7PRNA

E1m, d97a, e99a mutant of rh. blastica porin
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
289
structure length
289
Chain Sequence
b'MISLNGYGRFGLQYVEDRGVGLEDTIISSRLRINIVGTTETDQGVTFGAKLRMQWDDGDAFAGTAGNAAQFWTSYNGVTVSVGNVDTAFDSVALTYASAMGYEASSFGDAQSSFFAYNSKYDASGALDNYNGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAAYTTDAGGIVDNDIAFVGAAYKFNDAGTVGLNWYDNGLSTAGDQVTLYGNYAFGATTVRAYVSDIDRAGADTAYGIGADYQFAEGVKVSGSVQSGFANETVADVGVRFDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORIN
publication title Porin mutants with new channel properties.
pubmed rcsb
source organism Rhodobacter blasticus
molecule tags Membrane protein
total genus 73
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 1998-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 7prnA00
4RJXA 4D64A 2FGRA 4GCPA 2Y2XA 2XE5A 1GFPA 1HXTA 3SZVA 4FSOA 4JFBA 3WI4A 2Y0HA 3T0SA 1HXXA 2XG6A 3POQA 4GCQA 2ODJA 4LSEA 5JDPA 2FGQX 3SY7A 3SYBA 3A2SX 3VZWX 3HW9A 3O0EA 4GCSA 4FRTA 3EMNX 1OPFA 3HWBA 3T24A 4C69X 5DL7A 1H6S1 3SZDA 1MPFA 3SYSA 4D65A 4LSHA 5PRNA 1BT9A 2Y0LA 3UU2A 2ZFGA 1GFQA 4RJWA 1GFNA 1PRNA 2O4VA 3JTYA 8PRNA 4FOZA 3POXA 5DL8A 1GFMA 3PRNA 5DL5A 4FT6A 3WI5A 5FVNA 3SY9A 4KR8A 3VY8X 2PRNA 2K4TA 2OMFA 6PRNA 1HXUA 1E54A 2XE2A 3PORA 4AUIA 2Y0KA 4LSIA 3VZUX 4BUMX 3VY9X 3UPGA 4KRAA 1GFOA 3POUA 4FSPA 7PRNA 2J1NA 4D5UA 1BH3A 1PHOA 2J4UP 3K19A 4FRXA 3VZTX 2PORA 3FYXA 3T20A 4FMSA 2XE1A 5DL6A 2ZLDA 4KR4A 2QTKA 3NSGA 1OSMA 2XE3A 4LSFA
chains in the Genus database with same CATH superfamily
3AA6A 2IWWA 2R4LA 4RJXA 4E1TA 4D64A 3DWNA 2F1TA 2FGRA 4GCPA 3AAAB 3DZMA 4AZLA 3UAQA 2W81C 2Y2XA 2K0LA 2XE5A 1GFPA 1HXTA 3AAEA 3HOLA 3LK42 4AYNA 5GV0A 1MM4A 4N74A 2XMXA 3AA1B 3SZVA 4FSOA 4JFBA 1Q9FA 3AA0B 3WI4A 3G7GA 3VE1A 5KAFO 1QJ8A 2Y0HA 3T0SA 3BRYA 1HXXA 3QRCA 2XG6A 4IL6O 3VE2A 2W80C 3GP6A 3POQA 2ERVA 2ODJA 4GCQA 4B61A 2KXPA 2M07A 4LSEA 3RBHA 4U9CA 2F1VA 4C4VA 3DWOX 4PUXA 2R8AA 4C00A 3LK41 4RL9A 5JDPA 3KZIO 1ZHYA 2FGQX 1IZNB 4O3XB 4FQEA 2KZ7B 4AYDC 3SY7A 3SYBA 4N58A 2F1CX 3A2SX 3HW9A 2R89A 3O0EA 4FRTA 1P4TA 2WVPA 2X9KA 3LK3A 4GCSA 5EE2A 3EMNX 4AFKA 1OPFA 3HWBA 4N59A 4JCHA 5G26A 2WJRA 3T24A 1MM5A 1T16A 3PF1A 5DL7A 4C69X 5G3AA 3A0HO 3AA6B 2MNHA 1H6S1 1ZHWA 4FESA 4RLBA 3DA3A 1MPFA 1BXWA 3SYSA 2LHFA 