7PTDA

Phosphatidylinositol-specific phospholipase c mutant r163k
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
296
structure length
296
Chain Sequence
ASSVNELENWSKWMQPIPDSIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKKYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQDKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQDYINEKWSPLLYQEVIRANKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
publication title Probing the roles of active site residues in phosphatidylinositol-specific phospholipase C from Bacillus cereus by site-directed mutagenesis.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
total genus 92
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1997-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 7ptdA00
3QR1A 6PTDA 3V18A 1V8EA 1DJXA 1QASA 5T9BG 2OOGA 4I9TA 3PTDA 4F2TA 1DJHA 4RW5A 1DJWA 1O1ZA 4PTDA 3MZ2A 3QR0A 1T6MA 2OR2A 3H4WA 4QJ4B 3L12A 2PLCA 4I9JA 5T91A 1ZCCA 2ISDA 3CH0A 4F2BA 3H4XA 4I9MA 2FJUB 4F2UA 1QATA 1XX1A 4R7OA 3RLGA 3RLHA 3EA2A 4RV3A 3NO3A 2F9RA 4QJ3B 2O55A 3OHMB 3V16A 1DJZA 4S3GA 2PZ0A 4GNKB 4OECA 2ZKMX 3I10A 1AODA 2OTDA 1T8QA 3KS6A 4Q6XA 1GYMA 1DJIA 3V1HA 5PTDA 1DJYA 5T9CE 7PTDA 1PTDA 1PTGA 1YDYA 2P76A 4I8YA 3EA1A 3EA3A 4QJ5B 4I90A 1VD6A 2PTDA 1DJGA 4RW3A 3QVQA 3KS5A
chains in the Genus database with same CATH superfamily
8A3HA 1QVBA 5T26A 5LXXA 2R91A 3M0HA 3V1PA 3GAKA 1RD6A 3L4VA 4XTDA 4KETA 4DO6A 5E5CA 1DXIA 4NXKA 4MWAD 3W7KA 3TN3A 1E3ZA 4UQ9A 4IQLA 4ZOBA 3O6YX 5D9NA 1S2AA 3THCA 2OG9A 2UY4A 2V3FA 4XTIA 2JQXA 2E9LA 4LAUA 4IX0A 1J11A 3E2QA 3DC0A 1NFBA 2QCCA 1RVGA 4N9BA 1UC5A 1EPVA 3F4WA 3HV9A 3G1XA 4A3RA 5HATA 2Y7GA 1DHPA 5EBUA 2OJPA 3A12A 1F07A 1QFEA 4J28A 4JTCA 4BFAA 3SEPA 4ZO7A 3O63A 4H9VA 3W72A 3WFZA 3AC0A 4H8UA 3ARUA 1W3NA 1LQ2A 1RCXB 1V79A 3LCIA 4HKPA 5K2ZA 1N8FA 3MSRA 4C6JA 4LS0A 2OX1A 2R6OA 4GUHA 1KR1A 2OFJA 1XIBA 4YNGA 2E6AA 5BW6A 3BMXA 1PDYA 3DHPA 2D3NA 2GQ9A 1G7VA 2PD5A 4LVBA 4HU3A 1OZQA 1W9DM 4KMQA 4AEEA 1HFBA 3LI1A 3W00A 3TX9A 2G50A 5CXPA 4IUOA 5GJNA 5A5WA 4PRWA 2CLEA 2YW3A 4FK9A 3WDQA 2VFFA 3QZ6A 4GUIA 3UD6A 5AHLA 2WYSA 1PYFA 3C0LA 4HCLA 1L6FA 3TN4A 1AW2A 3GFZA 2OR2A 4LAMA 3TU9A 3TONA 5T91A 1FWCC 2NZLA 2W67A 4H8HA 3N9RA 3KTSA 1F2JA 3CZLA 3G6MA 4HZ6A 2Z29A 1SSDA 3NVDA 5M03A 4U10A 1HQTA 4EF9A 4DJEA 2DSWA 1A53A 1IWPA 2F6KA 2F38A 1TVPA 4HD5A 3U8GA 3AIQA 2ZOXA 4US5D 4S3BA 5K4ZA 4OECA 3DFPA 3FGCA 2WC3A 1JNDA 5CZSA 3VOGA 1RR2A 3U2CA 2NXHA 3FA3A 3W7NA 1W8GA 4DF0A 4K1GA 1U1UA 2JE8A 3FAXA 3BGGA 4UFIA 4MF4A 4C7FA 3W7HA 4A3QA 1S2TA 2WW5A 2CZEA 3MYOA 3MHFA 3BAXA 4P7OA 4NY2A 5CPQA 1SQ7A 2E09A 4JPGA 1W6TA 1P6CA 3GBEA 2TYSA 4AWUA 2A3HA 4KPLA 4BEUA 4GZ7A 4QLKA 5K9CA 1VD6A 3FJ6A 2DIJA 3EX6A 4JN7A 3IGSA 1I4NA 2JIWA 3NCOA 3PUOA 1TX0A 2V5DA 1CLVA 3CPGA 3RMEA 1SZRA 1BSLA 2G0WA 5D2WA 4IH3A 1YPFA 1V3LA 4S2CA 3H4WA 3LLDA 4DZ5A 4C5ZA 4OE7A 2XGIA 3AXIA 2G3MA 3CMJA 4GUJA 3H2CA 1F4AA 1BYAA 1JZ6A 3QZAA 3T0CA 3RUBL 3SQLA 3GG0A 3KLKA 3MKCA 2RUSA 1OVDA 3EBVA 5FIPA 3W84A 1NTHA 3GNDA 1Q8JA 3PB2A 3P61A 1ITQA 3P5YA 4XQ6A 1L6GA 4Y9AA 3W71A 2RAGA 4GC4A 2ZRYA 4PTXA 3A4JA 1OFAA 4IIDA 2C79A 3PUEA 1ZL1A 2Y5JA 1HP5A 1NQ6A 3W1NA 1AH4A 2QV5A 4M19A 4PTMA 3RM8A 1DQXA 2HZGA 1UR4A 2IXUA 3GRIA 5JBEA 3FYOA 4W9TA 4DI8A 1TCDA 3HIJA 2WMFA 4LW7A 5AHNA 3T07A 4HA3A 3WKZA 3U48A 5E6ZA 3WNKA 4ERAA 1C8YA 4N9EA 3P8IA 2DUXA 1EJWC 3DEQA 3GWQA 3ITVA 3AHVA 4YLWA 4BJHA 2Z2UA 3P80A 4TU1A 2OSXA 4F0SA 2WVUA 4XO6A 4O8RA 2XH2A 5CGTA 2QCMA 3DYPA 4QRNA 5LIYX 1POJA 2OPJA 4YVPA 2F6XA 4DVOA 1J96A 1PUDA 3M0JA 1E4IA 3TFXA 1HVQA 5MHBA 1WCGA 2OSYA 4JYDA 3QZEA 3WF2A 5LNUA 5AC6A 4K2SA 4G7EA 4D8ZA 2PWUA 2Z4GA 3VKBA 2FLIA 4PUDA 1TWSA 3VIIA 1F6KA 2J13A 1UD6A 1XLEA 2PWFA 2WNZA 1V02A 1U1JA 3K5XA 1XH0A 4NQ1A 1L2QA 5E93A 1J0KA 2Y88A 3GW3A 1BXBA 3RRAA 3MTWA 5A8NA 4LB3A 2C1IA 5GJPA 1GVQA 3TWAA 3G8RA 3LLXA 1E0UA 1TMQA 4DBEA 4Y8EA 1XH1A 5CZJA 1E15A 4L4PA 1PV8A 3PM6A 5A6BA 2J25A 3GC2A 4LUSA 2A3LA 5DT5A 1FXQA 2XGZA 3KCLA 1VBRA 2FGBA 5DT7A 5BXPA 3N4FA 2WC4A 2PGWA 3GH4A 1VHCA 2WV8A 3R0UA 4UWMA 5A95A 3UWVA 3GVQA 1KLZA 4UTTA 4DHGA 5H2ZA 3UVIA 3OVGA 1P6BA 2IPWA 3L4ZA 3BQ5A 1EJ7L 1JPKA 3EOEA 1R6WA 4E8GA 1XXXA 3KBNA 3RXZA 1ISVA 1N55A 3F7JA 5I3IA 2QLYA 2J88A 2ZRXA 3PAOA 3SB0A 2A7PA 3ES8A 4IIFA 1E70M 3C3NA 3M5ZA 2QNEA 1YHTA 4C6DA 4DM2A 3VIMA 2DGAA 1IWBA 1V6UA 3IJ6A 1VFOA 3CEPA 1TRDA 4O0ZA 3L68A 3B8IA 1AK5A 1GJUA 3RX3A 2WBGA 5JUVA 1NFGA 1J0YA 3VFLA 3EOUA 3PTMA 3AXMA 3NDOA 2WNNA 1KV8A 4AQLA 4LTSA 5C54A 2VZVA 2B7NA 3HGJA 4ATLA 3SCQA 3SAZA 1V6WA 5LZLA 3UEQA 2V30A 3XINA 3GB6A 3RK8A 2PI6A 2YXOA 3GM8A 1PYMA 1QAPA 2Y85A 2V81A 1VB9A 1Q2RA 3STFA 5HUOA 1OGGA 2ON3A 4MTVA 3PY2A 4GVIA 1UKOA 3WDPP 4PMZA 1OCNA 2R8WA 4A8LA 4PUEA 4EXBA 2DW6A 2QYGA 4DELA 1Q7ZA 1P4CA 3AI0A 2DJXA 3L21A 5HNTA 5KSWA 4MHBA 3MBDA 3CUFA 4B15A 3LSBA 2PDIA 1TO3A 1L9WA 4S2BA 3L5LA 3UY7A 3LCWA 1NIUA 2E7FA 4FF7A 2DORA 5MKGB 1EGZA 1C7SA 4HJFA 1MUWA 3UJ2A 1ONXA 2CZ5A 4NAEA 3PG8A 5I78A 2UZ9A 4NNAA 4TVUA 4IPNB 4QBXA 3QMSA 2ACRA 3A4WA 5EFDA 5AYIA 4PB5A 4CCZA 5DFAA 2AOSA 1W1IE 4WDXA 4D6GA 2Y63A 4GYFA 3CWHA 4IOTA 3QC0A 1UUQA 4K1WA 