9KA 4PJ6A 2C7FA 4Q6IA 3IBEA 4WK0B 1IFHH 3W11D 1HL8A 1PY0A 3D0LB 5ADPH 2R0KL 1KB5A 2JE8A 1NGPL 3PY9A 5E00B 3QA3B 5I66B 1NGWB 3HVDA 4DO5A 4UM8A 4RFNC 6TAAA 3LKQB 4PWKA 1VPOH 4MQTB 4IRSD 1S7SA 4ODHL 4P4RB 1IILE 4XP9L 1V55B 3BGFB 3GBEA 4NQQA 4XWGH 3I2CL 3QZWG 4MZRA 5LAXA 1GS7A 3U82B 4X9HA 3VRJB 1CE6A 1N3NA 1W72B 3NTCL 4XMWA 1HILA 2C9RA 1S3KL 3UTSD 2UVEA 3RILA 1BVLB 2WYZA 4MX7B 4WUUA 1I7ZA 1Y18B 2UXGA 4A2DA 1TR7A 3UZEC 5EO1B 4D0CA 4XX1G 3F7YA 5E2JA 3U1QA 1GGYA 3QPXL 7FABH 1KJ2A 2EYRB 4MBOA 3TA3B 4X6FA 1AGEA 2BCKA 4KK6C 3PWUB 4C83B 5ETUA 4WV1A 4G80A 2HT3C 2AJXL 3VFVA 5FWRA 3DUSA 4YHYB 5FA4B 4XMZA 1LYQA 5DD6A 3BYYA 5DCCA 5HYJA 4G8EA 3Q2CA 4GQ9L 5L0QB 4HUCA 1IGTA 3VFRB 4G8IA 4EUPH 1JIBA 3B7TA 1P5VB 3WE6A 3X1NA 1KZYA 4MS8D 2Y5TA 1O9ZA 4TLSA 3SDDD 4CMHC 4GAJH 1T20B 3L3IA 1PG7W 3O0RL 4IGBD 4LT7A 1HL4A 3HA0A 3P3TA 2G0LA 4PJ8D 3M1OA 1OT2A 4OH2A 4R97B 2NZ1A 3D39D 4OLXL 3CFDB 5LB1A 1ZOXA 3QUKA 3G5XA 2XVBA 4LP4A 3ESVF 4JRLA 4OJFH 2XI9A 4HPOL 2GEQA 3IN0A 3L3JB 3H53A 2EH7L 1FL6A 2VQ1B 3LN4A 1BFOB 1RUKL 4OGZA 4K7PY 2YKKA 4PLKC 3HUJB 1LE9A 1JV2B 3CFCL 1PF3A 5CFHA 4X7FC 4QXUL 4FJYA 4JAMB 3UG3A 4NJAL 4MNGB 5DD3L 1L0XA 1U30A 4U1SA 1EX0A 1TQTA 2VN7A 1N64L 4PJDE 1BD2A 1NC2D 2I24N 3QUZC 4N25A 3S88L 1NUGA 1EDHA 3UAAA 3V95A 4PB9L 1NMAH 4JPWH 3EJUA 2XZAH 1E6JH 3FU7A 2OMVA 4WEBL 4H0IA 1YYML 2CKBL 2OP4H 4N26A 2DI7A 2UWEB 2V37A 4U31A 2IVFC 5HHQA 1KBBA 3EDDA 3FQRA 4JZJC 1U8LB 3WIFA 1OSPH 2FQEA 2X1XR 3ZN6A 3TTYA 2OXGA 3DPDA 3MGTA 4U7KA 3KVDD 5C0EB 1JZJA 4KUZH 3T3PF 1HIMH 2DTMH 2NY0D 2OM5A 2K1MA 3KWWB 3C60C 3D3VD 4F3FB 4I48A 1BMGA 3VG9C 1RZGA 4K94L 4DUVA 1F86A 4PJ9A 5D6DC 4G71B 1W8EA 4WENB 4YSRA 1NAMB 1FVCA 4OZGA 5D93B 3CWGA 5AL0A 4L3EB 1GZPB 3H0TB 1NOLA 3AXHA 4OZHF 4PI2A 4IOFD 3RWFB 4XTRC 4K9EH 3VB8A 4UOZA 1PZDA 4PJHA 1ZD6A 5EBMB 5GZND 3EYFB 2B9AA 1MWOA 4H20H 