7PTDA

Phosphatidylinositol-specific phospholipase c mutant r163k
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
296
structure length
296
Chain Sequence
ASSVNELENWSKWMQPIPDSIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKKYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQDKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQDYINEKWSPLLYQEVIRANKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
publication title Probing the roles of active site residues in phosphatidylinositol-specific phospholipase C from Bacillus cereus by site-directed mutagenesis.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
total genus 92
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1997-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 7ptdA00
4I9MA 4RV3A 4QJ5B 4RW5A 1DJWA 5T91A 1DJGA 4PTDA 2PTDA 3L12A 3V1HA 4I9JA 2OTDA 2OOGA 3EA3A 4QJ3B 1DJHA 3KS6A 3H4WA 3EA2A 1QATA 2O55A 4F2TA 1ZCCA 4R7OA 4RW3A 4Q6XA 1DJZA 2FJUB 3QVQA 3KS5A 7PTDA 3H4XA 2F9RA 2PZ0A 2ZKMX 3EA1A 3V16A 4QJ4B 5PTDA 1DJYA 2P76A 1V8EA 5T9BG 3NO3A 3QR1A 1AODA 1PTDA 4F2UA 1YDYA 5T9CE 3CH0A 4F2BA 1O1ZA 3V18A 2PLCA 1T8QA 3OHMB 3RLGA 1T6MA 2OR2A 1GYMA 3RLHA 1XX1A 4I9TA 3I10A 1DJIA 1PTGA 4I90A 1QASA 3MZ2A 2ISDA 4I8YA 1VD6A 4GNKB 4S3GA 3QR0A 4OECA 1DJXA 6PTDA 3PTDA
chains in the Genus database with same CATH superfamily
2DH3A 3WMSA 4DJED 1BD0A 2WHMA 3IJIA 4LQ1A 1OYBA 2PB1A 1GZJA 3WQ8A 1XD1A 1ECQA 4W8AA 3SRDA 3TTSA 2OLSA 2GLKA 5E93A 3BSGA 2J7EA 3UWVA 2ZA1A 1A4LA 1XJBA 1UJPA 1XH0A 4JR5A 5HATA 1ITUA 2Z7GA 1KCXA 2A7NA 4NASA 4RNFA 1E4MM 2FVLA 3WLIA 3AXIA 2OZTA 2WKJA 2J6VA 4JXCA 5XIMA 1UZ4A 2DQWA 4HKPA 1MW0A 3K4WA 2GOKA 3MW7A 4M6PA 2PUZA 1JZ4A 2RHGA 2GQ3A 2W91A 4LBSA 1OQFA 3SRKA 4M80A 3ONCA 3BSHA 2XFYA 1OCNA 1QT1A 3VOHA 3HG4A 3W26A 3DHUA 1TV5A 4XVDA 1EEPA 3MPGA 3WQ6A 2E25A 1SZNA 1DHPA 2Y7EA 4BKNA 1UP3A 4V33A 1AW5A 1HZYA 1H7OA 2QMJA 5C9XA 3NM1A 2FPYA 4FA3A 4MTVA 2E40A 5JU6A 5CPMA 1Y8BA 1U5HA 2YA1A 1JUKA 