3H4GA 2YL9A 4B2DA 3MI6A 4N02A 1OF8A 3IJ8A 2OZ8A 5A1AA 1RZMA 3GD6A 3T0AA 2TODA 4F0KA 4PA8A 4W7UA 1W9XA 3R58A 4GQGA 1OSEA 3GS6A 4H7ZA 1HO1A 3VZZA 3BAKA 1FWGC 3A22A 1B0IA 5HPOA 1BG4A 1PCWA 1Z41A 1QT1A 4BF7A 3CAKA 1GHRA 4GI4A 3QV9A 4P8UA 2QCFA 4X2PA 3WDHA 1DHKA 1LCOA 4PN2A 5XINA 3AU6A 2PAJA 3CV7A 2CLFA 1VJZA 1H49A 1JCTA 1CGWA 4EP8C 1FCBA 4QDWA 4FPSA 2IS7A 4KBXA 3ZSSA 3VCNA 4NF7A 3S5NA 1V6YA 4P5UA 3TAOA 4JTDA 2DZUA 2ISFA 1CB2A 2VVSA 2J7CA 2W66A 3QLDA 1UH2A 2Y0FA 4Y6GA 4LVFA 4GCXA 1ODZA 5L6UA 4I7UA 3G3DA 3SRHA 1Z3NA 5E0FA 3GDBA 4DNMA 5FJOA 5TNVA 1WKEA 3E2RA 4ZO8A 2OQHA 1VCVA 2JGYA 5A2AA 2EHHA 2EEXA 2Y70A 3RGTA 1A5KC 3LCXA 1NOUA 4FNQA 3NPXA 3CQ0A 4XBSA 1JD7A 4N42A 4DYEA 3R1ZA 1R5YA 3F2BA 1ZAJA 2J62A 3TNBA 2AQWA 4LSBA 1YYAA 3A24A 3W1QA 3W7PA 4QQUA 3T4CA 2FFIA 4G7FA 2NXIA 3OBKA 1ZBWA 2VFEA 3W1RA 3LMYA 1BAGA 3UJSA 1K9EA 4LV4A 3RO8A 3SUUA 4GI6A 1JDCA 3W87A 3EWBX 4MDPA 1BQCA 3ZWTA 2F2HA 4BK9A 4RZ5A 3TXZA 3BAIA 1HP4A 4HNUA 3H26A 5E9XA 3SR7A 5CLWA 3GO2A 2VCCA 4RCXA 1DWGM 2PU0A 3BCFA 3P60A 3W73A 4QHRA 4QCFA 5IHRA 3H55A 4JIPA 5XIMA 3WQPA 4MZ1A 4ERGA 3VIPA 3M0MA 3LPPA 3NPWA 2CLOA 1HL2A 1KGXA 4AWSA 1GVSA 2INFA 1LL7A 3WSUA 2VGIA 4Q6JA 2NW0A 3SFKA 1B90A 4IPPA 4J3VA 3DH7A 1ADDA 4QG9A 3ZT6A 2HVNA 2OYLA 2Z1KA 3MZNA 1RJRA 4UZUA 4AG0A 3G1HA 3TYUA 4QSHA 1Z8AA 5A6LA 3BLOA 4S3AA 3WQGA 2FZNA 4AHPA 2CITA 3L7RA 1K4HA 2VZTA 2ATSA 4JNYA 4LC6A 1KXVA 1WDSA 3DI1A 3EPOA 4V2XA 1ZTVA 4EAYA 2ALRA 2EGZA 3V75A 5DMYA 1XYZA 2CWNA 3H12A 4MUZA 1ME9A 4KCTA 4TO8A 5BRQA 3U2OA 5DRCA 4NI3A 3R79A 4HSOA 2X2GA 3FKKA 1R86A 3KVLA 2J78A 2PDXA 3LMZA 3WUGA 3BJTA 3RPMA 1G7UA 4Z1AA 2NX3A 3DENA 3E3HA 5CKSA 5D33A 4PYSA 2RDUA 3VGEA 2OO0A 2G3FA 1EJUC 1XBYA 3VNDA 4UOJA 3TSBA 2WJFA 1DEDA 1KNWA 3M0LA 1KCXA 3WEMA 1JG9A 2Y6ZA 3FW6A 4H6RA 5MKGA 2F2KA 1VFHA 5C0QA 4OOZA 4DBSA 1LF1A 1MEIA 1UR2A 4GC3A 4FOUA 4RDVA 5EMKA 3TV8A 1K7FA 3ABOA 3BL3A 3AIVA 1E4NA 5CPTA 1ZCOA 4LAOA 1F4HA 4LOCA 2DZSA 1TV2A 4B3KA 9XIMA 3DXIA 2JEPA 2GOKA 3HGRA 5AYXA 3EPMA 3S5SA 4H9UA 3KUMA 2YL6A 3S5OA 2GJXB 5IHSA 4LRSA 3TR2A 2BS9A 1KM1A 1F8IA 1JAEA 5KMYA 3NO3A 4KESA 4MLRA 3K4DA 3TW7A 1KFWA 4HK5A 4I6VA 4JFSA 4HNOA 1A4LA 2D73A 1UG6A 2VURA 4MNKA 5B7YA 3V0TA 1U2YA 3QR3A 5CGQA 2C0AA 2HPIA 3T40A 1W3HA 4AZ7A 1Z32X 4W84A 4GJJA 1KCKA 1Y65A 3VMOA 1C93A 2RJGA 4AHQA 1SUXA 3H53A 4U28A 3LCGA 3IJ9A 5TD4A 3UWWA 1TRIA 4PBFA 2YXGA 5DXXA 3TUUA 1ZRQA 3TQVA 2E40A 1XGDA 3BCDA 4D8LA 3BANA 9CGTA 1ISWA 3ZSTA 5HXMA 3NZRA 1BYDA 5DCDA 1ZCCA 4BQ3A 4OV9A 1RCQA 3UR2A 3ITOA 1VJIA 2HRWA 3C2YA 1WZAA 2WNQA 4U2ZA 4DWSD 1DJWA 2FZDA 4O4VA 1X6LA 3C4UA 3P81A 4MB3A 2XJ7A 3L4WA 5K3VA 3L65A 2QJIA 1HJSA 1OBAA 1QI5A 1ADSA 3WNLA 2W63A 1TPH1 1BPLB 5TQLA 3MMDA 3HFYA 2B7OA 1F5ZA 4J40A 2XN0A 5KITA 3PWAA 4PSPA 5BMXA 3H2FA 1KA9F 3ENLA 2J8GA 3G0XA 3TKFA 4CLMA 4INFA 3CQKA 1FXPA 4B5NA 4QS6A 4L64A 1FWSA 2ZUWA 4WY0A 1R7OA 5I02A 3KBVA 2VEPA 3M64A 2VX5A 3NQAA 3VE9A 2RFGA 1Z9AA 1A47A 2PDQA 3AISA 2IPJA 2WKGA 1Q45A 2DSKA 2X09A 4JX5A 1RBOB 4AY8A 5I3KA 1NH6A 1YNQA 4ASTA 1J6PA 1XDJA 3TN6A 3NQMA 2OYKA 1B31A 3WQCA 3CS2A 3SRDA 1UD2A 3UWQA 3V7PA 3AUOA 4BQ5A 3SCRA 4UB9A 4NZ4A 1TTPA 4GZIA 3ALGA 3V18A 4CN4A 3OLGA 3E1F1 4WDUA 2I17A 2X16A 3O7UA 4DPPA 5FF3A 3E6EA 2OT0A 3IIVA 3GAYA 4ZE4A 4PODA 1VYSX 4PBEA 3RHGA 2ICSA 4LQ1A 3W29A 1AQHA 2ISWA 1HXJA 2ISDA 2R1KA 2CEQA 2EPMX 1CXHA 4IJBA 1KWGA 1QRQA 3EEZA 3NAVA 1W0MA 4A2SA 1OFOA 3VDHA 2QCLA 1NEYA 2CLIA 1KW1A 1J93A 3W25A 3R4IA 1QOXA 3VKJA 1QPQA 1I60A 4ZFMA 4AX6A 4NUWA 1MW1A 3CO8A 3I65A 4WR3A 1V0LA 2BP1A 3PANA 1D2KA 2VR5A 4O1EA 3RM9A 7A3HA 3HV8A 4WSHA 5A6TC 1MYRA 2NX1A 4AX7A 3IIZA 4WOQA 3VD4A 3DG6A 3VIHA 2QCGA 4H19A 2XINA 1IXPA 3CT7A 3G1AA 5T9CE 1A5UA 1LBLA 4Q7NA 1E0XA 3WH9A 2VHLA 4L6HA 1BTMA 4H7VA 4AZ6A 5FJTA 4R3UA 1H4PA 4H2CA 3UXDA 1TPB1 3LERA 2VEMA 1XIHA 4ZOEA 2H9AA 3BW2A 3W3OA 2PC8A 1GG0A 1EBHA 3M16A 4RNFA 1OFEA 1WKYA 4D6FA 4QAWA 4Z2LA 2FHCA 4LJ3A 2ATMA 2HDJA 3PTDA 3WEOA 1QPRA 4HP5A 3W2LA 1VCFA 2PMQA 1P43A 1XRFA 4YTUA 3VDBA 1GJWA 2A3AA 2GJXA 2IQTA 1Q4WA 3GUWA 3T6CA 1M7OA 1C8QA 1R38A 2AKZA 3G24A 1FTXA 4JHMA 5CSUA 1RQBA 3FN9A 2YL5A 3GHTA 5JH1A 3A5FA 5CCZA 3GLCA 3WL0A 3MVTA 3CZKA 1JYVA 5BOFA 3A6OA 2PRHA 1V7AA 5M1TA 4NZCA 2ZXDA 3LCLA 4U5IA 4MAZA 1RV8A 4ACZB 5H1WA 5BROA 3ID7A 2BASA 2Q71A 2ZXQA 2GFTA 4NXSA 2XU2A 1JI2A 3EWDA 2BHYA 1GQIA 3VFCA 1I75A 2NQLA 4FX7A 4LB4A 1QBBA 5C70A 3VGFA 1NY1A 4UQAA 3LGDA 5EFFA 1PIGA 2AGKA 3W22A 1UJPA 4X3ZA 4XVDA 3MP4A 2V2CA 2HS8A 3B8VA 4M6PA 1ZBKA 4RLIA 4DJFD 4IFRA 3BDKA 4CN1A 3REQB 3CQJA 5D32A 1TV8A 3HURA 1JFHA 3AZTA 3RAOA 4HN4A 1VPXA 3NQVA 3ME3A 4HHPA 1UZHA 3ANVA 4B3ZA 5BWFA 1FHUA 4MZYA 3UZZA 2AAMA 4R9XA 4Z08A 2VP8A 1ITXA 3WQ4A 4IFOA 1CYGA 4Q8PA 1JCNA 1XLIA 1HGYA 4CD7A 3VM5A 3CWOX 6REQB 1HJXA 1UMLA 1XRSA 3QTPA 3EX1A 1NWSA 1VFTA 4MWAC 1THFD 2VT0A 5CG0A 3IK2A 1B9ZA 4HIBA 1LP6A 4JNZA 4DYJA 1XX1A 4IMEA 1E9IA 4CNPA 4RV3A 1DIEA 2YKKA 4QS5A 3RCNA 4AMCA 1R2RA 3GDMA 4M8UA 4GH3A 4WD0A 1KRAC 3W7DA 3OGSA 3N9SA 1V6TA 2QVNA 3IK4A 1UWAA 2WCSA 4LANA 3S9IA 1SSGA 5SWUA 4IG2B 5CC5A 4ZOCA 5DQPA 2OT1A 1BVWA 2PWEA 3VIJA 4TXEA 3LXCA 4O17A 3HOJA 5FOOA 1NDVA 4CD5A 3EKLA 1J79A 3CPRA 4CQAA 