4FZNA 3SZDA 4D65A 4AKRB 3WU2O 2JMMA 4LSHA 4UB8O 5IYUA 5PRNA 1ZHTA 2N2LA 1BT9A 1ORMA 2Y0LA 2WJQA 3UU2A 5ADXL 2X27X 2ZFGA 4QQ1A 4Z3TA 1GFQA 4RJWA 1GFNA 5B5EO 1PRNA 2O4VA 3AA7A 3JCUO 2R4NA 2MHLA 5B66O 5GTHO 3JTYA 4UB6O 4XNLA 5AFUL 4O4XA 2KXPB 4O3YA 8PRNA 4C4VB 2R4OA 4FOZA 4FUVA 3PQUA 3POXA 4CTDA 3LK2B 2KC0A 2YPVA 4O3WA 5D5DA 1GFMA 1QJ9A 3PRNA 5DL5A 1ZHZA 5DL8A 5G39A 4FT6A 4GF4A 3WI5A 4AYEC 4PR7A 2IWVA 4K3CA 2LFUA 4O49A 5FVNA 4G76A 3SY9A 3PGRA 5AFUK 3HOEA 2KDYA 4KR8A 3VY8X 5G38A 4F4BA 2PRNA 3AAAA 4G75A 3AAEB 2K4TA 3PGUA 2OMFA 4AKMA 6PRNA 1HXUA 5KAIO 1E54A 2XE2A 3PORA 1Q9GA 2R88A 3AA1A 2Y0KA 3BS0A 3TZGA 4AUIA 2AXTO 4LSIA 3VZUX 2GE4A 2R4PA 3AA0A 3A0BO 1THQA 4BUMX 1YS5A 3VY9X 4O3ZA 3VZWX 4AKRA 4PJ0O 1T1LA 3C5OA 3V8UA 4RLCA 3UPGA 4KRAA 1GFOA 3POUA 3QRAA 4FSPA 7PRNA 5ADXK 3BRZA 2J1NA 4D5UA 1BH3A 1PHOA 2J4UP 5TISO 4AYID 4FZMA 4AYMC 1G90A 3KVDD 3AA7B 2XTQA 3K19A 3NJTA 4FRXA 3VZTX 4FZLA 4XNKA 2YNKA 4GHBA 1IZNA 2KZ7A 2Y7SA 4N75A 2XTRA 2PORA 3FYXA 5GTIO 3LK3B 3T20A 4FMSA 2XE1A 1QJPA 5DL6A 4O4UA 2ZLDA 4KR4A 1S5LO 5E79O 3DA4A 3LK2A 1ZHXA 2M06A 2QTKA 3NSGA 3PQSA 2JQYA 4K3BA 1OSMA 5H2FO 4E1SA 5T5FA 2XE3A 4LSFA 3PGSA 2N2MA
chains in the Genus database with same CATH topology
3AA6A 4RJXA 4E1TA 4D64A 2F1TA 2FGRA 4GCPA 3AAAB 4AZLA 3UAQA 2W81C 2Y2XA 2K0LA 2XE5A 1GFPA 1HXTA 3AAEA 3HOLA 3LK42 4AYNA 5GV0A 1MM4A 2XMXA 3AA1B 3SZVA 4FSOA 4JFBA 1Q9FA 3AA0B 3WI4A 3G7GA 3VE1A 1QJ8A 2Y0HA 3T0SA 1HXXA 3QRCA 2XG6A 3VE2A 2W80C 3GP6A 3POQA 2ERVA 2ODJA 4GCQA 4B61A 2KXPA 2M07A 4LSEA 3RBHA 4U9CA 2F1VA 4PUXA 3LK41 4RL9A 5JDPA 1ZHYA 2FGQX 1IZNB 4O3XB 4AYDC 2KZ7B 3SY7A 3SYBA 4N58A 3A2SX 3VZWX 3HW9A 3O0EA 4GCSA 4FRTA 1P4TA 3LK3A 5EE2A 3EMNX 4AFKA 1OPFA 3HWBA 4N59A 4JCHA 5G26A 3T24A 1MM5A 4C69X 5DL7A 3AA6B 2MNHA 1H6S1 1ZHWA 4FESA 4RLBA 3DA3A 1MPFA 1BXWA 3SYSA 2LHFA 4FZNA 3SZDA 4D65A 4AKRB 5IYUA 2JMMA 4LSHA 5PRNA 1ZHTA 2N2LA 1BT9A 1ORMA 2Y0LA 3UU2A 5ADXL 2X27X 2ZFGA 4QQ1A 4Z3TA 1GFQA 4RJWA 1GFNA 1PRNA 2O4VA 3AA7A 2MHLA 3JTYA 4XNLA 5AFUL 4O4XA 2KXPB 4O3YA 8PRNA 4FOZA 4FUVA 3PQUA 3POXA 3LK2B 2KC0A 2YPVA 4O3WA 5D5DA 1GFMA 1QJ9A 3PRNA 5DL5A 1ZHZA 5DL8A 4AYEC 4FT6A 4GF4A 3WI5A 4O49A 2LFUA 5FVNA 4G76A 3SY9A 5AFUK 3HOEA 2KDYA 4KR8A 3VY8X 4F4BA 2PRNA 3AAAA 4G75A 3AAEB 2K4TA 2OMFA 4AKMA 6PRNA 1HXUA 1E54A 