4YXGA 5C6MA 3NXFA 3IRSA 5LNVA 3GW0A 1XYZA 3PG8A 3VNLA 1S2CA 4JYFA 2ZRYA 4GYPA 2DUZA 4O18A 4M29A 4ACZB 2EKCA 4N42A 5BMWA 4YWSA 1QPOA 1JDDA 2VCCA 4QAIA 4M5PA 4QXIA 4D8ZA 5EBAA 4GI4A 4A21A 3GQYA 1AMKA 4NJKA 3HF3A 3PVFA 4EVZA 2CWNA 3RCMA 1CX9A 1G94A 1CIUA 2XVPA 1KFLA 1R3WA 1X8CA 3T0DA 4GUGA 4U33A 1Z44A 3QQWA 1VYRA 3L0KA 3WDQA 3W25A 3NQVA 2X1SA 1V6TA 4Y9PA 3MJYA 4UOQA 2TSYA 3ANVA 1DORA 5FJPA 2FHFA 2PDUA 3IGUA 4H8NA 3FA3A 2OQHA 2QDHA 3W2KA 3SN0A 1Z8AA 2O92A 4QJ4B 1LBFA 3PTKA 3GHSA 3NOYA 3R0KA 3A3WA 1R5YA 5I5RA 4Q7NA 4AF0A 5B7YA 3D47A 4GIYA 4A3RA 3VZXA 3CL7A 1RBAA 4Q6JA 1GVIA 4FXRA 1NTHA 4PFMA 2OELA 4R27A 2OCZA 3N9KA 1YDOA 4RE4A 4AB4A 2EHHA 3NR0A 1UR0A 2C71A 3GXMA 1M9HA 4IIDA 1DOSA 1ZLPA 1MWOA 2WNQA 3L23A 4K8HA 2HE8A 1EGMA 2IKHA 3W53A 3M07A 4L9ZA 3HJEA 4I9MA 1OIFA 1YIXA 4LB3A 4ZTXA 4NL1A 1AL7A 3NJ3A 3ITGA 2EAWA 2ZRUA 3CV1A 3L5LA 1DYSA 2QKFA 4MB5A 4QJ3B 4NAFB 1PKYA 4Z2KA 3V36A 3W4RA 2ZFAA 1R7OA 2VC6A 1EJRC 3REQA 1JGIA 3LHYA 3GE7A 2OYKA 3CIXA 3T40A 2WMJA 3L7RA 3VM7A 1UWAA 5C2XA 1T96A 3WL0A 4RW3A 5RUBA 1QJWA 3T7VA 1V0LA 1PDYA 2YA0A 3FJLA 3RU6A 1O5QA 3KS5A 7PTDA 2NT1A 1H63A 4D71A 3KWXA 3V16A 3L4YA 2ZUVA 3P82A 2PP1A 5HR7A 1J79A 4F0KA 3QMTA 3LCGA 1H4PA 1NELA 3FS2A 1E72M 2PF0A 4AWSA 1EC7A 4TX9A 4Q32A 5BXPA 4JYEA 3H7UA 4FNQA 2H90A 3ARYA 4BA0A 2ANUA 1VFOA 4H00A 4HOWA 4ZB0A 2IUZA 4GI9A 4OUEA 4MOZA 5EU9A 4HYRA 3DKLA 2OT1A 2FHCA 3P8JA 3QR3A 1UKTA 3W1QA 1IT7A 2FB2A 1N7KA 1TZ9A 1XX1A 3PHAA 1W5QA 1J01A 2PDYA 4P8XA 3A47A 1DIKA 3WLSA 3UR8A 4Q22A 4DI9A 5H8UA 2J78A 3T9PA 2ZZ5A 3TJIA 4KEMA 3CH9A 3BLDA 3UJRA 3OGRA 2NSXA 2I9UA 3EXRA 1JXKA 5DCEA 1IR1A 1HNYA 2V38A 3TW9A 1SQ7A 2E5CA 2W67A 4L1XA 1BFNA 4F0RA 2WVUA 2QV4A 3A6OA 3KVJA 1TA3B 1BYAA 2BHZA 3ITCA 3R11A 3T4CA 3KTCA 5ECVA 1I8JA 4OJYA 3G1DA 3S6TA 3PNZA 1KM3A 4C5YA 2JFEX 1XBXA 4IGMA 5XIAA 4UTWC 1B5TA 1G7VA 2GVJA 1IGWA 1S46A 4CD8A 4DF2A 1P7TA 2FGLA 3C8NA 1NEYA 3HPZA 1JPKA 3IK4A 4IZGA 5TNVA 4C6LA 2JALA 2DIKA 4L80A 3OVGA 1VBGA 2HSAA 1K6AA 3HB9A 