1KLYA 3UXAA 2DH2A 2G3JA 4A6GA 2Q8XA 3EA3A 3MWAA 4HU4A 5GPRA 3M7SA 3N11A 3MV11 2WWDA 4I90A 4G5DA 1US0A 1XW8A 3QHNA 2OLHA 5LGXA 4C6PA 1S2WA 1E56A 2E5CA 1W8SA 4TIMA 3IV8A 1TR9A 3KTXA 2B81A 3ZJ8A 1LOLA 3CZEA 4EWND 2DZAA 4IXXA 4ADTA 1TJ2A 3GNOA 3W86A 2OWWA 1RCOB 1W32A 2BV9A 4GISA 5CC6A 2GJPA 3HQPA 1HGWA 3KOXA 3QH2A 1OYCA 1I9CB 1ALDA 3CZJA 3TOPA 3BOFA 4IIBA 4PMQA 1M5WA 1PKYA 1BXNA 1OX4A 3DOPA 3ARZA 3BO9A 3G18A 4HYVA 3EB3A 2J9ZA 1QPOA 1M04A 3UVAA 3IWPA 4QNWA 4KEUA 2E5BA 2VUYA 1B3VA 4D72A 3RLUA 3UYIA 3WMCA 1OFPA 4GA8A 4ZSTA 1X98A 3TMQA 2BVDA 4D71A 3CT2A 5FJUA 3F4DA 1H7OA 4GLEA 3P84A 2R94A 2FMNA 4FMVA 2PP0A 1E5JA 4PUKA 5JMUA 4FHAA 3NQ6A 3UXIA 2PURA 1XI3A 3CHFA 2ALDA 2V0TA 3AWNA 2J9XA 4JX4A 3HGOA 1ITCA 9XIAA 1ZALA 4H8NA 4RE3A 4C65A 3LHYA 2DZVA 2WVVB 1ZLPA 5CAKA 2V9DA 3GXFA 1DTUA 4M80A 1U5JA 1O12A 3R0KA 1JDFA 1MZHA 2W92A 4LU0A 3S2NA 4LY4A 4I5UA 1Q6GA 2TRSA 1XLJA 2ZIDA 3CL6A 3R12A 1LL4A 3MVIA 1BF2A 1Y5XA 2OWXA 1W2VA 4O19A 1J8VA 3L0GA 4KWSA 2VC5A 1BEUA 2CLKA 1WPCA 2VR4A 3UP8A 1UD8A 4EE9A 2J75A 3MDWA 3WJXA 1HKKA 2G37A 3I3BA 4C6CA 4QDMA 1Q65A 2EG8A 3VD9A 1EKOA 3GTNA 3JU2A 1EA0A 3P62A 3GTHA 5D02A 1MFUA 1UP2A 4GPNA 4PR4A 4RL3A 5HOSA 4CEUC 3EDEA 3ARQA 2WCGA 1ISYA 4NJJA 5A8GA 1G4SA 3CMFA 2W9MA 1A5MC 5FEXA 1V08A 3S5YA 4AF0B 4ACZA 3LS9A 2VRKA 3AS1A 4CCCA 4DXXA 1PB0A 1VFUA 4H7CA 3JZEA 5XIAA 2NUXA 2NQ5A 4GYKA 3TJ4A 2ISSA 4AC7C 1TTQA 2JK2A 4H9XA 1YDYA 3G2GA 4OU1A 4WK9A 3ZVIA 1YADA 2CLMA 3DC8A 1XBVA 4A22A 3RF9A 1Q8AA 1VFLA 4E6MA 3CUJA 3WH6A 3FJNA 2YOCA 4G1KA 1KC7A 4GOAA 4K37A 4YVVA 1ECQA 3CMGA 3OPSA 4AD1A 1F9CA 3ZIZA 2IW0A 2RHGA 3V35A 3EWZA 3GYEA 1CBGA 5JVLA 4RNJA 4WCJA 2V8ZA 3WNOA 3FVDA 4IP5A 2HROA 1RUSA 3C61A 3VNIA 3W2MA 1XD0A 5CEWA 5LIWX 2DV0A 4W93A 1HKJA 2Q01A 5I3GA 1FRBA 3IVTA 2GGIA 4Z1YA 1OYBA 1OD0A 4E2DA 3VOHA 1PZ0A 2FZ9A 4R7OA 3K8LA 3OEXA 2J79A 4UR8A 1A3HA 4QG6A 2HPMA 3E12A 1UUOA 1V51A 1FY6A 1XLBA 1IIHA 1SW3A 1TJ1A 4Q8TA 1DWJM 3PR2A 4ADSA 4E2OA 4JTHA 3U5UA 1MWOA 1RK6A 3NFUA 3NM3A 3LD5A 1L8NA 3G0SA 3U2EA 3UWYA 2NVCA 2WHMA 1VGAA 2KX9A 3HPXA 2W62A 1GZGA 4WX2A 2IPFA 2VQUA 3RU8X 2GK1A 4GYJA 3KAOA 2GUYA 3DUGA 3W6MA 4LNYA 2BY2A 4N9DA 4JQ4A 1QR7A 3QHMA 4MNMA 4XV0A 3O9NA 4KWUA 5I79A 2VRQA 2BXVA 3A23A 1BXCA 1WKFA 3ARTA 3N6HA 4FIQA 4DF1A 1PZ3A 5C9UA 4Q4OA 3OG3A 1RY8A 1TV5A 4TVCA 2J7DA 2VGFA 3VNKA 3ZR6A 1CGVA 3MANA 5EMMA 1MZRA 4KS0A 3D6NA 1ONEA 2BOEX 1WE5A 3R0DA 4XAYA 1BWLA 3CYJA 4E4UA 3F4VA 1R2SA 4CU8A 3MUXA 1B1YA 3OJGA 4BWLA 1HKVA 1XPYA 4JTJA 4AZBA 3NQEA 1KBKA 3F2DA 3H2MA 2D69A 3ZQ9A 3IAPA 1O95A 1LBFA 1UR1A 1DIOA 1MVYA 2VRJA 2OEMA 4WJ8A 3AXKA 2V5BA 1OJXA 3LK6A 2O9OA 3IGUA 2VX4A 1TWIA 4X2RA 3GFXA 1VRDA 4BS0A 1Z6KA 1FWTA 2HXTA 4JTKA 1AA1B 3WFLA 1KBJA 2CU0A 1GOIA 2VFGA 1JZ5A 4DAFA 2RDTA 1U83A 3URQA 2QT3A 1U5VA 4KEZA 2WVSA 2PFHA 3DFHA 4PGLA 1R3WA 4IL0A 3I4KA 4ROPA 3PN8A 1MXDA 2UWFA 2Z7KA 3N3TA 1MXGA 3N2TA 2EF9A 2NWRA 4XIMA 3UW6A 4GXMA 3FHQA 2WZHA 1UQZA 2BTMA 1XF0A 3VE7A 2ZUVA 4QFUA 1ENUA 1BWKA 3C56A 4AF0A 4QX4A 3HQ1A 3L0NA 3MSDA 1AZ1A 1E0WA 4ZTYA 1PL9A 3GNXA 1XFBA 3P0XA 4UMCA 3KDNA 4ATDA 5CSYA 1UKPA 3ZLFA 3FCPA 1NF7A 4OV4A 1CLXA 4Z17A 7CGTA 1YXYA 4FF5A 1X8CA 4YCPA 3NQ8A 3BH4A 4DBDA 1DTNA 1XIFA 3NNTA 4S3JA 1IEXA 4J3UA 1FA2A 4GBUA 3BZGA 3VD3A 1GVYA 2JIEA 1VZWA 4Z1BA 5IDIA 4DRSA 2BSLA 1S39A 3D3FA 1G0CA 5HQEA 6ALDA 1H11A 5I3FA 3NEHA 3OA3A 4X9SA 1VFMA 2WM1A 1MRAA 2ACUA 5G4EA 4GY7A 4I8YA 3WLRA 4F0MA 4S3FA 2CBJA 4LUYA 3HB9A 3JZUA 3AS3A 5TBOA 1GOXA 3DECA 4IFKA 1Q7QA 1AJZA 4M51A 3O05A 3OQEA 1B3OA 5AVHA 4POCA 3LM7A 2DP3A 4LT9A 1K1DA 3B9NA 2X2YA 1EIXA 5C2GA 1CCWB 3TE9A 1W54A 3S8HA 4ZO6A 1OT1A 1YTDA 1JZ3A 1HX0A 1UA3A 4X60A 1DJQA 2FB3A 2VELA 4WDTA 3HPSA 4KFOA 3GVVA 3T44A 2AL2B 3B4YA 4XB3A 2R1LA 3O6CA 2V5JA 4GY0A 4AXNA 1T5AA 3W1UA 4JDBA 5GJMA 4C6QA 2Q3OA 4GIYA 3M41A 4BI5A 4RZ4A 3EZ4A 3WK2A 3ZJ7A 1TCMA 3MKVA 5A6BD 4GKTA 3EB2A 3OYZA 4HHHA 3VDGA 4FR6A 3WH7A 1YIXA 1P7TB 4MWAE 4PUMA 4PL2A 4FI4A 4AUBA 3M07A 4G56A 2A1YA 1VQTA 5M5DA 3I3DA 3IIXA 4RNHA 5CH9A 3STCA 1O94A 3F5KA 3MJYA 1SJDA 4AEFA 4AD0A 1UP3A 3O15A 3VCCA 4QGCA 3F03K 1UD4A 1DWAM 3I6TA 2OGYA 2YCLB 3GTIA 4GD0A 4PMXA 4BZYA 3NDYA 1LLOA 1XGEA 3P74A 3VAVA 2J24A 3R7MA 1W3TA 3G1VA 4NX5A 2ZXBA 2HNEA 2D3LA 4R27A 4M7TA 1YMYA 2XWDA 5IBXA 4HOZA 2VNCA 3WN6A 1JRCA 2EPNA 1WB0A 2QMJA 1XIDA 2MNRA 1VC4A 4ALDA 1UKQA 2A4AA 1FH8A 4GXWA 4I5XA 2J4GA 3WO8A 2GGEA 4IHCA 1GW1A 2QJJA 4F79A 2DDXA 4NKCA 1V6VA 4PH6A 2J7HA 3WCZA 4BF9A 1T40A 2F8QA 4XSLA 1PE1A 5A6KA 3OHMB 3QW4B 4O4WA 3GR4A 1B4KA 1SO6A 3BMWA 3UFYA 2ZKMX 5FACA 1BVZA 2HK1A 5GNYA 3CASA 2YGYA 3B0UX 5DLCA 2VZOA 2V63A 3WLMA 1LM1A 2Z2BA 5U7SA 3WD2A 2XWEA 4D8AA 3W75A 4BHYA 4NAFA 1R7AA 4XKYA 3HQNA 5BOOA 2V69A 1ZNNA 3WBXA 4QITA 5I5RA 3PPHA 1XSJA 4GXPA 2CBIA 3UY8A 3QPEA 1XDLA 1TPWA 2R14A 4MWAB 4RE0A 3U2ZA 4B16A 3BG5A 2J9YA 1Q6CA 3AMDA 1VFFA 3CV6A 1X1NA 2D2OA 4MMWA 4ZQNA 3QHOA 1MO0A 2R1MA 4ORMA 4IIEA 1W3KA 2VZSA 4BCEA 4RE4A 1UHVA 1FDYA 1FDZA 3FSUA 1BGGA 2ZICA 1QK2A 1HL9A 3SSZA 2IPGA 3MCNA 3E38A 3JS3A 3JUGA 3GXNA 2H8XA 4ZENA 4E3VA 4CEXC 4UTKA 4JIHA 2ZX9A 3BG3A 3AHYA 3APYA 5EL1A 2HEJA 1Z48A 2J7EA 3E02A 2W3ZA 1YQ2A 3FXGA 1IXQA 