4FLRA 3ZKXC 3WHE1 1BWWA 5E9NA 3ZYOA 4Y4KA 5KVEE 2NDFA 3FCTA 1VZHA 3QAZC 2WWKT 3RWHA 4MDJB 1BFTA 1ZANL 2X05A 5H4ZA 4W9ZA 4JL2A 3TJEL 2Q3AA 1Q72L 5HJDA 5DRWB 2DKSA 1NUDA 4GG8A 2HX7A 1HTYA 2A99A 3ZT5A 4MJIE 4FQIH 4JZNB 1KGUA 1ZHNB 1MPAL 3O2DH 5K9KA 2PW1A 1S9YA 4JG0L 3SZ6A 2OI9B 4XNMB 1SBSL 5BRQA 1IQWH 3LD8C 3FFCD 1AY1L 3G5VA 1UA6L 2VDOH 3M7FB 4CADA 1MI5E 4ZOCA 1F1DA 2NYYD 1FIGH 4WTZA 2OTWB 4NQVB 4MNQA 2HRPL 3HNVH 3HS8A 3T0AA 3OKMA 4PJCB 1TTUA 3FAXA 3W0WE 4BRJA 1NDMA 1WFIA 4HF5H 4RESB 4YZFE 5IUCA 3BX7C 1Z5LB 4R90L 2F5AL 3OQRA 4GSUA 4YSTA 3HC4L 1CE1H 3IKCA 5DD0L 2A7BA 5FYJL 4DP1X 1XZ0A 1NDTA 2B1AH 3KE0A 3P4NB 1MAKA 4X8XA 3NDZE 4G1MB 1HHKA 4M43L 5LCVA 3QG6A 3GSRB 1XBRA 4NFDA 5D7LD 3V7MA 5JIIA 3TM6A 5DJXB 1M3IA 4JM2F 1BGXL 5KJ7E 4QO1B 5DO2C 4CBZA 5D96C 3S3PA 1HCVA 1UM5H 1HAUA 2VM4A 3IJEA 2CM5A 3VXRB 4B9YA 3JUZA 3AY4C 3O3BB 4PJAB 4I8DA 1KYFA 1V05A 5G5DB 1MCOH 1S5HB 4AMKL 5D5MF 3VFWB 1RP8A 2FHCA 3BZEA 4ZSOE 3ARFB 5G4OA 2IEPA 4ABUA 2XWDA 3VXMA 3EOBB 1HHJA 1KBGL 2JNZA 3BSHA 2WIMA 1O0VA 3MAWA 3O3EA 4X9BA 1FLRL 1CLZL 2EXWC 2EIZB 3KHOA 4YPGA 3S35X 5IV2B 3MNZB 4G6KL 2OFQA 2DEYX 3KPNB 2YWZA 5J3HC 5A2IH 3MXWL 5IROC 5CD5D 4QWWC 4Z77B 2WLZA 1PL3A 1OD9A 2ZXGA 3QARA 1JJUA 5G4MA 3SGDH 1JGLH 1RMFL 2QSCL 3KLQA 3WNMA 4YR6A 4UBDC 3VXUA 2FT8A 2XWZA 4OAWA 3MCYA 1PZBA 5I6XC 1XGRA 3MUUA 3KLKA 4Z7VA 4YDVA 3CBKB 1ZV9A 1HKFA 4WHTA 5K9JH 2QMJA 2ZG3A 4P2AA 2YRLA 1HZHL 3GM0A 2NY2B 2DQFA 2JB5L 4NQED 4DKFL 1BA9A 1D9KA 4YXLH 3PWLB 4J3XA 1CGUA 1GVIA 3MACL 4HISA 4LCIH 4ENEC 3T71A 5C07B 2X6BA 3II2A 1MN4A 1UOVA 1SN5A 3B4NA 2DTSA 3MOQA 5HI4D 3CUPA 4G1EA 2MHAB 4ZMPA 2X70B 5ADOH 1A1NA 4B27A 1KT2B 2NYKA 3IJHA 4HKXA 1AXTH 2OR8A 2ETWA 4ERSH 5CNHA 4JJOA 2VDNH 1F6AA 4X0NA 2JKXA 3QW9A 3VQ2C 3ZDXE 1NDGA 1T3FA 2YAEA 1LWRA 3GBDA 3RFZC 5IB3A 2HKHL 3JTSB 3MC0A 4MMYB 5TK2A 5F3HA 1WIOA 