7PRNA

E1m, d97a, e99a mutant of rh. blastica porin
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
289
structure length
289
Chain Sequence
MISLNGYGRFGLQYVEDRGVGLEDTIISSRLRINIVGTTETDQGVTFGAKLRMQWDDGDAFAGTAGNAAQFWTSYNGVTVSVGNVDTAFDSVALTYASAMGYEASSFGDAQSSFFAYNSKYDASGALDNYNGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAAYTTDAGGIVDNDIAFVGAAYKFNDAGTVGLNWYDNGLSTAGDQVTLYGNYAFGATTVRAYVSDIDRAGADTAYGIGADYQFAEGVKVSGSVQSGFANETVADVGVRFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORIN
publication title Porin mutants with new channel properties.
pubmed rcsb
source organism Rhodobacter blasticus
molecule tags Membrane protein
total genus 73
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 1998-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 7prnA00
3POUA 4FOZA 3UU2A 2XE5A 3VY8X 2PRNA 3HWBA 4FSOA 1MPFA 4KR4A 3T20A 3VZWX 2FGRA 4RJXA 4LSEA 1GFOA 3VZUX 2ZLDA 3POXA 3SZVA 1GFMA 2Y0LA 4LSHA 7PRNA 1H6S1 1PRNA 3K19A 3T24A 1HXTA 1GFPA 1HXUA 2ODJA 4GCSA 4FSPA 2PORA 4LSFA 1E54A 4JFBA 5DL5A 4GCQA 2XE2A 6PRNA 2K4TA 1OPFA 1HXXA 4FMSA 3O0EA 4FRXA 2XG6A 4KR8A 5JDPA 2Y2XA 3SYBA 3T0SA 3VY9X 1OSMA 4BUMX 3SZDA 1GFNA 3UPGA 4GCPA 5DL7A 3FYXA 2QTKA 4RJWA 5FVNA 5DL8A 4FRTA 3PORA 4C69X 4D5UA 4D65A 1BT9A 4LSIA 1BH3A 2Y0KA 5DL6A 3WI5A 2OMFA 3HW9A 2O4VA 2ZFGA 3WI4A 4AUIA 3POQA 1GFQA 2XE3A 2J4UP 2Y0HA 3VZTX 2XE1A 3EMNX 4D64A 3JTYA 3A2SX 2J1NA 8PRNA 3SY9A 4KRAA 3SY7A 3PRNA 5PRNA 2FGQX 3NSGA 4FT6A 3SYSA 1PHOA
chains in the Genus database with same CATH superfamily
3POUA 4AZLA 3PGUA 2J4UP 1ZHWA 2XTQA 4FOZA 3UU2A 4QQ1A 2XE5A 3QRCA 2KZ7A 4RLCA 1MM4A 1ZHZA 3VY8X 3KZIO 1QJ9A 2PRNA 3AA7B 1MPFA 3G7GA 3HWBA 4FSOA 4Z3TA 4KR4A 4O3XB 5E79O 2Y7SA 4JCHA 5D5DA 5KAFO 5TISO 3T20A 3DZMA 4K3BA 2FGRA 3DA3A 3VZWX 2R4NA 4RJXA 4G75A 4LSEA 3VE2A 1GFOA 3VZUX 4N58A 1T16A 2ZLDA 3POXA 4FUVA 3SZVA 5ADXK 1GFMA 5H2FO 2Y0LA 4LSHA 4PR7A 1ZHYA 5GTIO 1H6S1 3DWNA 4U9CA 4AYID 7PRNA 5ADXL 2LFUA 2R8AA 3PQUA 1PRNA 3K19A 4FQEA 3LK3A 3DA4A 3T24A 1T1LA 3TZGA 5AFUK 1G90A 1HXTA 5KAIO 1GFPA 4AYEC 4CTDA 1HXUA 1MM5A 2ODJA 4GCSA 4PJ0O 4AYNA 2PORA 4FSPA 5G26A 2KZ7B 1E54A 2KXPA 4LSFA 4JFBA 5DL5A 3BS0A 3UAQA 2W81C 2M07A 4GCQA 1YS5A 2XE2A 3NJTA 3HOLA 6PRNA 4FZLA 2K4TA 1OPFA 1HXXA 3AA6B 4FMSA 4FZNA 3O0EA 4FRXA 2K0LA 