3W38A 4I7WA 1OX6A 3R2GA 3D47A 1C92A 4Y9MA 4LF2A 3FOKA 2X8RA 1ODUA 4N4PA 2GSHA 3IARA 4AY7A 2OTDA 3O8AA 4BI7A 4QISA 1CXIA 3QKEA 3Q67A 1KQZA 2VWSA 4CNSA 3LHVA 4NP7A 1AD1A 2X30A 3SM0A 3TC3A 3MO4A 1WUFA 2E1WA 3CJPA 3WQDA 4FEZA 3B3DA 3Q94A 1TA3B 2ZUUA 4O52A 4UCFA 4QM1A 5BNKA 1E4LA 1C8XA 1W1B1 6TAAA 1ZPTA 1PXGA 3SCNA 1F61A 1A3XA 2ZWZA 5JBDA 1HF6A 1OGSA 1EH9A 3W7QA 3SQSA 1FWFC 3MMWA 3GW0A 3UYCA 2PBGA 1GW9A 4LY8A 5C9XA 2FYMA 3KX6A 3GYCA 2A6NA 4J3WA 1E6QM 2GLKA 4FLOA 5J04A 3H2AA 3N2XA 2DH3A 4GACA 4I9MA 2BY1A 3S6TA 1J0JA 1OCJA 2HK0A 1VBHA 1FBAA 3C6CA 4ZXOA 4Q4PA 3OBEA 1JD9A 5CPNA 3P0WA 5F4XA 1XISA 1BYCA 3H2NA 3SGZA 3IGHX 3NQ7A 3WNPA 5HR6A 4HK6A 2WMIA 2XN1A 3OHIA 2YBVA 5DCBA 4DO7A 3WQ6A 6CGTA 2DIKA 4UC5A 3GNRA 4MNLA 3NGFA 5AC4A 2UY3A 2DSUA 4MKNA 5HBFA 2E1DA 3STPA 2BVWA 3WL1A 1TG7A 5I24A 2DPEA 1WDDA 3N2OA 3VD7A 2FVLA 2VTFA 3AICA 4OJYA 2B7PA 3A47A 4U4MA 3RYSA 3M46A 3AIUA 3NWRA 3ARRA 3DFTA 4AH7A 2ABAA 2ODOA 3ABSA 3BC9A 3V0SA 3DKJA 1I2QA 1P0BA 4AB4A 4CUCA 2BX7A 2VM8A 5JU6A 4XAPA 1XINA 4ZR8A 5I7GA 1W3IA 4X0VA 4MB5A 3GKAA 1X39A 3GU2A 1EFZA 4O54A 2VJXA 3E0LA 4KERA 3KWXA 3BK0A 1UP0A 3ITGA 4B5SA 1IF2A 4KIRA 3O3RA 1QJWA 2FJKA 3I6EA 5D37A 2C19A 3ZXWA 2E5DA 5A3HA 3LN3A 3AIEA 3BJSA 4JIQA 4XZHA 2J66A 2Y5EA 3PJXA 1K9TA 3OVPA 4D1IA 3ARWA 1C9WA 3WUBA 5M17A 1IT7A 1TPVA 4JTTA 1PIFA 1GVOA 3AMCA 1ITUA 3CV2A 3GZ3A 4GQ0A 4MNJA 4P7RA 1WDQA 2XIOA 5BU6A 1OY0A 1VYRA 1L2UA 1R30A 5C2CA 2QV4A 5AYBA 4C6IA 5CBBA 4HNLA 2V6AA 5LXEA 4HMEA 3SQMA 2WJDA 1XBXA 4J2PA 4D6HA 1B9BA 3USZA 3A13A 2VMFA 1ZAIA 1H0IA 1WDWA 1FWJC 1G01A 4Y96A 1CWYA 5CJ5A 1G6CA 4RW3A 3QR1A 3FYYA 3IIPA 4MIMA 5C71A 1EEPA 2Y4SA 3V4BA 3TLLA 1VS1A 4Z2GA 3KDOA 5FF0A 4JCMA 4L61A 2IKJA 8CGTA 3HGSA 1OF6A 1TUFA 3PPFA 2BVTA 3OB8A 4TV5A 4GINA 2BGQA 3SIMA 1EF2A 4REQB 4W89A 3QSRA 3FY1A 3NEVA 1KXTA 4Y9NA 3WLPA 1KM5A 1DXEA 3IJLA 4QE5A 3M44A 5ABHA 7REQB 3VZXA 2E77A 1YTEA 3BAYA 2E6FA 3OIHA 2REQA 2FHBA 1UD3A 5FL0A 3BMVA 3VGBA 4U2YA 1I0BA 2QIWA 3AUJA 2WMKA 3N2MA 2DUZA 3GHRA 1DQWA 3W1TA 4GIEA 4JNMA 3AIBA 3KW3A 4YTQA 4HJWA 1QDSA 4IMCA 1FWDC 2A79A 5EYWA 4P8WA 4Q6XA 3IVSA 4I3GA 3BOLA 4C91A 3CK5A 3EMCA 1UMYA 5CJMA 3UA4A 2CHNA 3VMNA 3MSGA 4ZO9A 2XVPA 4AZHA 4J7RA 4K3ZA 4XWUA 4FNTA 3T09A 3H7RA 3PUDA 1XYMA 3U4FA 4XSMA 3KL5A 4C60A 2G95A 1UB3A 4V15A 2ZYFA 5CZKA 1OZMA 2XH4A 3W23A 1KTBA 4S23A 5K7JA 4ZGYA 2I5IA 3RCYA 5I07A 1K02A 4EOUA 3R43A 3D46A 4US5A 2NUYA 2CC0A 2DQWA 3AYRA 3CEUA 1BKSA 4H6QA 3WELA 1PPIA 2ZTKA 1NVMA 1AJ2A 1L8PA 3VI2A 1DE6A 1V3IA 2B0MA 2IUZA 2YXXA 3GIQA 1LORA 1CXFA 1O6IA 4FSAA 1LQAA 3WJWA 1O5QA 3VXGA 1G1YA 1GQJA 1V77A 5CSSA 3PBVA 4UUIA 1AJ0A 1JDEA 3LXBA 4FX6M 1MI3A 3AZSA 1IXOA 2UV8G 4PRTA 4N9CA 3IJ7A 3R89A 4YJ5A 4Q7IA 2Z27A 1VBUA 1W1TA 2YX0A 1QHZA 1TPEA 5F2LA 2H3BA 3C3UA 3E0FA 4W8BA 4UTJA 4WSKA 2PWDA 2CXEA 3BLEA 2YBUA 4S3CA 3SJ3A 1V6XA 1E0TA 3V5OA 3HFTA 4AZGA 2SFPA 3WLSA 1M7PA 3OQ8A 2HTMA 2PGFA 5D2XA 2WKLA 3LPFA 4HTYA 3WG6A 3OIXA 4H41A 2VC9A 4Y90A 4RE2A 3ITCA 4WRHA 4WDWA 2X40A 4XD3A 1JUEA 4H2HA 1NJJA 3K4WA 4AY1A 1NOWA 1M03A 1LUCB 4ZQOA 5TF0A 2D24A 1RPKA 2VEFA 4E38A 4IQJA 3P67A 1FUYA 2C13A 4CQDA 1KFBA 4IICA 3SUVA 2EKGA 1DBTA 4UZSA 2CZFA 3B9OA 2Y8UA 3A9IA 5EMYA 4CCDA 1PCKA 1EC8A 2CLPA 3VYLA 3EKGA 3P3BA 4GGHA 1JAKA 3B0VC 3EYPA 1JR1A 4N0RA 4O50A 2NQHA 1GQNA 3U9IA 1YXCA 3HPZA 4QROA 4TVDA 2OEJA 4AYSA 4AFYA 4S39A 3ATZA 5D9OA 3DU0A 3PWIA 1TFVA 3HMJG 2PDGA 1E73M 4QG8A 5BRBA 4XAGA 4JAWA 3WDJA 1UASA 2P5NA 3B0XA 5ABTA 3DBNA 2PRLA 1QI3A 4MFEA 3RJYA 3KBMA 1VFSA 1TTIA 2GVJA 3CHEA 3TCEA 5FSEC 3CAWA 5AY7A 5EY5A 4NI8A 1Q6LA 3W1AA 3U5YA 4HZ7A 2VD9A 1XIGA 2A6LA 3LRKA 3SCUA 5JQ9A 1LRTA 2QCEA 2AQOA 1H63A 4GUFA 2FTPA 3VKDA 1E9ZB 1EBGA 2PLMA 3KS5A 2H8ZA 3BURA 1H1NA 2FZBA 4REQA 2NV1A 1UJQA 4GO8A 2X1RA 4HN8A 3KM8A 3MY9A 1XKYA 1QXLA 3OA5A 5HJXA 1H3GA 4RDZA 3IRDA 4YCOA 1QPNA 3CL8A 1VLIA 3OLEA 4E5TA 4IGSA 1GHSA 3TXVA 1IYXA 1M65A 1ZBVA 1QW7A 3VGHA 1T99A 2B7QA 4M24A 3WLTA 1IT8A 2VYOA 4JL1A 5FL1A 5GQBA 4LCRA 1RBAA 4UTMA 3SN0A 1R9ZA 1S5WA 5AYYA 3LBOA 1KR0A 3W27A 3TYZA 1GVFA 2QPXA 2VX7A 3AQUA 1W9VA 4O28A 5FA5A 3MJMA 5CPOA 4GY1A 1PX4A 2ISVA 5J8LA 2O7QA 4CKQA 4YTRA 1Q13A 3LTYA 2D1ZA 3S1XA 2PP3A 1UZ1A 3TTEA 1Q6FA 4YXGA 3EWYA 4PCFA 3C5QA 3CHDA 1OG6A 1YDVA 4X0NA 4UFJA 3SUSA 2I9EA 1ZFJA 2BNJA 3NZPA 4C5YA 5EMJA 1XGZA 1W1VA 2HBXA 3ARVA 1ML1A 1BQGA 3PPGA 2BFGA 5HJYA 1GOQA 5A8MA 4MKVA 3U7BA 5HWJA 2JKAA 2WOQA 3IUDA 4Z2KA 3IJQA 4QP0A 4R33A 5AC8A 5DMMA 2RDWA 1GTEA 1NWUA 3DG7A 2WB5A 1LRNA 3MCOA 3QV7A 4O16A 4M6QA 1Q6QA 1QBAA 2QGYA 3M9YA 3RCMA 1OEPA 4J3TA 1SYTA 3SFWA 5FSDC 1UCWA 1N82A 1K6AA 2VX6A 1SFLA 3CUXA 3ONCA 3N13A 3CH0A 1NWRA 2P88A 4YU1A 1RALA 3NPUA 4A35A 3T1GA 3T08A 3UZYA 3ZR5A 4CN6A 2O4MA 2Z28A 2WO5A 3Q37A 4B90A 1Q6EA 3AIRA 3B8UA 1ZZMA 1LLZA 4AU0A 1MQRA 1EDGA 3QRHA 4N7QA 2WLYA 1RD5A 1C90A 1VIZA 1VEOA 4DZAA 2YA2A 3AU2A 4ICNA 4Q4RA 3APGA 2BOGX 1W5MA 4LF1A 2HNHA 3EX3A 2PUZA 1OB0A 3S83A 1RLDA 5RUBA 4NJHA 4F48A 3DHFA 2X1IA 5HUPA 3O06A 4JL2A 3POCA 3KOZA 2FPTA 1CGXA 2QUNA 4AISA 1M41A 1EP2A 1U30A 2GGGA 4ZFCA 3B40A 3FJLA 5E0CA 1LUCA 3E0VA 4JN6A 3E0WA 4XUGA 3EDKA 1X7IA 1Z44A 7XIMA 3TJLA 3VNZA 3CV1A 5BXRA 