4JM2D 3UAFA 5JDSA 3AREB 5DJ6A 4RWYH 1AKJB 1R3LB 2AK4E 4HCRA 3VJ6B 2BOCA 3WNJA 4XO9A 3ES6B 1PIFA 2Y2TA 1I9RH 3H9YA 2D9QB 5C0RH 1XIWD 4JQIH 4CVWA 5IB1B 1JK9A 1UZ6E 2VB5A 1TMCB 3M86A 3ZHFA 4R7NA 3KJ4C 5CKAA 4Q2ZA 3ZTJG 1MHHA 3NN8A 4OQ1A 5FHBH 3X12A 5I19L 5H4YA 2EDNA 1F45A 3DRQB 5IMKA 4R2GD 3TN0C 4XAKD 4EI5D 3WN5B 1UQSB 4E36A 4XPHH 4HGKC 4MWFB 2BY1A 3IF1B 2VDRH 5J13C 4GBXC 5DD5H 5IF0B 2F2HA 7CGTA 2V17L 4P06A 3PGCB 5D1QE 5H37A 3UBXI 4XO5A 2ENQA 5T3ZD 2P8PA 1AD0A 1JXFA 4NRXB 1I3RA 1WFTA 4WEEA 4DN4L 1IFGA 4ESKA 1UJ3A 5LLIC 5EF3A 2H3XC 3VRIA 4FQJL 3BE1L 1NCCH 4YDNA 1BQLL 3NK4A 2OMUA 3HKFA 1U2CA 4MCZA 4S1QL 5C09E 5DK0A 5I1HH 3D06A 1U8CB 1WA1X 3ENEA 2VC2L 2ICEC 2AXFA 4Y8DC 5CN2A 1AQ8A 2LU5A 3BQUB 1KG0A 1SHMA 4KY1H 4X7DC 1DQLH 1QLRA 1HXMA 4BXVA 3STLB 3B7YA 4M29A 1U8KA 5ITFA 3FZUD 5IGXL 2WY3B 1ZLVK 1IM3D 3BIKB 4PG9A 4AQ1A 2F8XC 4PIRF 2IAMD 3GSUB 3K5RA 3M17A 4JDZB 1IAOA 3S37H 5IQ7L 1SJEA 2VISA 2AVGA 5EUOE 2PTUA 3SKOB 1YEHL 1ZVNA 1DYZA 3TFKC 4UNTA 3REWB 2YAPA 3NRQA 4KVPA 4OSUL 5HBBA 4RZKA 1A9BB 4GB9A 1A8ZA 1DQMH 1OAUH 1OT1A 2EVHA 2EDWA 3S3CB 5L88L 2XYCA 1EO7A 1MFCL 1QG3A 2BS9A 5C6WH 2GITA 3FT4B 3AB0C 3EJYC 5TK4A 3LH8A 3BVVA 4NO3B 2JJVA 1LMKA 3VACA 1JNHA 2X44D 3UEQA 3GI8H 3ORJA 4FX5A 4NZTH 4GW5B 5ID0A 4E0RB 2QGDA 3DK0A 5GS1A 3NAAH 4DF9A 2IANB 3N44B 4ZXBD 1MFBH 4ANWA 1H3PL 1OSYA 2B5IB 5CJOL 3W82A 3IAQA 4OGXL 4GXUM 5DK2A 2YD7A 4LO9A 1JZDC 4Z7NE 4X4ME 1I7UB 1OOWA 1J8HB 3V55A 1D7BA 3HG3A 3OKEA 3ATBA 4AZ8B 5CD3A 4F57L 3EOAB 1TU2A 2CH8A 5L2KA 3QCUH 5E8OA 3EGXB 2A2QT 1IGML 5I0WA 3EH4B 4H0HB 4WU5B 4E9RA 2Y7OA 3MRFA 3R18A 3ABKB 5FUZH 2X4QA 2O5ZH 2OTUB 2WLMA 5LQBL 4R4ND 3GGWA 4ACPA 2YK1L 4Z23A 3CU7A 3ZTNH 3CAFA 2VXQL 1RK0B 1TTFA 4G6AD 1Q9KA 5JOPD 1EBPA 1IGCH 2BS8A 3QNZB 4G7SB 5I0YA 5HJ3B 2GJ6A 1KB9K 3IFLH 3TBYB 5K1JA 4HUXB 5MEPA 4QGTA 3QZPA 1XQ4A 3V5KB 