2WJRA 2XG6A 4KR8A 3AA6A 1P4TA 3LK2B 3JCUO 3PGRA 2W80C 2X27X 2YNKA 2YPVA 3AAEB 5JDPA 2AXTO 2Y2XA 3LK3B 4PUXA 3SYBA 3T0SA 1OSMA 3LK2A 3KVDD 3VY9X 4AKMA 4AKRB 3AAEA 4C00A 3BRYA 5G38A 5B66O 2MHLA 3V8UA 2KXPB 2X9KA 4AKRA 5AFUL 4O3WA 4BUMX 2GE4A 3SZDA 2WJQA 3DWOX 3PQSA 5B5EO 1GFNA 3UPGA 2XMXA 3LK41 4GCPA 4GF4A 3FYXA 5DL7A 2QTKA 4RJWA 4XNKA 3LK42 5FVNA 3A0BO 5DL8A 4FRTA 3PORA 4C69X 4D5UA 4D65A 1Q9GA 4F4BA 5GV0A 1BT9A 4LSIA 2IWVA 2IWWA 1IZNA 1BH3A 2Y0KA 3PGSA 5DL6A 4E1SA 1QJPA 3WI5A 2LHFA 4AFKA 2OMFA 3HW9A 2R88A 4IL6O 4RLBA 4FESA 2N2LA 2O4VA 2ZFGA 4O3YA 4N59A 3WI4A 4AUIA 2R4LA 3POQA 1QJ8A 3AA1A 3QRAA 4UB8O 4C4VA 1GFQA 2XE3A 4GHBA 3AAAB 1ZHTA 2F1TA 2XTRA 2XE1A 2ERVA 2Y0HA 3EMNX 3VZTX 1Q9FA 4D64A 1THQA 2F1VA 3JTYA 4K3CA 4O49A 3A2SX 5T5FA 2R4PA 3AAAA 3BRZA 3GP6A 5G39A 3RBHA 2J1NA 2F1CX 2JMMA 4AYDC 8PRNA 1IZNB 3AA7A 3SY9A 4UB6O 4RL9A 3VE1A 4KRAA 4E1TA 2JQYA 4G76A 2MNHA 1ZHXA 2R89A 3C5OA 3PRNA 4FZMA 3SY7A 2N2MA 4B61A 5GTHO 5IYUA 2R4OA 3A0HO 4O4UA 2KC0A 5EE2A 5PRNA 4AYMC 4N74A 4N75A 2M06A 2KDYA 3AA1B 4C4VB 5G3AA 3AA0B 1S5LO 1BXWA 4XNLA 2FGQX 3NSGA 3WU2O 1ORMA 3HOEA 4O4XA 4FT6A 4O3ZA 3AA0A 3SYSA 1PHOA 2WVPA 3PF1A
chains in the Genus database with same CATH topology
3POUA 4AZLA 2J4UP 1ZHWA 2XTQA 4FOZA 3UU2A 4QQ1A 2XE5A 3QRCA 2KZ7A 4RLCA 1MM4A 1ZHZA 3VY8X 1QJ9A 2PRNA 3AA7B 1MPFA 3G7GA 3HWBA 4FSOA 4Z3TA 4KR4A 4O3XB 3T20A 2Y7SA 4JCHA 5D5DA 3VZWX 2FGRA 3DA3A 4RJXA 4G75A 4LSEA 3VE2A 1GFOA 3VZUX 4N58A 2ZLDA 3POXA 4FUVA 3SZVA 5ADXK 1GFMA 2Y0LA 4LSHA 1ZHYA 7PRNA 1H6S1 5ADXL 4U9CA 4AYID 2LFUA 3PQUA 1PRNA 3K19A 3LK3A 3DA4A 3T24A 3TZGA 5AFUK 1G90A 1HXTA 1GFPA 4AYEC 1HXUA 1MM5A 2ODJA 4GCSA 4AYNA 2PORA 4FSPA 5G26A 2KZ7B 1E54A 2KXPA 4LSFA 4JFBA 5DL5A 3UAQA 2W81C 2M07A 4GCQA 1YS5A 2XE2A 3HOLA 6PRNA 4FZLA 2K4TA 1OPFA 1HXXA 3AA6B 4FMSA 4FZNA 3O0EA 4FRXA 2K0LA 2XG6A 4KR8A 3AA6A 1P4TA 3LK2B 2W80C 2X27X 2YNKA 2YPVA 3AAEB 5JDPA 2Y2XA 3LK3B 4PUXA 3SYBA 3T0SA 1OSMA 3LK2A 3KVDD 3VY9X 4AKMA 4AKRB 3AAEA 2MHLA 3V8UA 2KXPB 4AKRA 5AFUL 4O3WA 4BUMX 2GE4A 3SZDA 3PQSA 1GFNA 3UPGA 2XMXA 3LK41 4GCPA 5DL7A 3FYXA 2QTKA 4RJWA 4XNKA 3LK42 5FVNA 5DL8A 4FRTA 3PORA 4C69X 4D5UA 4D65A 1Q9GA 4F4BA 5GV0A 1BT9A 4LSIA 1IZNA 1BH3A 2Y0KA 5DL6A 4E1SA 1QJPA 3WI5A 2LHFA 4AFKA 2OMFA 3HW9A 4RLBA 4FESA 2N2LA 2O4VA 