4YYCA 4FXFA 3UR7A 3HJEA 4UQDA 1X6NA 5FAGA 2HSAA 1GYLA 1IGWA 2XSAA 4PB4A 2BBFA 4KEMA 5KZ6A 4HA0A 1XUUA 3TTSA 4H1ZA 1S3TC 3QVQA 3ZMRA 5FJIA 1SFSA 1PKLA 1FFQA 1UZDA 4UQEA 3VKKA 2JFEX 4LUTA 4RPQA 1BVNP 4NRRA 8XIAA 3PJWA 2CBUA 4O0KA 5DY3A 5DF0A 5HR7A 1H51A 4D6IA 1HNYA 4IF2A 3W28A 4DJEC 1XYBA 2LLEA 4EPKA 2YIHA 5EA9A 4URIA 2P53A 3W24A 3URNA 3B9DA 3TZFA 4RR4A 4KEVA 4XAFA 1LQ0A 3LZ3A 3R13A 4EWJA 2QIIA 3B8WA 4QDPA 3KOFA 1IZCA 4JTSA 1DJZA 4LBRA 2HE8A 4AWEA 4RDYA 4FNSA 1WKDA 1FDJA 2VGBA 4LH8A 3VGDA 3W85A 1I2PA 3R8HA 2ZTJA 4DBUA 1GVEA 1A4MA 1A0DA 2FHFA 1DORA 1H5VA 1PTDA 1EGMA 3ZOAA 5EBAA 2WHJA 4DWSB 4PMOA 3MO7A 1GK8A 2CKRA 1UWQA 3BW4A 3NIYA 2AMGA 1EJVC 2POZA 3ZYZA 4GJ1A 3R11A 4JFUA 4F66A 2HVMA 4NJIA 2Y5SA 5B80A 3QFWA 2GVLA 3W70A 2ZX6A 2Q8ZA 4PE8A 2G8ZA 1BF6A 3WUFA 4AEOA 1XIMA 2J27A 2DSVA 1AG1O 5G2HA 5T8GA 3L4TA 4QSFA 2QF8A 1JQVA 3QY7A 3RIKA 1KM0A 3TWBA 1EC7A 3UWUA 3S5ZA 4DUXA 1R3VA 1OFBA 3OYXA 4C7GA 5IXEA 4XZLX 3UPMA 3GDRA 1V7YA 1P0EA 3BLDA 4O10A 3TYAA 4FXJA 1W17A 3WK0A 3UA3A 1W5QA 4DO4A 4PMJA 1C3FA 4L1XA 4FLQA 5C6MA 6TIMA 2PF0A 3ZLHA 5F1UA 3LTPA 1EZWA 1PX8A 4RDWA 1OK4A 3U6WA 2ZZ5A 4MY9A 4GKLA 4RUBA 2GWNA 3KFTA 1JUKA 4XK2A 5FF2A 1GVIA 2C91A 4M81A 5JIWA 1WOBA 1XLGA 3CIXA 1XC4A 2OLSA 4GH1A 2OCZA 3WY1A 1VHNA 5JBFA 3KZSA 1TELA 4JTUA 3KBSA 1GKQA 2PP1A 4FR1A 3K30A 3MUZ1 2YL8A 4V1XA 4NZ1A 4CQCA 4S1FA 1XSIA 2ZZ1A 2E8ZA 1CGUA 1RH9A 1YEYA 4R5EA 3L12A 2D23A 3NYDA 5K4XA 3ZO9A 3OODA 1IEWA 1ICSA 1QTWA 1SM9A 1GOOA 1IV8A 1FCVA 2CFFA 4XZMX 1GPFA 3RJXA 3RR4A 1E5NA 4Z1CA 3EXRA 4LVDA 5A6SA 2DZBA 1GKRA 4OBRA 4FOJA 2Y8KA 3P2VA 3U4AA 2JBMA 4J3ZA 2JEQA 3GTFA 3BLLA 2X1TA 3N29A 3EWXA 2NXGA 2G4JA 5FAJA 3H23A 2WK2A 5CC7A 3FA5A 3S9YA 5BOEA 3W83A 3LB0A 4FX8A 5FF4A 1E1EA 3BV7A 1JIBA 4M1BA 2HXUA 4CD4A 3EMQA 2FGZA 4JTEA 3CHCA 3WD0A 4HNVA 4UFKA 4QIUA 1EJSC 1P1MA 2J74A 1E55A 3MPGA 4M29A 7TAAA 2IXVA 2QUMA 4UTTC 2VD8A 1H1YA 1X1ZA 4XZWA 4IMGA 2CYGA 5KZDA 1DJGA 4ES4A 3LV5A 1G69A 3MW7A 3RILA 3GXIA 2QDEA 5REQB 3WMSA 5I3DA 1VH7A 3K1DA 3Q45A 5HDRA 2VWTA 2QJGA 5A69A 4I8DA 4QJ4B 2Y62A 2POTA 3TNOA 1LWHA 1GWJA 1T7LA 1XH2A 2ZQ0A 1JI1A 1RJPA 4WXZA 4CU7A 3AMLA 3SN1A 4E0CA 3ZM8A 2GGJA 4JOMA 4AD2A 3QOKA 1CGTA 2VO5A 1F74A 2YJQA 3TH6A 1QMLA 3N2BA 3S47A 1ZJBA 2AGTA 4NASA 1ESWA 1W1ZA 1AMKA 3W7GA 3W0KA 1O60A 1GOWA 3MWCA 4W7WA 5E6YA 2VFIA 4JFTA 4DWSA 3C2OA 1WO2A 1DE5A 4U5KA 2P3EA 2OZ3A 3ES7A 5I03A 3CZ8A 4O1AA 2J8FA 1JXKA 1TYGA 4IWWA 1HVXA 1Q66A 1HJWA 4K7VA 1H2JA 1JJKA 3DG3A 3UBPC 3EDFA 5A8QA 2V5KA 4ECLA 1Q63A 2ZZ3A 2EJAA 1G4EA 1J0ZA 1OM0A 2Y2WA 1W9UA 4PTVA 2GJLA 4UFLA 3M0VA 4KCUA 4F9DA 4ZZ9A 2XPKA 1UC4A 1SW0A 3P8JA 3WIJA 3VIFA 2JF6A 4O14A 1QASA 3A5VA 4IPLA 2QPSA 4PTDA 3VINA 1UH3A 1P48A 3IJDA 2YCEA 4WIWA 3ABQA 3EKZA 5D4YA 1YNYA 5BXSA 1UWSA 3BXWA 3WEZA 4A05A 5M2FX 2ZRZA 3H22A 4AVNA 3OZPA 2Z1XA 3HA1A 2TMDA 1RHCA 3WLHA 3BW3A 3NA8A 2A7NA 3QQ1A 4LX4A 4I9AA 1UIOA 2HV5A 3UESA 3RN6A 4C1LA 2XSBA 4DBWA 2PDYA 5I6SA 1KXHA 1CXLA 4UTIA 5G4HC 3UGVA 4TMCA 1SR0A 2ZZ4A 4EXAA 3TQPA 2VFHA 4D6JA 3OTRA 1QOQA 4KGJA 3OW1A 1MNSA 1Y7VA 4HNNA 4UTWA 4S3KA 1XWYA 3LU2A 4GO9A 3RPTA 2J6XA 1WBJA 2C8NA 4TX8A 4AD5A 2VOMA 5F1VA 4WEVX 2BODX 3TIMA 2NV9A 1ZJHA 4FIRA 3V36A 3LHTA 1YTKA 1H1ZA 3UPBA 1FWRA 4P2VA 1TJPA 1KFEA 1KBBA 4BEQA 1TJ0A 1AMYA 1KKRA 3CTTA 3UG5A 3S46A 5E09A 3YPIA 5DBUA 2WPGA 2A3EA 2VEIA 3S1GA 1E1CB 1EUNA 1UR9A 5HINA 3MUY1 1IEQA 5H8PA 4U31A 1OFQA 1A5AA 3HZ3A 2EPLX 1QI0A 1JGIA 4YWSA 5AECA 1ZJAA 2CLHA 3EB4A 3T42A 1K8XA 1W3LA 3TA9A 2J7BA 4PBGA 4QTGA 3S3GA 3PBWA 4GFSA 4B9ZA 2Z24A 3STEA 4NSBA 2NSOA 5AVNA 4DJDA 3OBAA 3OOQA 3NOYA 4XUYA 1QI2A 4QEEA 2I5GA 3RG6A 2BMBA 4M1RA 1TREA 2FH6A 3VO0A 3ZS4A 1R8LA 4ZEPA 3B06A 4HPXA 3B05A 3PS7A 3UR5A 5DCEA 1RXOB 4D6CA 3W1PA 1HJUA 4W4QA 3R5EA 6XIAA 2VC6A 3TTYA 4L5ZA 5FKYA 1Q6OA 4HPHA 2YFNA 5LNRA 2GZXA 1CTNA 4LRTA 4ML9A 4CCEA 1B3ZA 3P82A 3MC5A 3ZJKA 3MU7A 5GNXA 3W2JA 1QI4A 5D30A 4FLRA 4K8HA 3UXLA 4XBKA 4YYFA 3QJAA 2DZWA 5CSRA 4PMYA 5D38A 1QU4A 2GDUA 4Q8UA 4W88A 2CXGA 3GUGA 1P0KA 4Q3MA 3SGUA 4XAZA 1S5VA 2XIIA 2QS8A 2FZMA 3W6LA 1ZJIA 3PBYA 4MADA 4BR1A 4JQAA 2PWHA 2HBVA 3VM7A 4ZXLA 4JIRA 4M7SA 2XYLA 3QTGA 3AJ7A 3SCPA 2YLLA 5HMDA 4MPQA 2DSZA 3AFBA 3JW7A 4DJFA 4P61A 3NURA 5FJRA 5AYZA 4OHQA 3MDUA 2PDPA 2WKJA 3LG3A 2V68A 1MUMA 4DXVA 5D03A 4KW2A 3T8LA 4UBPC 4UTFA 1NP2A 2PZ0A 3MQTA 1J0HA 3WJSA 1A3WA 3K46A 3LQGA 4UXDA 2ESCA 2VC7A 4ZA0A 3KVKA 2BHUA 1I2NA 1GCYA 2JKPA 4MJMA 2WAGA 3A4XA 1FKWA 1XLLA 3EA1A 1E0VA 5AKQA 2EG7A 3TMLA 2I56A 1WZLA 3MI2A 5HMFA 3WD1A 1ICQA 4IM4A 3SRKA 5LA0A 1BLIA 2Q6ZA 4FB7A 3ICJA 3A3HA 1XKJA 4O15A 4XZNX 3SY5A 1UPPA 2QEZA 3BARA 3MYPA 5CQ1A 5HNUA 3N4EA 2PDLA 1NQKA 4CVUA 3C2RA 7ENLA 1RA0A 5IOBA 3APTA 3UETA 1A0EA 3OZOA 4HMNA 1OC5A 1XUZA 2JGQA 4A2RA 3RX4A 3MUIA 2G41A 2BVYA 3ITYA 2OB3A 3LHUA 3W1LA 2ZX7A 1AH3A 1TB3A 4G8TA 3EWUA 3SCWA 3PULA 2WBKA 1KQYA 4NZFA 1OG0A 4GIAA 2HVOA 1SZNA 3ZT5A 2ZBTA 1FWIC 4LBSA 4G6CA 4QJ3B 3QQ0A 3TYEA 3PFRA 1EYEA 3WLKX 3GTXA 2GSJA 4DUVA 5G1YA 2W4XA 3INPA 3N19B 1UWTA 3EXTA 4GVGA 1V0NA 2XZ9A 2XVNA 5CBJA 3UZWA 1HL8A 1TVNA 3C52A 4JX6A 3H24A 2CZDA 1XLAA 1XIIA 3LBMA 3I68A 1ONRA 1KM2A 1R9XA 1ZQ5A 3TEVA 