3HR6A 2OMWA 5CBAA 1SJVA 2WMPB 1SM3H 5H94A 1KJVB 1IGYA 5GGQH 5I82A 2ZCLL 4EDWH 1IIKA 1NCDH 1MHCB 5MEOB 1ADWA 2ZNWA 3A4DA 5GSRA 4PRPB 2ZSVA 4JDEA 3MBXH 1DLFL 1EH9A 4WHYG 5C7XL 1O5DT 1PZ5B 1QPPA 2AERT 3OKNB 4IK6A 1FGNL 4X7SL 2D73A 1R4XA 5CZKA 4M03A 1L7TL 4LLVB 5K9QI 1VB9A 4X80L 2EVIA 3KDPB 3HMXL 2HG5A 2BP0A 2GC4C 2AC0A 4O02B 5LO7A 4FAAB 2H8PA 3IVKB 2E6QA 2VLRE 1A6AA 4N22A 2Z35B 2ZYIA 4U0QB 4G83A 4XXWA 2PCFA 3PRZA 1URIA 3KYOB 2ERJB 3FUMA 2WUBL 3EJZC 3FDWA 3VRLF 2A0LD 1V3LA 5BRZB 1TCMA 4BCXA 3EJCA 1O7DC 4DGUA 5CILH 3HN8A 1OQXA 4RAUA 3BZFA 4TNEA 2AJ3B 4GXVH 4U0RB 5BUPA 4RA3A 3TO4A 5DT1H 3U36B 1QMUA 2EDEA 5DUML 4H2CA 3NSJA 2VO5A 4G43A 5T3XE 1HN1A 5ES4B 4H8UA 4UQ9A 4X5RA 4HWUA 1B4TA 4EUPB 3FOMB 2BW5A 2QQKH 2WB1A 5J8OA 1Q9WB 5ENWA 4LKCA 1JXGA 3B5GA 4OCRL 1EMTL 3R0MA 4L8BB 5EIVA 2KZBA 5HPMA 4P5TC 3CVCA 1P84J 1J18A 1XGTA 3GS7A 4HFWA 1ZHKA 4TN9A 3F7RA 3ZDYE 5ALCL 2P80A 1G7PA 5BZZA 1ES0A 5CGYC 4P23C 4WTWA 3BI9X 5KSBB 32C2B 1J0JA 4PJIE 4R5VA 5HI5D 4KKPA 1J1XL 4MASA 3F6LA 4Y1TA 4E5XB 3VFTA 2ZZUT 4LU5L 1XGYH 4JN1L 3SOBH 5BO0D 2GYSA 2FR4A 2PXYB 4KV5E 4KKBD 2YPLB 4EF3A 1QABA 3ARDB 4JQXA 1YEEH 5I8CA 1B3JA 4U1IA 3H2PA 2NYZA 4QRRE 1PU0A 2LLNA 3QEQE 2DH2A 1NKOA 3T2OA 3QUXD 1N5AA 2D0HA 1A0QH 5FA3B 1R3HA 2BCMA 4YOKA 2BIPA 3MVSA 4AZUA 5HDOA 3SDAC 4BDVB 1C5BH 5F7EL 2O6EA 2GJRA 3WTWA 4P5RA 1DCEA 1DHKA 5AZ2H 2FX9L 3PE9A 1A7PH 2YXWA 2XOTA 1UVQB 3WI9A 1VESA 3C6SA 4AM0A 4JFHD 4XP1L 4Y19E 1RZIA 4K2UL 3DYMA 3NGBC 5DHVA 1R46A 2WC7A 5C08E 2E4FA 3F7QA 5B8CB 1CFSB 4ZQKB 4CC0A 2QHRL 1BSIA 3E9TA 5FUOL 2XFXB 4F7EA 2EDKA 4HJSA 4RZCB 3GUFA 3UBHA 1QNZL 4G8GE 4Z3HA 1DBBH 5EIIB 3CHPA 1QYGL 4HHAA 1N6UA 2EQDA 4WDIA 4KPHL 3H3PH 3S5ZA 2EIBA 2ITEA 5E8NA 3X2QB 1KCKA 4O2EA 3SO3B 4RDBA 5JXEC 2H41A 5JW4Q 1BIIA 2A6JA 2IH1A 4OCXH 3KLHD 3N91A 3GSNL 3ZE1B 1H8SA 4O4YH 2CDFA 1S7XA 