2ZFGA 4O3YA 4N59A 3WI4A 4AUIA 3POQA 1QJ8A 3AA1A 3QRAA 1GFQA 2XE3A 4GHBA 3AAAB 1ZHTA 2F1TA 2XTRA 2XE1A 2ERVA 2Y0HA 3EMNX 3VZTX 1Q9FA 4D64A 1THQA 2F1VA 3JTYA 4O49A 5T5FA 3A2SX 3AAAA 3GP6A 3RBHA 2J1NA 2JMMA 4AYDC 8PRNA 1IZNB 3AA7A 3SY9A 4RL9A 3VE1A 4KRAA 4E1TA 4G76A 2MNHA 1ZHXA 3SY7A 3C5OA 3PRNA 4FZMA 5IYUA 2N2MA 4B61A 4O4UA 2KC0A 5EE2A 5PRNA 4AYMC 2M06A 2KDYA 3AA1B 3AA0B 4XNLA 1BXWA 2FGQX 3NSGA 1ORMA 3HOEA 4O4XA 4FT6A 4O3ZA 3AA0A 3SYSA 1PHOA 4GF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3POU A;  4FOZ A;  3UU2 A;  2XE5 A;  3VY8 X;  2PRN A;  3HWB A;  4FSO A;  1MPF A;  4KR4 A;  3T20 A;  3VZW X;  2FGR A;  4RJX A;  4LSE A;  1GFO A;  3VZU X;  2ZLD A;  3POX A;  3SZV A;  1GFM A;  2Y0L A;  4LSH A;  7PRN A;  1H6S 1;  1PRN A;  3K19 A;  3T24 A;  1HXT A;  1GFP A;  1HXU A;  2ODJ A;  4GCS A;  4FSP A;  2POR A;  4LSF A;  1E54 A;  4JFB A;  5DL5 A;  4GCQ A;  2XE2 A;  6PRN A;  2K4T A;  1OPF A;  1HXX A;  4FMS A;  3O0E A;  4FRX A;  2XG6 A;  4KR8 A;  5JDP A;  2Y2X A;  3SYB A;  3T0S A;  3VY9 X;  1OSM A;  4BUM X;  3SZD A;  1GFN A;  3UPG A;  4GCP A;  5DL7 A;  3FYX A;  2QTK A;  4RJW A;  5FVN A;  5DL8 A;  4FRT A;  3POR A;  4C69 X;  4D5U A;  4D65 A;  1BT9 A;  4LSI A;  1BH3 A;  2Y0K A;  5DL6 A;  3WI5 A;  2OMF A;  3HW9 A;  2O4V A;  2ZFG A;  3WI4 A;  4AUI A;  3POQ A;  1GFQ A;  2XE3 A;  2J4U P;  2Y0H A;  3VZT X;  2XE1 A;  3EMN X;  4D64 A;  3JTY A;  3A2S X;  2J1N A;  8PRN A;  3SY9 A;  4KRA A;  3SY7 A;  3PRN A;  5PRN A;  2FGQ X;  3NSG A;  4FT6 A;  3SYS A;  1PHO A; 
#chains in the Genus database with same CATH topology
 3POU A;  4AZL A;  3PGU A;  2J4U P;  1ZHW A;  2XTQ A;  4FOZ A;  3UU2 A;  4QQ1 A;  2XE5 A;  3QRC A;  2KZ7 A;  4RLC A;  1MM4 A;  1ZHZ A;  3VY8 X;  3KZI O;  1QJ9 A;  2PRN A;  3AA7 B;  1MPF A;  3G7G A;  3HWB A;  4FSO A;  4Z3T A;  4KR4 A;  4O3X B;  5E79 O;  2Y7S A;  4JCH A;  5D5D A;  5KAF O;  5TIS O;  3T20 A;  3DZM A;  4K3B A;  2FGR A;  3DA3 A;  3VZW X;  2R4N A;  4RJX A;  4G75 A;  4LSE A;  3VE2 A;  1GFO A;  3VZU X;  4N58 A;  1T16 A;  2ZLD A;  3POX A;  4FUV A;  3SZV A;  5ADX K;  1GFM A;  5H2F O;  2Y0L A;  4LSH A;  4PR7 A;  1ZHY A;  5GTI O;  1H6S 1;  3DWN A;  4U9C A;  4AYI D;  7PRN A;  5ADX L;  2LFU A;  2R8A A;  3PQU A;  1PRN A;  3K19 A;  4FQE A;  3LK3 A;  3DA4 A;  3T24 