2GQ3A 1S1PA 1O5KA 2GGHA 3FV9A 3MMTA 4L80A 5DELA 3L0KA 3T55A 4DX3A 1LZOA 1I45A 1OFDA 1V0KA 3KCJA 1D8WA 4JTIA 5KEZA 5I77A 2YDQA 2H90A 1Y5WA 3FGCB 1Q85A 2XVLA 3WH5A 4JQ3A 4ATWA 3VNJA 4O53A 1W91A 1CLKA 5IRPA 2W0UA 1EP3A 2NLYA 1I1WA 2PDKA 1X7FA 3AWOA 3DKLA 4R34A 2ZZ2A 2IKIA 4KFNA 4GWEA 3KHJA 3M0XA 2Q8LA 1TQXA 3CLMA 1YPIA 3QY8A 3PTKA 3SZ8A 4PCPA 3TN5A 1SW7A 3ELFA 3NL2A 3S1VA 3BLKA 2P3ZA 2H6RA 2F61A 1CZ1A 1VKFA 1UZ4A 3RNDA 2XM1A 3MT1A 1JCLA 2C6QA 1PO9A 2J8TA 4D6DA 3GXDA 2OYMA 1YDOA 4JD4A 2UBPC 4AVFA 4IIGA 3B0PA 3IUIA 1TPC1 4HYWA 5F7UA 3MBFA 3RLVA 4JXCA 5EMUA 1FWBC 4NJGA 2WXDM 2E68A 5K9XA 1MMFA 2NV2A 3VOJA 4QCEA 2FPYA 1JF5A 1YE4A 1V02E 2CHOA 1MUCA 4O13A 2VI0A 2W61A 4IGNA 4JR5A 4PB3A 5ABFB 3PZUA 2ZA2A 3VUSA 4EX4A 3WBEA 3LCFA 5BCAA 1LT7A 4X63A 1QOPA 3SUTA 3EX4A 3WK1A 2B4GA 2Z0IA 3QBUA 3WNNA 1J18A 3UERA 4PRRA 4J9JA 4J3SA 1BSIA 1M7JA 4NZ5A 2RKXA 1MSSA 1TSIA 5T9BG 4RNIA 3GG1A 1F3WA 3WF0A 2WJZA 1DV7A 3GIPA 4PULA 3CC1A 3QYSA 2DJLA 1R46A 3NR0A 4YIWA 3IACA 1YW1A 5AB3A 3HPFA 2WQDA 1MDRA 4IMFA 4O1CA 4GVFA 4LYQA 3N2CA 3GH5A 3I7QA 2OODA 3F2CA 3GHUA 4NU7A 1Q2SA 3B9EA 4B5XA 1HKIA 3THDA 2VKZG 2J7FA 4MG4A 3PJTA 3M0YA 3DYOA 3P7YA 1XSKA 5HAOA 1G94A 2DIEA 3WZ0E 3BGAA 3QSTA 3LCHA 2PCEA 2KZHA 1JEZA 1AQMA 3IRSA 2GVYA 1HW6A 4WHBA 4JY9A 1KM4A 3VD5A 4R85A 1R3QA 4C6MA 4OFCA 2CIPA 1KCZA 2D2HA 4IMAA 4WZHA 3S6DA 3GY1A 4W8LA 2X1SA 3LHWA 5MF5A 4YN5A 4UNLA 4G7EB 3V0UA 4W5ZA 3VOCA 3SY8A 3P93A 3VIOA 4U3AA 1J9YA 4GHRA 1R3TA 3LGGA 1DL3A 7ODCA 2ZDSA 3LA4A 1B2YA 3CBWA 3D5HA 2WSKA 3EOOA 1B5TA 3RMJA 3N1AA 4JTGA 2F7FA 3S1WA 5ECUA 1OADA 3H6OA 3W2UA 4DIAA 1IZKA 2WMJA 1WV2A 3OLIA 4LUSB 1SZFA 5E9AA 1WAUA 1ZENA 5AHIA 5D2VA 3E9AA 3MB9A 3W7MA 4Q32A 1ZY9A 1NELA 4MKSA 3RFAA 4UTHA 3OGVA 4R7JA 3SCVA 1E9LA 1J4EA 1LT8A 1S5TA 1GZJA 2VCBA 4L4LA 3S42A 4ZODA 3W1MA 3H7VA 3UJRA 3VC5A 3SUWA 3WDIA 3VNMA 3GU9A 5AC7A 2HE5A 4M56A 3TYCA 4Q8VA 3STGA 1HG3A 3RITA 4X22A 3GHSA 1LLWA 3RU6A 2YDRA 5DXYA 1EL3A 1E6PA 4H8VA 2A0NA 1TV7A 4D9PA 3QXBA 2CESA 1KCLA 3HG4A 1RP9A 3TFCA 1ZAHA 3GNPA 1LG1A 1TV4A 4QEHA 2V3GA 1SMDA 4RXFA 1ICPA 3IV3A 3O6DA 4KIEA 4LAZA 4XVEA 4Z1DA 3SN4A 4CVWA 4E8DA 1DYSA 1XQKA 1GJPA 4ZSUA 3S2JA 4RZBA 1JRBA 4AC1X 2CPUA 4ZE5A 5FD0A 3TK7A 1VRXA 3PZGA 3W88A 4WOZA 3HMCA 1C91A 4HSHA 3LRLA 4H00A 2OOGA 2QCNA 2ANUA 3SCOA 2ZRWA 4E3TA 2ZWYA 4GNVA 3W53A 4WJEA 1EOMA 2FIQA 4QXIA 5I0DA 4NIRA 3N3MA 4ZVJA 3BV4A 4LYPA 3V5CA 4FP1A 3DHDA 4R53A 4MOZA 2FZ8A 3KOYA 4I9JA 4OVXA 4E4PA 1A5BA 2YR1A 3DI0A 5DMLA 3TJIA 1ZB5A 5A2CA 2YSWA 1P1XA 4Z0JA 3B8DA 1OYAA 1IEVA 3BOXA 4EVZA 3N4AA 1IT0A 2R1PA 4ZB2A 3VGGA 1QUMA 2GJRA 4IT1A 3WUEA 3AJXA 4MAVA 3WBAA 3BAJA 2A85A 1D7FA 4XZIA 4BQ2A 1AW5A 3I10A 4OGZA 3FS2A 5ABFA 1MW3A 3T0TA 4NAEB 3OZMA 1J2WA 3WLIA 3FDKA 2WLZA 1QWKA 4TR9A 4ROQA 2NQJA 3TR9A 1RPXA 1TWZA 1Y8BA 5AOUA 1UOKA 4Q8QA 3LDVA 1YKWA 5HNNA 3C86A 4DM1A 1S2CA 4C6KA 2R82A 4Q4MA 4HB7A 2GVEA 1NDZA 3T8QA 3M43A 1J2BA 4GK8A 4CNNA 4AXKA 5H8UA 3KHDA 5C9RA 2O92A 1QNPA 3H2OA 2PTXA 4C6BA 5AHFA 1WXZA 6ENLA 3W2KA 1R3RA 1E71M 4O1BA 1QHPA 2ZUMA 1UPMB 2ZA3A 1N7KA 4KCWA 3M5VA 4WGHA 5G5IA 4A4AA 4F4RA 2ACSA 4DYKA 3OO2A 3GSMA 2O9RA 4IJCA 3Q2DA 3LM3A 3O6AA 1XLFA 4ZBCA 1YPXA 4PCTA 3D0CA 4NL1A 3WD4A 4YPJA 3O07A 3B9AA 4ZB0A 3DZ1A 5FEZA 4K38A 1AW1A 1NFPA 5I09A 3DN5A 2ZRVA 1B30A 3KL0A 3DYMA 2XG9A 1XG3A 1WZKA 3KTCA 2Y61A 3ONBA 3V16A 3QMRA 1OCQA 3UR8A 4RKAA 1SO5A 3W7LA 5E1QA 3UJEA 2QCHA 5G4WA 2YZ5A 1ZBCA 3MA8A 4W86A 5LIXX 5IM51 4Q4QA 3H8AA 3ZR4A 1GG1A 4DUOA 2X05A 5LGZA 3N6QA 4S3DA 2P1FA 2YW4A 4YL2A 3KBWA 2VQTA 4F9JA 1BFNA 3TJXA 4AHOA 1GZ1A 1H7WA 4Q8MA 1MEWA 4IP7A 4GI9A 1V03A 2PWVA 3WQ5A 2KAUC 1MNZA 1EXBA 1VBGA 1O1ZA 1HT6A 2TSYA 4UR9A 4UFHA 4F3HA 3QR0A 1ZGDA 1DXFA 5BWAA 5ABGA 3WQOA 4IUGA 3N14A 1KTCA 4AIBA 3G1DA 3KL3A 4OTKA 5A6JA 1EDTA 1JCMP 4EAMA 3PZNA 1US3A 5FF7A 2YZRA 4GE8A 1CDGA 2AMXA 5FJJA 1AL7A 3AHXA 3M5YA 4P8XA 4MY8A 3DAQA 1OHLA 2DVUA 3OVRA 3KCOA 3WBYA 3REQA 1JYXA 3QW3A 3FAWA 1ECEA 1KWKA 3NL5A 4MPKA 4CD8A 1DWHM 3GZAA 4WF7A 1BG9A 2BGNE 4HZMA 3UNDA 4AAJA 4UTLA 4B5UA 1UQYA 2WZTA 3NL6A 3RX2A 1V3MA 3CZGA 1TIMA 5F4SA 3O1NA 2VOTA 4CQ8A 3E5BA 3GC4A 4EK7A 1LG2A 1N8WA 3LGEA 6REQA 5AFDA 4XZ9A 2RH9A 1IGSA 2O0TA 2TPSA 4IZGA 1R3YA 2QF7A 1JYNA 1TZZA 3VIKA 2QULA 2Z26A 4JEJA 3I7RA 5HWNA 1H62A 2WSQA 1QWGA 3HTWA 5F2GA 1TPFA 2BY0A 1XYLA 3HPAA 2O4QA 2WHLA 3M1ZA 4J5NA 4C6OA 2HMCA 2AKMA 3AYTA 2YYTA 5HQMA 5CJNA 3TOYA 4IG2A 4LCQA 1WX0A 1ME8A 3OU8A 3OVQA 4IPIA 1A80A 2WWCA 1JZ4A 1N8IA 3DGRA 4JKMA 2CLLA 4CNUA 1L6WA 1BWVA 4N6FA 2G96A 3W01A 2EPKX 3K13A 5H6HA 2GDVA 4GBDA 4CNTA 1JXJA 1QNVA 3LENA 1G4TA 1V5XA 4GI8A 3FX4A 4LUJA 3CH9A 5FJPA 3C2FA 1JNEA 1GGOA 3C8NA 3N04A 3NUKA 4PMNA 2V2DA 1XLMA 2PGEA 1IHIA 3P6LA 1D8CA 5D9PA 4DNHA 3V1HA 4V33A 3F5LA 4TV6A 2O9TA 2WZEA 2PDUA 3NSMA 1R47A 4EPEC 3DIPA 2A3CA 1B3XA 3H7UA 4B92A 4U3CA 4DJED 3PC0A 1WUEA 2QW5A 4AIEA 4FNRA 1G5AA 1FWEC 4MFDA 4NNCA 3FIGA 4PMRA 2AL1A 1Z7AA 3L67A 3W2NA 1A5NC 4PFHA 3UT0A 3M0KA 4ZQCA 5H8MA 3E5PA 3G22A 2YDAA 2BXZA 1A5LC 5JH2A 3D3AA 1A49A 3CUIA 3K2GA 1NP0A 2ZUNA 4PUJA 1F73A 3IANA 3E96A 4JYEA 1EYWA 4NRSA 1FKXA 1WXJA 4GQRA 4BWLC 5CBIA 1NDYA 2WVVA 4UQBA 