1AS6A 5CFAA 2BMKA 1GS8A 3RY6A 4AQEA 4ODTH 2X53A 3CH1B 3BYTA 2ESVA 1Q0YH 3QULB 4UZUA 2Y5QA 4XI5C 4UYQA 1RJYB 5AVRB 2F61A 1YNKH 2GEEA 1UXSB 1VFMA 4N0UB 4M7LH 4CN4A 1ASQA 1NFKA 2B9BA 3BP4B 3B6SA 2YQGA 2ZICA 2X7LB 4MJ2A 4ALAH 1DVQA 3CPLA 4PJBB 3ZKMD 3IJSA 3BZ5A 4N2FA 1T5KA 5AD0A 4YNYA 3D8MA 4UI2A 4KZDL 4YAQB 3HG1B 2WO3B 1OAYL 1TVHB 1AGCB 1TIUA 4HSCX 3BT2H 1G7MB 3EF4A 2DEWX 4LVEA 4TS6A 2AVFA 2P5WD 2X42A 4L9LC 4GRWE 5F7WC 6PCYA 1CDJA 3QISA 3PGFL 3LEYH 1AS7A 5E2VL 4UTAH 2BXYA 5D8JH 2VDOB 4JW3A 5CN1A 5JPNB 2ENYA 1A7NH 2XQBL 2ZYRA 4YDKH 4LZKA 1XSIA 5EOCJ 3OWRA 4P2CG 2BP3A 1INQA 4HIXL 3BWUC 2L3BA 4TQHA 1E4XH 3NZSA 4K71B 4RIRA 5ACMA 5A2CA 5KANI 4WEUD 1J1PH 1YEIL 5KUKA 1WISA 2D03L 4RFOH 1AS8A 3G5YB 1OARL 2FO4B 1XSKA 1EO5A 2GC7C 4GT7A 4EJ1C 2X3BA 3OHXB 5HHNB 2GTWA 2VTFA 4U1HB 5SWQA 2EP6A 3TOPA 2XN9E 3HRZA 3HC0A 4ODVH 5K1VA 4C47A 4NM8H 1JNLH 2RFXA 2X6AA 3GUTA 1D5XA 5GZOA 2ZUWA 1MH5B 4K5MA 3B37A 4S1DC 1RHHA 2VH5H 1JNNH 4MQ7B 5J11B 3PWVB 1PDKB 1YEFL 3GINA 1IU1A 1FQ9C 3FH8A 2HB0A 3J2PA 1X4ZA 1A3QA 4A2LA 5ABDE 1U8QA 2PPCA 3DMMB 5CJBA 3LQZB 2CIIA 1AQKL 1CU4H 1DVFD 3L5XL 4HA1A 4Y2DB 3ZR6A 2V7NA 2O61B 2MKWA 1FP5A 3EO0A 2FJHA 3OXSB 4RMBA 3ZRFC 5AZUA 4JNXA 2ORBH 4N2LA 4K8RC 4GJTB 4BFEA 5AUMB 3UJIH 5AG8A 4ZYKB 2O5XH 1X5MA 4H0GA 2VLKD 3QZMA 5CINL 1CTMA 1URZA 4PR5B 3B56A 1IAKA 2X87A 3Q6FA 3R1GL 4JFXB 3RTQA 3TBVB 1MJUL 2OMXA 2VLLA 1JZ2A 3L7EB 5C70A 1IKOP 2GAZB 2WSPA 3IBOA 4H13C 3HAEB 4G8FB 4GINA 1ZHLB 2X0VA 5IHBA 3O6FD 2H26B 5CP7B 1TSRA 4JO2H 3LKOA 4ZZKA 4AIXA 5E9DA 4KJYA 3P3YA 2QTEA 5I74B 3MRBA 1JUFA 4K4KA 5E2TL 43CAB 4Z0XA 4X5XA 2KPNA 2VDNB 2Q3ZA 4Y9EA 4PJHF 2AABL 3MRLA 1I8MA 2X4NA 3U4EB 3TPKA 5J5EA 1E4JA 3GK8L 2QEJA 3UBXA 4K5NA 2BIHA 3QIUA 3VVWA 5CCKH 3IB4A 1WA2X 4OJEH 2CJUH 3U46A 2N56A 3QZOA 4POYA 3ZL1A 4LQFH 2F18A 3UERA 1QNIA 1ZS8B 3UTTE 1RY7B 1U8HA</