A;  1T1L A;  3TZG A;  5AFU K;  1G90 A;  1HXT A;  5KAI O;  1GFP A;  4AYE C;  4CTD A;  1HXU A;  1MM5 A;  2ODJ A;  4GCS A;  4PJ0 O;  4AYN A;  2POR A;  4FSP A;  5G26 A;  2KZ7 B;  1E54 A;  2KXP A;  4LSF A;  4JFB A;  5DL5 A;  3BS0 A;  3UAQ A;  2W81 C;  2M07 A;  4GCQ A;  1YS5 A;  2XE2 A;  3NJT A;  3HOL A;  6PRN A;  4FZL A;  2K4T A;  1OPF A;  1HXX A;  3AA6 B;  4FMS A;  4FZN A;  3O0E A;  4FRX A;  2K0L A;  2WJR A;  2XG6 A;  4KR8 A;  3AA6 A;  1P4T A;  3LK2 B;  3JCU O;  3PGR A;  2W80 C;  2X27 X;  2YNK A;  2YPV A;  3AAE B;  5JDP A;  2AXT O;  2Y2X A;  3LK3 B;  4PUX A;  3SYB A;  3T0S A;  1OSM A;  3LK2 A;  3KVD D;  3VY9 X;  4AKM A;  4AKR B;  3AAE A;  4C00 A;  3BRY A;  5G38 A;  5B66 O;  2MHL A;  3V8U A;  2KXP B;  2X9K A;  4AKR A;  5AFU L;  4O3W A;  4BUM X;  2GE4 A;  3SZD A;  2WJQ A;  3DWO X;  3PQS A;  5B5E O;  1GFN A;  3UPG A;  2XMX A;  3LK4 1;  4GCP A;  4GF4 A;  3FYX A;  5DL7 A;  2QTK A;  4RJW A;  4XNK A;  3LK4 2;  5FVN A;  3A0B O;  5DL8 A;  4FRT A;  3POR A;  4C69 X;  4D5U A;  4D65 A;  1Q9G A;  4F4B A;  5GV0 A;  1BT9 A;  4LSI A;  2IWV A;  2IWW A;  1IZN A;  1BH3 A;  2Y0K A;  3PGS A;  5DL6 A;  4E1S A;  1QJP A;  3WI5 A;  2LHF A;  4AFK A;  2OMF A;  3HW9 A;  2R88 A;  4IL6 O;  4RLB A;  4FES A;  2N2L A;  2O4V A;  2ZFG A;  4O3Y A;  4N59 A;  3WI4 A;  4AUI A;  2R4L A;  3POQ A;  1QJ8 A;  3AA1 A;  3QRA A;  4UB8 O;  4C4V A;  1GFQ A;  2XE3 A;  4GHB A;  3AAA B;  1ZHT A;  2F1T A;  2XTR A;  2XE1 A;  2ERV A;  2Y0H A;  3EMN X;  3VZT X;  1Q9F A;  4D64 A;  1THQ A;  2F1V A;  3JTY A;  4K3C A;  4O49 A;  3A2S X;  5T5F A;  2R4P A;  3AAA A;  3BRZ A;  3GP6 A;  5G39 A;  3RBH A;  2J1N A;  2F1C X;  2JMM A;  4AYD C;  8PRN A;  1IZN B;  3AA7 A;  3SY9 A;  4UB6 O;  4RL9 A;  3VE1 A;  4KRA A;  4E1T A;  2JQY A;  4G76 A;  2MNH A;  1ZHX A;  2R89 A;  3C5O A;  3PRN A;  4FZM A;  3SY7 A;  2N2M A;  4B61 A;  5GTH O;  5IYU A;  2R4O A;  3A0H O;  4O4U A;  2KC0 A;  5EE2 A;  5PRN A;  4AYM C;  4N74 A;  4N75 A;  2M06 A;  2KDY A;  3AA1 B;  4C4V B;  5G3A A;  3AA0 B;  1S5L O;  1BXW A;  4XNL A;  2FGQ X;  3NSG A;  3WU2 O;  1ORM A;  3HOE A;  4O4X A;  4FT6 A;  4O3Z A;  3AA0 A;  3SYS A;  1PHO A;  2WVP A;  3PF1 A; 
#chains in the Genus database with same CATH homology