1Y5VA 4GYPC 4GJIA 2C16A 4HHLA 1ME7A 3VVGA 3CQIA 2EG6A 1YDNA 3PVFA 1N2VA 4LS2A 3CXOA 4DN1A 8TIMA 3DDMA 1W56A 3THQA 2X7WA 1UW9A 5I3JA 1CX9A 4JBRA 3N73A 3ZWSA 3B04A 2FPVA 4GCAA 1GTHA 1W1PA 1K03A 2FB2A 3DFOA 1ISZA 4HPGA 4UCGA 5GVJA 3QYQA 4AZIA 1V3KA 1EJXC 3UZ5A 1UR8A 2QCDB 4A3YA 4NX0A 4L6OA 5DRIA 4J35A 1FWWA 3ARSA 3ZVHB 2QUUA 4IP4A 1C7TA 2MANA 3B8SA 3SCTA 3BPWA 2VEKA 2ONEA 3KP0A 1LBMA 2E9BA 1KRBC 1QW8A 3NL3A 3O0FA 4H01A 4C6EA 2OKTA 4D6EA 1V8EA 4WY0B 2RDXA 3QKZA 4DO5A 4F8XA 4AMAA 4F2TA 3MUCA 4KWVA 1E9YB 3MZ2A 2OSWA 1GORA 4PTNA 2PRMA 5KETA 1B4EA 3N25A 4LVGA 3T2QA 3BLIA 3G1SA 1PZ2A 1V93A 1OWQA 1SO3A 3GH7A 3WYZA 3PBUA 3OLDA 4A8RA 3VK5A 5CPLA 2Z00A 1C9DA 4JIEA 3UPWA 1V3HA 3RLHA 4XBJA 4UMBA 1UH4A 3ANYA 1GKPA 4IL2A 2PEVA 1IZJA 4GNJA 1ZP3A 1UBSA 3M7WA 2PODA 1Q5MA 2PB1A 1UOZA 5DBTA 3CO4A 1NF0A 1P0DA 1UR3M 1T8QA 3GE7A 3M47A 3L4XA 1UROA 3CHVA 4ACYA 1U33A 1XP3A 2BXYA 4Q22A 3KE0A 5BXTA 2C1HA 3M0ZA 2I9UA 2QJHA 2WQPA 1T41A 2E4TA 3C2VA 3CUZA 3CPUA 3BAWA 2J47A 4NG3A 1KB3A 4Z2IA 3VUPA 4UMAA 2XUCA 4H04A 1CI1A 4B9YA 1E43A 3EPNA 2WCAA 1L6YA 4JKLA 4YS1A 4B5VA 3GBDA 3IVUA 2QR6A 3C0SA 1ZP4A 4QE1A 1TIWA 3GXMA 3H70A 3TYDA 1O5XA 4JHOA 3IIOA 2YB4A 2YCJA 3ERPA 5C9WA 4NYYA 3AO0A 3QPZA 1K7EA 3I3EA 3LPGA 3L4YA 1JGMA 3RPDA 2OMAA 1AVAA 3FXYA 3K8MA 3WQWA 3W4RA 5C2XA 2PPGA 2H9AB 2FJUB 2QQ6A 4UIOA 2IMRA 5D2TA 2FGLA 2PDFA 2IKHA 3AYVA 4AIOA 3WLLA 4HPJA 1S2VA 3IUHA 1M6JA 4BA0A 4QR6A 1GEQA 3LI0A 2WSYA 2XIBA 4GNKB 2C71A 3GFYA 4EIVA 3CLWA 2C7FA 2C1GA 5E70A 4JTFA 1K8ZA 1S38A 4ZQPA 2C18A 3MP3A 1PHQA 5CZ0A 3UXKA 3U3HA 4CQ9A 5L9FA 3QV6A 3NG3A 1FCQA 3IAQA 4TUFA 3WJZA 3IEBA 4GABA 5DEZA 3E49A 4A3UA 1V3JA 4JTRA 4PZVA 1KM3A 4Q33A 5HPCA 3G0UA 4PC8A 3QGVA 3TAKA 4MY1A 4KF1A 4PUWA 3PTQA 3TROA 5IBXC 3DESA 3M6YA 2G3IA 3AYSA 2W91A 3B4UA 1FWNA 3M0IA 3NQCA 1CB7B 3M5XA 4B3LA 1GQLA 3FKRA 1A50A 4GFIA 3BZJA 2G5WA 3LHZA 1S46A 1JFXA 4H9TA 4GG9A 4LYKA 4XG1A 4ML4A 4DB7A 3WF3A 1XIJA 4ZTXA 1F3EA 1G67A 4YVXA 1PWMA 3GR7A 1KGWA 1NARA 5I2UA 2IQDA 4FXRA 4L1WA 3GVWA 1D3CA 1MEHA 2NLIA 2BDQA 3QPYA 5CLTA 3NVTA 4IXHA 4PFMA 5JIPA 1M68A 1VYPX 3A4AA 4YTSA 2QCDA 2E6YA 1OK6A 2D2GA 2X0HA 2NUWA 3A9BA 4PL1A 3ZVHA 1ADOA 5G1MA 3PJUA 2ZUSA 3JR2A 2OZ0A 3MMUA 3TC6A 5EMLA 3RO6A 3GVGA 1O1HA 3LOTA 1KTNA 1P0NA 3SW6A 2XVGA 3CQHA 2ZE0A 2V5CA 2BG5A 2P10A 4XO7A 5LA1A 3S6OA 1E6SM 2VUNA 2CW6A 1OD8A 5KTLA 3NJ3A 3HM7A 3TP4A 1TR1A 2BZNA 4B2DD 4IISA 4AD3A 1B54A 1IIGA 4UFMA 3FDGA 2E9MA 3R6IA 2PDWA 3S0CA 3KBJA 4JQ2A 1ZU8A 3QOMA 4FAMA 3K8KA 3MI3A 2DFAA 1BD0A 2PTZA 1OC6A 2Z2AA 4XX6A 1XLDA 3S2CA 1R2TA 4QAIA 4NT0A 3VX1A 2NWSA 3WBWA 3KVJA 1RP8A 1FWAC 3ALFA 5D8WA 1E51A 2VFDA 1XR2A 2FH8A 3GG7A 3QQWA 2I14A 4UOQA 1MRQA 4HHMA 3R8RA 4JY8A 2EQDA 5G1TA 3NQBA 1K6WA 2P8CA 1OX4B 3WDRA 4JTLA 4W85A 4KQNA 3CIVA 1EGVA 1F6YA 5A2BA 1PJ9A 4KWOA 4R7WA 1CIUA 1HJQA 2PDHA 3ATYA 2AL2A 3S2MA 3CAVA 2PC4A 4K6AA 2PTYA 4WSJA 2YBTA 4L56A 1QNSA 3EXSA 3MP5A 2A5HA 3ZZ1A 2BY3A 5EGRA 2YLAA 4MGGA 1RBLA 3SADA 1M9HA 2XDFA 4OUIA 5TAOA 3LY0A 3L23A 1P7TA 3E2VA 2D2JA 4HNCA 1JCJA 1B3YA 1T6MA 4DJDD 3G77A 3W9ZA 1KFLA 2FDSA 4OT7A 1VENA 3AIWA 1E40A 4XD4A 4PEEA 1H09A 3L9CA 2P8BA 1XM3A 3A64A 2Y24A 3KRZA 1WQ5A 2FQIA 2YCLA 3G1YA 1JPHA 4MVAA 2D0GA 2Y8VA 2XFYA 4JCLA 2X1UA 1AFSA 1I6NA 2XFFA 4NVTA 3R25A 2NT0A 3ARYA 2PDBA 5IFPA 4M6UA 3DFNA 2CCRA 3PNZA 2PS2A 1GYMA 1DOSA 1SJAA 1O68A 1WBHA 3GX9A 2XHYA 3DFQA 4J1OA 5HWMA 3NZGA 2WSRA 3DBPA 3QC3A 4UTUA 4K8GA 4ILSA 2DU2A 4JTQA 4KRZA 2FTYA 1KFJA 2EO7A 1XLCA 2QGHA 4XD5A 4HPNA 3IJIA 1VCGA 4GUGA 2Q3RA 1QNQA 3MHUA 4US6A 1EC9A 1VLWA 3K1GA 1H7NA 3ABXA 4FNUA 8XIMA 2RJHA 3GVRA 2V3EA 2PF8A 4B4FA 2ZZ6A 6XIMA 1XLHA 4ADUA 3PZMA 2W79A 5IDZA 4F0RA 2OKOA 2XN2A 1YX1A 5HA7A 2QKFA 4UNIA 3S1UA 3CTLA 1M53A 1ZSXA 1PHWA 1H50A 5I06A 1POKA 4EANA 4KGLA 3MHGA 3PAJA 3H4XA 2DUAA 4JKKA 5DANA 4BQ4A 1T8XA 1J6OA 1PWLA 4E2VA 2HISA 5CC3A 5FEPA 1YBQB 4MWAA 2GQAA 3PZQA 4ENLA 5HK4A 2YDSA 3WNMA 1KXQA 3T9PA 2ZE3A 4JQ1A 2G3NA 3SY1A 4FZIA 5ECVA 4ZB5A 4GIRA 3PZ9A 4JFWA 5DY2A 4MDOA 3UCCA 1TMLA 5I3HA 1AUSL 1XYAA 4LFYA 2QZRA 5A6AA 1Q4NX 3CB3A 3HN3A 3W7OA 1LOQA 2WC7A 3F5JA 1UWRA 1R9YA 1TZ9A 3SRFA 3W7IA 1JL8A 3GK0A 3F1QA 4TX6A 4A21A 1W2PA 1FCUA 2XIJA 3EEGA 1TV3A 3QGKC 4RZ6A 4K8EA 2DZTA 4GZJA 4GRSA 2WZMA 2IQ0A 1KBIA 3HU7A 1BGAA 4IPJA 3W81A 3NO1A 5LIUX 4DLFA 3KRBA 1QCWA 2O9PA 4P7QA 4RW5A 3THUA 2WSPA 1XIEA 5D9MA 2PLJA 4HCHA 3CNYA 4WY0F 3TTOA 1XDMA 2FMOA 3ORWA 5HMSA 4MJ2A 1SFTA 1FH7A 4WLCA 2JALA 5B7ZA 4LS1A 5TIMA 2OEKA 3HG5A 1RA5A 3KEHA 3WMLA 1DPMA 2GK1B 3FNDA 3G8EA 3L4UA 2C14A 3T78A 2Z1VA 4H6KA 3QGAC 3GU1A 1TE1A 3GG8A 1TA3A 2TAAA 4ICCX 1I1XA 4V1YA 4LBUA 1BRLB 1BTCA 4UR7A 1HJVA 4HNTA 1Z42A 2E28A 1I2RA 2NVDA 1OX5A 1FP8A 1DWIM 4PUUA 1AODA 1VEMA 1UYQA 1KO0A 1XV8A 1ELSA 3DFSA 3EOLA 2VDGA 4R9OA 3CU2A 2F6UA 2PA6A 5PTDA 4IIHA 2V67A 2XH0A 1PTGA 3T7VA 4RPPA 3PSWA 4DY1A 3BGJA 4KRTA 4LCSA 1PKNA 1UR0A 3C2EA 1X96A 2QVHA 3VDCA 2Q09A 2D22A 1KM6A 2I7GA 1A0CA 1ZS2A 3FA4A 3ZT7A 3ZJ6A 1EQPA 1EP1A 4IJRA 3BSHA 3M4HA 2CWXA 1OCBA 1YNPA 1VPQA 2WPBA 3Q4DA 1CW2A 2QDHA 3HG2A 1JYWA 4CD6A 3G1FA 3SDOA 3USBA 1XC6A 3T05A 6A3HA 1WYIA 2XFWA 3LUTA 3EWWA 4WVXA 5H91A 3B97A 