4H04A 4I9AA 1T40A 4UFKA 1YADA 3VK5A 2QIWA 1SM9A 1ZL1A 4D6FA 2WWDA 1R86A 3USZA 3D0CA 4ATLA 3CZ8A 3VMOA 1H7PA 4D6JA 3ARTA 2J6XA 2WMIB 2YR1A 1M7PA 1OFQA 2H3DA 3R8HA 3HPSA 4W85A 3VD7A 4L4MA 1C8XA 1EC9A 1H62A 3AI0A 1R9ZA 5K7JA 1SJBA 4HB7A 1E6SM 1EJSC 1TELA 5D03A 5ECUA 5E09A 1GCYA 3OIHA 2OU4A 4CVUA 3MS8A 3EDDA 3IIVA 4H19A 3B8DA 1AA1B 1P0EA 4G6CA 2FJKA 3MY9A 1PPIA 2VQTA 2G50A 1THFD 3GFZA 3CGTA 3RF9A 3JZEA 5BZAA 3SSJA 1PWMA 3TDFA 2XH4A 1EJXC 3EYPA 2Y5SA 2I14A 1ONRA 1KTBA 3E5PA 2WCAA 3W1RA 3AMGA 4ORMA 4OU1A 4U5IA 3BAIA 2B7PA 3VE9A 2XN1A 9XIAA 3CPRA 1IR2A 1KFKA 1UH2A 3OIXA 3VOJA 2XVNA 3BGJA 3NVTA 3AMCA 3H4XA 1VRXA 1Q65A 2NUXA 1TSIA 5HJLA 1E1EA 2WSQA 1I6NA 1PCKA 3PS7A 1GQJA 1M1BA 4KGLA 3I6RA 4DNMA 2WMHA 3MYOA 4LEFA 1E4NA 3T07A 3QN3A 4RLIA 2CW6A 3KM8A 3B9AA 2FZNA 5E0FA 3UG3A 4QM1A 4PCTA 4MKVA 1I4NA 4LNCA 2WM0A 3W7MA 1G1YA 3KXQA 2OOFA 3B0VC 4JX5A 2IS7A 3IRDA 4IH3A 3QYQA 1J0HA 2CLPA 3MCOA 2VRQA 3A4AA 3DZ1A 2WVVB 4JFWA 1MXDA 4WR3A 1OX6A 5CZTA 3MZ2A 1LL7A 5CZSA 4C90A 1WCGA 5IOBA 2Y62A 1HL8A 2ISFA 4GYPC 3FSUA 5D37A 1K8YA 4O8RA 1JQXA 3WQWA 1Z41A 1IIHA 3H4WA 4Z1DA 5ABTA 1QATA 4PMNA 1E71M 3C0JA 2VZSA 2DIEA 1CXHA 4HU3A 2RJGA 2VD9A 1GYNA 4FX8A 1TJ2A 4NJJA 3S0CA 2WBKA 2GQ8A 4ACZA 5JBFA 2CLIA 5KTLA 1E51A 2VX6A 3U5YA 1OADA 4RDWA 1KFWA 2YW4A 3OA5A 1U1UA 2Q6ZA 3GTIA 4EAMA 2V0TA 2VOMA 2BG5A 3WNMA 1E0WA 1EO5A 1JYWA 1YXDA 4IJCA 1Q6EA 2PRHA 5M3WA 4LB4A 1BXBA 3AMLA 3W0KA 4NZCA 2VDHA 4ZA0A 3KE0A 3AISA 4ZQNA 3B3DA 3U4AA 1MI3A 5CZ0A 3R6IA 2OR2A 4MLJA 2AKMA 4CKQA 2PODA 2AQVA 1V0NA 2QCHA 4KRUA 4Z0SA 2CZEA 5A6SA 4W89A 1W3HA 4H7ZA 1RLDA 1R47A 1WPCA 2J13A 3WDRA 5BRBA 3VTRA 2C15A 2VM8A 4FP1A 3TR2A 3QC0A 1JPMA 1FWIC 5J04A 1XYFA 3WLRA 4QS6A 5D2YA 1QOPA 4HIBA 4L6OA 3VDCA 3NZPA 1ZGDA 1H2JA 3GC5A 1W5OA 3OOQA 3ZWSA 1Q4NX 1Y7VA 1FP9A 5LGZA 4Q8UA 2YYUA 4GVIA 1ZBWA 3M64A 5LIXX 2DEPA 3HQPA 3ZLFA 3R7MA 3BAKA 3EDJA 4CU6A 3V3WA 2ZXBA 4QP0A 4BY3A 4ECLA 4D8AA 4AIBA 2EEXA 3LI1A 5AFDA 5HNRA 1DE5A 1I2PA 1RXOB 3UR2A 1X6LA 3IJLA 