 3POU A;  4AZL A;  2J4U P;  1ZHW A;  2XTQ A;  4FOZ A;  3UU2 A;  4QQ1 A;  2XE5 A;  3QRC A;  2KZ7 A;  4RLC A;  1MM4 A;  1ZHZ A;  3VY8 X;  1QJ9 A;  2PRN A;  3AA7 B;  1MPF A;  3G7G A;  3HWB A;  4FSO A;  4Z3T A;  4KR4 A;  4O3X B;  3T20 A;  2Y7S A;  4JCH A;  5D5D A;  3VZW X;  2FGR A;  3DA3 A;  4RJX A;  4G75 A;  4LSE A;  3VE2 A;  1GFO A;  3VZU X;  4N58 A;  2ZLD A;  3POX A;  4FUV A;  3SZV A;  5ADX K;  1GFM A;  2Y0L A;  4LSH A;  1ZHY A;  7PRN A;  1H6S 1;  5ADX L;  4U9C A;  4AYI D;  2LFU A;  3PQU A;  1PRN A;  3K19 A;  3LK3 A;  3DA4 A;  3T24 A;  3TZG A;  5AFU K;  1G90 A;  1HXT A;  1GFP A;  4AYE C;  1HXU A;  1MM5 A;  2ODJ A;  4GCS A;  4AYN A;  2POR A;  4FSP A;  5G26 A;  2KZ7 B;  1E54 A;  2KXP A;  4LSF A;  4JFB A;  5DL5 A;  3UAQ A;  2W81 C;  2M07 A;  4GCQ A;  1YS5 A;  2XE2 A;  3HOL A;  6PRN A;  4FZL A;  2K4T A;  1OPF A;  1HXX A;  3AA6 B;  4FMS A;  4FZN A;  3O0E A;  4FRX A;  2K0L A;  2XG6 A;  4KR8 A;  3AA6 A;  1P4T A;  3LK2 B;  2W80 C;  2X27 X;  2YNK A;  2YPV A;  3AAE B;  5JDP A;  2Y2X A;  3LK3 B;  4PUX A;  3SYB A;  3T0S A;  1OSM A;  3LK2 A;  3KVD D;  3VY9 X;  4AKM A;  4AKR B;  3AAE A;  2MHL A;  3V8U A;  2KXP B;  4AKR A;  5AFU L;  4O3W A;  4BUM X;  2GE4 A;  3SZD A;  3PQS A;  1GFN A;  3UPG A;  2XMX A;  3LK4 1;  4GCP A;  5DL7 A;  3FYX A;  2QTK A;  4RJW A;  4XNK A;  3LK4 2;  5FVN A;  5DL8 A;  4FRT A;  3POR A;  4C69 X;  4D5U A;  4D65 A;  1Q9G A;  4F4B A;  5GV0 A;  1BT9 A;  4LSI A;  1IZN A;  1BH3 A;  2Y0K A;  5DL6 A;  4E1S A;  1QJP A;  3WI5 A;  2LHF A;  4AFK A;  2OMF A;  3HW9 A;  4RLB A;  4FES A;  2N2L A;  2O4V A;  2ZFG A;  4O3Y A;  4N59 A;  3WI4 A;  4AUI A;  3POQ A;  1QJ8 A;  3AA1 A;  3QRA A;  1GFQ A;  2XE3 A;  4GHB A;  3AAA B;  1ZHT A;  2F1T A;  2XTR A;  2XE1 A;  2ERV A;  2Y0H A;  3EMN X;  3VZT X;  1Q9F A;  4D64 A;  1THQ A;  2F1V A;  3JTY A;  4O49 A;  5T5F A;  3A2S X;  3AAA A;  3GP6 A;  3RBH A;  2J1N A;  2JMM A;  4AYD C;  8PRN A;  1IZN B;  3AA7 A;  3SY9 A;  4RL9 A;  3VE1 A;  4KRA A;  4E1T A;  4G76 A;  2MNH A;  1ZHX A;  3SY7 A;  3C5O A;  3PRN A;  4FZM A;  5IYU A;  2N2M A;  4B61 A;  4O4U A;  2KC0 A;  5EE2 A;  5PRN A;  4AYM C;  2M06 A;  2KDY A;  3AA1 B;  3AA0 B;  4XNL A;  1BXW A;  2FGQ X;  3NSG A;  1ORM A;  3HOE A;  4O4X A;  4FT6 A;  4O3Z A;  3AA0 A;  3SYS A;  1PHO A;  4GF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...