2XE2A 3PORA 1Q9GA 3AA1A 3TZGA 2Y0KA 4AUIA 4LSIA 3VZUX 2GE4A 3AA0A 4BUMX 1THQA 1YS5A 3VY9X 4O3ZA 4AKRA 3C5OA 3V8UA 4RLCA 3UPGA 4KRAA 1GFOA 3POUA 3QRAA 4FSPA 7PRNA 5ADXK 2J1NA 4D5UA 1BH3A 1PHOA 2J4UP 4AYID 4FZMA 4AYMC 1G90A 3KVDD 3AA7B 2XTQA 3K19A 4FRXA 3VZTX 4FZLA 4XNKA 2YNKA 4GHBA 1IZNA 2KZ7A 2Y7SA 2XTRA 2PORA 3FYXA 3LK3B 3T20A 4FMSA 2XE1A 1QJPA 5DL6A 4O4UA 2ZLDA 4KR4A 3DA4A 3LK2A 1ZHXA 2M06A 2QTKA 3NSGA 3PQSA 1OSMA 4E1SA 5T5FA 2XE3A 4LSFA 2N2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RJX A;  4D64 A;  2FGR A;  4GCP A;  2Y2X A;  2XE5 A;  1GFP A;  1HXT A;  3SZV A;  4FSO A;  4JFB A;  3WI4 A;  2Y0H A;  3T0S A;  1HXX A;  2XG6 A;  3POQ A;  4GCQ A;  2ODJ A;  4LSE A;  5JDP A;  2FGQ X;  3SY7 A;  3SYB A;  3A2S X;  3VZW X;  3HW9 A;  3O0E A;  4GCS A;  4FRT A;  3EMN X;  1OPF A;  3HWB A;  3T24 A;  4C69 X;  5DL7 A;  1H6S 1;  3SZD A;  1MPF A;  3SYS A;  4D65 A;  4LSH A;  5PRN A;  1BT9 A;  2Y0L A;  3UU2 A;  2ZFG A;  1GFQ A;  4RJW A;  1GFN A;  1PRN A;  2O4V A;  3JTY A;  8PRN A;  4FOZ A;  3POX A;  5DL8 A;  1GFM A;  3PRN A;  5DL5 A;  4FT6 A;  3WI5 A;  5FVN A;  3SY9 A;  4KR8 A;  3VY8 X;  2PRN A;  2K4T A;  2OMF A;  6PRN A;  1HXU A;  1E54 A;  2XE2 A;  3POR A;  4AUI A;  2Y0K A;  4LSI A;  3VZU X;  4BUM X;  3VY9 X;  3UPG A;  4KRA A;  1GFO A;  3POU A;  4FSP A;  7PRN A;  2J1N A;  4D5U A;  1BH3 A;  1PHO A;  2J4U P;  3K19 A;  4FRX A;  3VZT X;  2POR A;  3FYX A;  3T20 A;  4FMS A;  2XE1 A;  5DL6 A;  2ZLD A;  4KR4 A;  2QTK A;  3NSG A;  1OSM A;  2XE3 A;  4LSF A; 
#chains in the Genus database with same CATH topology
 3AA6 A;  2IWW A;  2R4L A;  4RJX A;  4E1T A;  4D64 A;  3DWN A;  2F1T A;  2FGR A;  4GCP A;  3AAA B;  3DZM A;  4AZL A;  3UAQ A;  2W81 C;  2Y2X A;  2K0L A;  2XE5 A;  1GFP A;  1HXT A;  3AAE A;  3HOL A;  3LK4 2;  4AYN A;  5GV0 A;  1MM4 A;  4N74 A;  2XMX A;  3AA1 B;  3SZV A;  4FSO A;  4JFB A;  1Q9F A;  3AA0 B;  3WI4 A;  3G7G A;  3VE1 A;  5KAF O;  1QJ8 A;  2Y0H A;  3T0S A;  3BRY A;  1HXX A;  3QRC A;  2XG6 A;  4IL6 O;  3VE2 A;  2W80 C;  3GP6 A;  3POQ A;  2ERV A;  2ODJ A;  4GCQ A;  4B61 A;  2KXP A;  2M07 A;  4LSE A;  3RBH A;  4U9C A;  2F1V A;  4C4V A;  3DWO X;  4PUX A;  2R8A A;  4C00 A;  3LK4 1;  4RL9 A;  5JDP A;  3KZI O;  1ZHY A;  2FGQ X;  1IZN B;  4O3X B;  4FQE A;  2KZ7 