2DFAA 3OO2A 4ENLA 3CV7A 3GR7A 3TR9A 5DXYA 3F2BA 1F4HA 3UZ5A 5CH9A 1R30A 1TJ1A 4JFVA 3KZSA 3M0ZA 5LYRA 2QJIA 3ZSTA 4CU8A 2E6DA 1OF8A 2CPUA 2PDLA 3TLLA 2ZADA 4K2SA 2CERA 3P81A 3UERA 5AVNA 4PSRA 5KEZA 2YKKA 1YTEA 4JTIA 4GQGA 2WHLA 5DMNA 3NL3A 1YQ2A 3GNOA 1VPQA 2BXZA 3WYZA 1WYIA 5EL1A 3QZEA 3IANA 3V7PA 5ABFB 4PMOA 2PDJA 3RCNA 2P50A 2FZBA 3GZAA 1NDVA 1UP2A 4LALA 2D0FA 3AIWA 5TIMA 1K7FA 1GJWA 1YDNA 3GTNA 4CVWA 3DFNA 2V63A 2X0HA 2HRWA 1M41A 4WVXA 4M7TA 1HJSA 3TJXA 2C13A 1XIIA 5BWAA 1VCVA 4ERGA 2D1ZA 4L4OA 1F76A 2HNHA 3CIWA 3B9NA 1NFBA 5I2UA 4MJZA 4RZ4A 4DB7A 2J9ZA 5IDIA 4IIHA 3NYDA 2R8WA 1ME9A 4W5ZA 2IPJA 3BTNA 4RK8A 3UQNA 5HWMA 3T0BA 1LWJA 4ZQRA 1TZ7A 3EWYA 4IL2A 4DWSB 1W1PA 3L68A 3V35A 3L5MA 3N17A 4H2HA 1PZ0A 4G56A 1C93A 4PRWA 4QGCA 4WHBA 4XK2A 4B5NA 2WNZA 4MNJA 3NQ7A 1R3SA 2JIWA 2A4AA 1TA3A 3GYCA 5DANA 1XH2A 4H8UA 4HHHA 3SUUA 2OWCA 1JYNA 3E1F1 4W5UA 3FKKA 1PXGA 3LLXA 1TWWA 2PBOA 3U2EA 1I9CB 4GQBA 3W86A 1UA7A 3RR4A 1BXNA 1CECA 1GKQA 4WY0F 4UTFA 3MMWA 1N8WA 4LUTB 4AIOA 3AIVA 2DT1A 2BY1A 4NUWA 1XPYA 2FIQA 4W7UA 2J79A 4PYSA 2HPIA 4XD6A 3CHEA 3AXMA 1X7IA 4YTUA 2Y8VA 2VYOA 1EIXA 2YGYA 1YNQA 3THUA 1ZBCA 1I0BA 3O3RA 2WMIA 4JX6A 2FTWA 3C3NA 2QCEA 4B15A 4BHYA 3EOEA 3MUXA 2H8XA 3LZ3A 1O94A 5HJYA 4LRSA 2EPHA 3SDOA 4HCLA 2NQ9A 1VHCA 2DJLA 2JF7A 1PWLA 2XIOA 5G2HA 1DP0A 1SO4A 3M6DA 4IFKB 3CZEA 2JQXA 1GZ1A 1W5PA 3UBPC 4DUXA 2REQB 1YPFA 4LAKA 4IQEA 3NUKA 1TX2A 4LWWA 1AODA 1W0MA 3B8IA 4S39A 3KTSA 3SO7A 2BGNE 1UZDA 1F8IA 2W66A 3U57A 1MDRA 3L5AA 3TSBA 4PMVA 5A5WA 3OTRA 3S42A 1UIOA 3NO1A 3BLKA 2PDQA 4DBEA 3FW6A 4WEVX 3LERA 4TV6A 4XIAA 2PI6A 4YNGA 1K8XA 2JEPA 1E6ZA 4R7JA 1LWIA 4URIA 5CJ5A 4ZR8A 4FMVA 2OWXA 3ARVA 4OECA 3VNKA 2GGEA 1LLWA 3AU2A 4W8LA 1PE1A 2V5JA 2OX1A 3HPFA 4Q4QA 3R1ZA 1S2TA 1Z32X 4DJFC 3G6LA 4TVUA 1BRLB 3PPHA 4DZHA 3LX9A 3NURA 3NSXA 1FWDC 4HSOA 4XB3A 1US2A 2Z24A 1LRQA 3P93A 3IJ6A 3LHVA 4AHQA 1UBPC 2ISVA 4O13A 3V0SA 4AFYA 2AL2B 2WVVA 1SPQA 2C0HA 1ISYA 3LY0A 5I24A 4GD0A 4HPJA 