1JZ7A 4YTTA 3HBLA 1D9EA 4L9YA 4CU6A 1PSCA 1XCWA 4NZJA 2P0OA 1GUVA 3GDKA 3VKAA 4GQBA 2PDCA 3WD3A 5D04C 3S2LA 2CNCA 2A21A 4HK7A 3AS2A 3ARXA 3W74A 1YRRA 4NZ3A 2PSNA 3AXHA 3T4WA 4JDYA 1XL9A 1UKSA 1H41A 3JVAA 2FTWA 2J6VA 4S3GA 1GT8A 4DI9A 4W8AA 2Z7GA 5KZEA 5HMEA 3WQVA 1JULA 1J10A 2HWGA 3O2LA 3W82A 1WA3A 3K4AA 3N12A 4K7YA 2Y1HA 3OP2A 1D3GA 3CGTA 1EHNA 1NAL1 3DERA 2YB1A 2VDHA 3UCQA 1W1A1 4GX8A 4DPQA 1GQKA 2YCIX 2BGSA 4DF2A 3C8FA 4QJ5B 4ERIA 3UCDA 2FVKA 3GDTA 2GL5A 4OZOA 2V2HA 3PZIA 1US2A 3BJFA 2QXWA 4OKDA 1XJBA 3PZVA 3SBFA 6PTDA 1HO4A 2OX4A 4O8AA 3ZFHA 3XISA 4C6NA 1VF8A 1DJHA 1FP9A 3II1A 1G9HA 3WLNA 1Y0EA 1JPIA 1X8FA 2INEA 4H9MA 1ZHAA 5EKYA 3WENA 1EHAA 1NWTA 4WJXA 1YLVA 3F4NA 3NDZA 1YBQA 4AW7A 4PMDA 1J0IA 2QAFA 2VXNA 3EDDA 2W6RA 2C0HA 1VP5A 4PUNA 3R94A 3FSTA 2H3DA 1M01A 5AZ1A 1O66A 3GR8A 4OQVA 3BSGA 3O16A 4MJ4A 1VEPA 4HU8A 4IFKB 1F3TA 5LHEA 4P7NA 5A94A 3G1RA 4L9XA 3QF0A 4C1KA 5HJLA 1U5HA 1LYXA 1UD5A 2WMGA 1W3JA 2OO6A 2XFRA 4OBSA 1NSJA 2D0FA 4LEQA 3WK3A 1K8CA 1AL8A 3QMTA 3LNPA 3FJ4A 4A8IA 1JCYA 2NQZA 3FVMA 1HKMA 2DQXA 2XIMA 2PZNA 3UJFA 4DLMA 2DT0A 1K4GA 1TMHA 1XRVA 3H54A 4HZ8A 7REQA 1R87A 3WLOA 3NPVA 3UWEA 1MQQA 3U57A 1F7BA 2EPOA 2ZCGA 3QLLA 1EJTC 4HOXA 1IXNA 3BLFA 2BB0A 9RUBA 4JZ5A 1O4UA 4M0XA 3G6LA 4MSSA 1XD1A 4OIFA 5M3WA 3AXXA 3NOEA 3WQEA 2VZUA 5E0KA 1EDQA 1WDRA 4MYAA 3IS4A 2PLCA 3J7HA 3LYEA 2NT1A 4EPBC 4KCVA 1AQFA 5BRPA 1PTAA 1AH0A 5C7VA 3I6RA 4OUEA 4Q7BA 3N9KA 1BRLA 1PEZA 5DX7A 3UG4A 3UG3A 3UF9A 4DZIA 5CAHA 4FOKA 4YWIA 3UWZA 2EKCA 5BYWA 2NX9A 4MZ8A 3IGXA 3GXPA 4FA3A 3ANUA 3H21A 4XISA 2NSXA 1W5OA 1XYFA 3EAUA 5D2YA 2E3ZA 3PHAA 5LSMA 1OQFA 3HF3A 1JDAA 3SO7A 1E6XM 2JF7A 1S2UA 4WXYA 2PDNA 3DCPA 4C1NB 3PK7A 5GNZA 4TMBA 4EKJA 3KOWA 4P8VA 3A3WA 4GYPA 2W5FA 1IR1A 2I57A 3S4TA 3AAMA 1CEOA 1GVRA 1KRCC 1SZGA 2G4FA 3PZTA 3ITTA 1FHLA 2HJPA 2V38A 2FKPA 5A6MA 2J77A 3NZQA 3T0DA 1Q6DA 1ZUAX 1FHVA 1GNXA 1FQ0A 4TTUA 2QPUA 5AZ0A 1ISXA 3TC7A 4JEQA 1TKKA 3COTA 4B5TA 3QFEA 4BKNA 4C90A 2UY5A 2A7RA 1DJXA 1MDLA 3MUAA 3SECA 2XIQA 3BUVA 2PLKA 3MSYA 4PEKA 1WOAA 1REQB 1LWIA 2VEGA 4NAFB 4YHGA 5A8OA 3LSCA 5AHEA 4XKYB 5EPDA 4O11A 1IQ8A 5D09A 2ZC8A 2VENA 4PCNA 4ZCWA 4RV8A 3FLUA 1SJCA 5HNRA 4WQ6A 3NTYA 3SJNA 2Y89A 1JQXA 1H60A 2G97A 2PDMA 4AZCB 2X7VA 1KRMA 2OU4A 2DY3A 4OBTA 4J4KA 2EPHA 5C5YA 3BICA 1YE6A 3JRKA 5FI8A 3B8TA 3BWWA 3N17A 1RVKA 1HZYA 1OC7A 3CUGA 3AMGA 3R10A 3TSMA 2XGBA 2PGRA 1HKWA 4ZOAA 1SGJA 4K36A 2ABBA 3UZJA 4HU0A 1MXSA 1BYBA 4V27A 4MM1A 1XCFA 3KRUA 2QHAA 5CPMA 2PWGA 1DIDA 2Z1SA 5LYRA 3VIGA 3ECQA 4Q8WA 3N15A 3Q58A 4Y9OA 3LZ5A 1A5OC 2QUTA 5K9DA 1PS9A 3DHUA 5DN1A 1PBGA 3KXQA 3BE7A 1QO2A 4W5UA 4HOWA 1W5NA 1B57A 1SVDA 2BHZA 4C6FA 1VAHA 3WF4A 3ARPA 3VNLA 2DVTA 1RY0A 2DW7A 2PTDA 4BI6A 5CGMA 3QEZA 1EXPA 2ZZ7A 4Z2JA 4LWWA 2WJEA 1ONWA 5FEWA 4O1FA 5AHMA 2EXOA 1CPUA 1Q3NA 2WM0A 4HA4A 1D3HA 3UG8A 5FESA 4XKMA 2QAPA 2ZC1A 1P6WA 2BOFX 4H9ZA 3A3XA 4C6LA 1K9DA 4NILA 2J7GA 3VNYA 3CAQA 1UA7A 4Q4SA 3U0HA 2FVMA 3DX5A 1IR2A 4W7VA 2RGMA 3TSDA 4QLLA 4KFPA 1H7PA 3VKCA 3VOFA 2QJMA 3A21A 2EJ1A 4HVXA 3TTQA 3MCMA 4QQ3A 4HQVA 1A5CA 1UIPA 4L65A 1H7XA 1L0PA 3BSMA 2ZADA 2XVKA 7TIMA 2PBOA 2P76A 1RJQA 4ORIA 4PTWA 2VR2A 1NU5A 1EOKA 1H5YA 4FLSA 4UOZA 1JUBA 4O18A 3LRMA 4JYFA 5IFTA 1UBPC 1IWAA 1XBZA 1FOBA 2PE4A 1M1BA 4B5WA 2WMIB 4MB1A 4O12A 1W1YA 3RDKA 3CM4A 3PPCA 3I4EA 4Q4KA 4L6DA 2F84A 3QY6A 1UWIA 3PSVA 1PZ1A 3GQYA 3PB0A 5CZTA 3SSJA 4E8CA 4TQTA 4Y9PA 1EO7A 1F6PA 4FS9A 5FCZA 4HTBA 4KRUA 3NZ1A 1Z69A 2P50A 2XM2A 2L5HA 3NXLA 1O7AA 1MQPA 1BKHA 4R88A 4HBKA 3TQKA 1LOSA 1H61A 1TTJA 4EACA 1JVNA 1VJSA 1GONA 2OXNA 4C1NA 1I2OA 2WZIA 4O0QA 8RUCA 3EA2A 3I7SA 2QUVA 3VX0A 4GVHA 3W7RA 4Y7EA 4L4OA 3E2SA 4HGXA 1JDDA 4IX2A 2VVNA 1KD0A 1EIBA 3W7CA 3V3WA 4O1DA 2GUUA 3KP1A 1EWDA 3OG2A 2GSEA 3CYVA 1TPUA 2Y7FA 4LALA 3BQ6A 3L5MA 3ZLGA 4B4HA 4MB4A 2R1NA 1WDPA 3GKFA 1OIFA 4QE4A 3TYBA 4CQBA 2WVTA 1CGYA 3NSXA 2GPTA 1REQA 4IGHA 1KBLA 4GZEA 3UU0A 2RGLA 3LNMA 3BVJA 1LJYA 2OELA 4BF5A 5LIKX 2QDGA 3TLQA 1H0GA 4BY3A 2E25A 3B0YA 2WANA 1DWFM 1I0DA 4AZCA 1W5PA 4I6KA 3P5ZA 1W37A 3RM4A 4F0HA 3PG9A 3DGBA 3T2PA 4Z0SA 3VOIA 3CUHA 2OZTA 4X61A 2VGGA 4UQCA 2DVXA 1X1OA 5EB8A 5ENLA 2XZ7A 1QATA 3NO5A 2CHRA 5BZAA 1NOFA 3RLGA 1PX3A 1MW0A 1EPXA 3NQDA 2XTKA 1Q7MA 3R8GA 2PCQA 5J5DA 1EB3A 2E6DA 2X0SA 1J12A 3TW6A 4P7LA 4ZL1A 4ZQRA 1CXEA 4JIIX 4S38A 1EF3A 4F0LA 2CERA 2DT2A 3LEPA 4TTGA 1QHOA 1J01A 3VCRA 1QW9A 2E67A 1FWHC 4YHEA 1IEIA 5KZMA 1LDCA 2D20A 4RK8A 5DMNA 4LYRA 2E0PA 2Z6IA 2DZPA 2GDQA 5EU9A 2Q02A 2REQB 1PVNA 4JGDA 4IMDA 2E8YA 1EJRC 2XISA 4KT2A 1GOKA 2ZX5A 1OABA 1GEHA 3NM1A 1I8JA 3LBCA 1SZEA 4A8NA 4YMZA 1DQUA 1XLKA 2Z25A 4EF8A 2FFCA 1M7XA 1TJRA 3VABA 1K3UA 4D2JA 1FX6A 3VZYA 1VBJA 1VPYA 1RQEA 1B3WA 4M82A 2ZX8A 2DEPA 1DKWA 4IGMA 4Y8FA 2FDMA 1UKTA 4JICA 5LNSA 4JFVA 5DO8A 4FALA 1LRQA 3POHA 4F2BA 3PZOA 1QK0A 4PMUA 2NQ9A 4IQDA 3RRXA 1OGBA 3AOFA 2JKEA 4KKXA 2GJNA 1TPDA 3TW9A 3MS8A 2Z1WA 4M3PA 4PMVA 1FVPA 2PTWA 4DWSC 3SURA 4JS3A 3EDJA 3THAA 1OIMA 1JF6A 4PSRA 4AYGA 4GX9A 4L7ZA 3UQNA 4Y2WA 3UGRA 1FH9A 1U22A 1X38A 4H6EA 2PD9A 3IPWA 1TE6A 1JCXA 1RK5A 4MJZA 3RR1A 3VU2A 1F3XA 3AALA 4LEFA