B;  4AYD C;  3SY7 A;  3SYB A;  4N58 A;  2F1C X;  3A2S X;  3HW9 A;  2R89 A;  3O0E A;  4FRT A;  1P4T A;  2WVP A;  2X9K A;  3LK3 A;  4GCS A;  5EE2 A;  3EMN X;  4AFK A;  1OPF A;  3HWB A;  4N59 A;  4JCH A;  5G26 A;  2WJR A;  3T24 A;  1MM5 A;  1T16 A;  3PF1 A;  5DL7 A;  4C69 X;  5G3A A;  3A0H O;  3AA6 B;  2MNH A;  1H6S 1;  1ZHW A;  4FES A;  4RLB A;  3DA3 A;  1MPF A;  1BXW A;  3SYS A;  2LHF A;  4FZN A;  3SZD A;  4D65 A;  4AKR B;  3WU2 O;  2JMM A;  4LSH A;  4UB8 O;  5IYU A;  5PRN A;  1ZHT A;  2N2L A;  1BT9 A;  1ORM A;  2Y0L A;  2WJQ A;  3UU2 A;  5ADX L;  2X27 X;  2ZFG A;  4QQ1 A;  4Z3T A;  1GFQ A;  4RJW A;  1GFN A;  5B5E O;  1PRN A;  2O4V A;  3AA7 A;  3JCU O;  2R4N A;  2MHL A;  5B66 O;  5GTH O;  3JTY A;  4UB6 O;  4XNL A;  5AFU L;  4O4X A;  2KXP B;  4O3Y A;  8PRN A;  4C4V B;  2R4O A;  4FOZ A;  4FUV A;  3PQU A;  3POX A;  4CTD A;  3LK2 B;  2KC0 A;  2YPV A;  4O3W A;  5D5D A;  1GFM A;  1QJ9 A;  3PRN A;  5DL5 A;  1ZHZ A;  5DL8 A;  5G39 A;  4FT6 A;  4GF4 A;  3WI5 A;  4AYE C;  4PR7 A;  2IWV A;  4K3C A;  2LFU A;  4O49 A;  5FVN A;  4G76 A;  3SY9 A;  3PGR A;  5AFU K;  3HOE A;  2KDY A;  4KR8 A;  3VY8 X;  5G38 A;  4F4B A;  2PRN A;  3AAA A;  4G75 A;  3AAE B;  2K4T A;  3PGU A;  2OMF A;  4AKM A;  6PRN A;  1HXU A;  5KAI O;  1E54 A;  2XE2 A;  3POR A;  1Q9G A;  2R88 A;  3AA1 A;  2Y0K A;  3BS0 A;  3TZG A;  4AUI A;  2AXT O;  4LSI A;  3VZU X;  2GE4 A;  2R4P A;  3AA0 A;  3A0B O;  1THQ A;  4BUM X;  1YS5 A;  3VY9 X;  4O3Z A;  3VZW X;  4AKR A;  4PJ0 O;  1T1L A;  3C5O A;  3V8U A;  4RLC A;  3UPG A;  4KRA A;  1GFO A;  3POU A;  3QRA A;  4FSP A;  7PRN A;  5ADX K;  3BRZ A;  2J1N A;  4D5U A;  1BH3 A;  1PHO A;  2J4U P;  5TIS O;  4AYI D;  4FZM A;  4AYM C;  1G90 A;  3KVD D;  3AA7 B;  2XTQ A;  3K19 A;  3NJT A;  4FRX A;  3VZT X;  4FZL A;  4XNK A;  2YNK A;  4GHB A;  1IZN A;  2KZ7 A;  2Y7S A;  4N75 A;  2XTR A;  2POR A;  3FYX A;  5GTI O;  3LK3 B;  3T20 A;  4FMS A;  2XE1 A;  1QJP A;  5DL6 A;  4O4U A;  2ZLD A;  4KR4 A;  1S5L O;  5E79 O;  3DA4 A;  3LK2 A;  1ZHX A;  2M06 A;  2QTK A;  3NSG A;  3PQS A;  2JQY A;  4K3B A;  1OSM A;  5H2F O;  4E1S A;  5T5F A;  2XE3 A;  4LSF A;  3PGS A;  2N2M A; 
#chains in the Genus database with same CATH homology
 3AA6 A;  4RJX A;  4E1T A;  4D64 A;  2F1T A;  2FGR A;  4GCP A;  3AAA B;  4AZL A;  3UAQ A;  2W81 C;  2Y2X A;  2K0L A;  2XE5 A;  1GFP A;  1HXT A;  3AAE A;  3HOL A;  3LK4 2;  4AYN A;  5GV0 A;  1MM4 A;  2XMX A;  3AA1 B;  3SZV A;  4FSO A;  4JFB A;  1Q9F A;  3AA0 B;  3WI4 A;  3G7G A;  3VE1 A;  1QJ8 A;  2Y0H A;  3T0S A;  1HXX A;  3QRC A;  2XG6 A;  3VE2 A;  2W80 C;  3GP6 A;  3POQ A;  2ERV A;  2ODJ A;  4GCQ A;  4B61 A;  2KXP A;  2M07 A;  4LSE A;  3RBH A;  4U9C A;  2F1V A;  4PUX A;  3LK4 1;  4RL9 A;  5JDP A;  1ZHY A;  2FGQ X;  1IZN B;  4O3X B;  4AYD C;  2KZ7 B;  3SY7 A;  3SYB A;  4N58 A;  3A2S X;  3VZW X;  3HW9 A;  3O0E A;  4GCS A;  4FRT A;  1P4T A;  3LK3 A;  5EE2 A;  3EMN X;  4AFK A;  1OPF A;  3HWB A;  4N59 A;  4JCH A;  5G26 A;  3T24 A;  1MM5 A;  4C69 X;  5DL7 A;  3AA6 B;  2MNH A;  1H6S 1;  1ZHW A;  4FES A;  4RLB A;  3DA3 A;  1MPF A;  1BXW A;  3SYS A;  2LHF A;  4FZN A;  3SZD A;  4D65 A;  4AKR B;  5IYU A;  2JMM A;  4LSH A;  5PRN A;  1ZHT A;  2N2L A;  1BT9 A;  1ORM A;  2Y0L A;  3UU2 A;  5ADX L;  2X27 X;  2ZFG A;  4QQ1 A;  4Z3T A;  1GFQ A;  4RJW A;  1GFN A;  1PRN A;  2O4V A;  3AA7 A;  2MHL A;  3JTY A;  4XNL A;  5AFU L;  4O4X A;  2KXP B;  4O3Y A;  8PRN A;  4FOZ A;  4FUV A;  3PQU A;  3POX A;  3LK2 B;  2KC0 A;  2YPV A;  4O3W A;  5D5D A;  1GFM A;  1QJ9 A;  3PRN A;  5DL5 A;  1ZHZ A;  5DL8 A;  4AYE C;  4FT6 A;  4GF4 A;  3WI5 A;  4O49 A;  2LFU A;  5FVN A;  4G76 A;  3SY9 A;  5AFU K;  3HOE A;  2KDY A;  4KR8 A;  3VY8 X;  4F4B A;  2PRN A;  3AAA A;  4G75 A;  3AAE B;  2K4T A;  2OMF A;  4AKM A;  6PRN A;  1HXU A;  1E54 A;  2XE2 A;  3POR A;  1Q9G A;  3AA1 A;  3TZG A;  2Y0K A;  4AUI A;  4LSI A;  3VZU X;  2GE4 A;  3AA0 A;  4BUM X;  1THQ A;  1YS5 A;  3VY9 X;  4O3Z A;  4AKR A;  3C5O A;  3V8U A;  4RLC A;  3UPG A;  4KRA A;  1GFO A;  3POU A;  3QRA A;  4FSP A;  7PRN A;  5ADX K;  2J1N A;  4D5U A;  1BH3 A;  1PHO A;  2J4U P;  4AYI D;  4FZM A;  4AYM C;  1G90 A;  3KVD D;  3AA7 B;  2XTQ A;  3K19 A;  4FRX A;  3VZT X;  4FZL A;  4XNK A;  2YNK A;  4GHB A;  1IZN A;  2KZ7 A;  2Y7S A;  2XTR A;  2POR A;  3FYX A;  3LK3 B;  3T20 A;  4FMS A;  2XE1 A;  1QJP A;  5DL6 A;  4O4U A;  2ZLD A;  4KR4 A;  3DA4 A;  3LK2 A;  1ZHX A;  2M06 A;  2QTK A;  3NSG A;  3PQS A;  1OSM A;  4E1S A;  5T5F A;  2XE3 A;  4LSF A;  2N2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...