2YPIA 1MEHA 3ARWA 3GG0A 2QUNA 4CNOA 3EWXA 1H49A 1KBKA 5L9FA 4PTMA 1ME7A 5BU6A 1UWTA 3WLPA 4JHMA 1HJQA 3I6EA 3U7VA 1BQCA 3P5ZA 3DENA 3LS9A 3MHFA 1XPGA 2NXGA 4BQ2A 4GACA 3TA6A 3VGDA 4LTSA 4XZLX 3KRBA 3S5OA 1RCOB 1L6FA 1G4PA 5LA2A 4QNWA 2NUWA 3D5HA 2AQWA 2VEIA 1QNVA 2BTMA 5C71A 2WQPA 3RCYA 3GLCA 4E5TA 2VURA 1XWYA 3G1YA 2CKRA 3DFOA 1UKSA 1YYAA 3LGEA 1ZALA 3BJFA 1OYAA 3E3HA 4CD4A 2D3LA 3M5ZA 1DJWA 5BW6A 2OJPA 3ZWTA 4HNLA 1AFSA 4K8GA 3OLEA 2DT0A 2Z2UA 2ZXAA 3M9YA 3L0GA 2XIMA 4MNLA 5D8ZA 4Q8NA 4ONVA 4DJEA 2HS8A 3S9IA 3CEUA 3MP3A 5F4XA 5AC7A 4QROA 4G9PA 2O56A 4B16A 4ATWA 1O95A 1IEWA 2WC3A 3QM3A 4M0XA 4AMAA 2A5HA 1MRAA 1XM3A 4KERA 4C6IA 4HU8A 4J28A 3FAWA 1LJYA 3BK0A 2O4MA 3SW6A 4QE1A 1CB2A 3SBFA 4KKXA 3GG7A 3L4TA 3THAA 1B57A 5CPQA 4C6QA 3AOFA 4I6VA 4M24A 1GW9A 2VWTA 5DX7A 1V7YA 4Z2IA 2D20A 2JBMA 4A29A 3QQ0A 2EPOA 3KLLA 3HOJA 3BANA 2ACSA 4N9EA 3G22A 3B8TA 1GOKA 4PUMA 3TZNA 1GVEA 4QE5A 1UP0A 3VVGA 1F4AA 3R25A 1KNWA 2XWEA 1TG7A 1OFAA 4XUYA 1M53A 4N7QA 3BAJA 3P84A 1Q6FA 3BOLA 3PWIA 3BICA 3U2ZA 1WQ5A 1ICQA 1MMFA 4OVXA 7XIMA 2J8GA 1C9DA 1KRCC 4GIEA 4S3EA 1YXYA 2AOSA 3VGFA 3QV8A 1GKPA 3HQ1A 1VJIA 5ABFA 5JIPA 3ES8A 3CO4A 2V5KA 4J4KA 3UG4A 3GR4A 1G69A 3BVJA 5CG7A 2FH6A 5A8QA 4B2DD 4E2VA 4YS1A 3W1MA 4F0HA 3IV3A 4C91A 2DZWA 3TE9A 1JCMP 2I1OA 3LCXA 4R9XA 3N2OA 1XH1A 2J9YA 1VKFA 2WHKA 4DLMA 4WQ6A 3UJ2A 5A6BD 1FHVA 1PHWA 2CYGA 2FKPA 4UNLA 3P6LA 3WQ5A 2VR5A 1GZGA 1H51A 2QCCA 2WJEA 1Q45A 2V69A 4K1GA 4H1ZA 2FB3A 2VL4A 4C6DA 1EUAA 3B4UA 1XV8A 4C6NA 4DWSA 3T42A 5I3JA 4GIRA 3GIPA 2FDMA 5HDRA 3WLTA 1SSDA 1EYWA 4JGDA 1J6PA 5C9RA 1UUOA 3TWAA 3RYSA 1QBBA 3L21A 1VBJA 3DYMA 4HT3A 1E15A 1PAMA 4O1CA 3NQDA 1HF6A 2GJPA 1UROA 5H8MA 2J7GA 1XUZA 1WP6A 2A3HA 1XHGA 1NVMA 1A50A 2GGHA 2WKLA 1GVYA 3HZ3A 2QCLA 2VCAA 4FF7A 2V2DA 5HQMA 5A6JA 3STEA 4H6RA 4K7VA 3QZ6A 2HJPA 4LUTA 4G2DA 3K30A 3BMXA 1PKMA 2J47A 4P5UA 3OLIA 2A7RA 4RKAA 1T99A 3P74A 1W9XA 1XUUA 1NWRA 3G1SA 2P0IA 2E67A 1Z9AA 3QW4B 4TTGA 3MDUA 3MSGA 3SQLA 2PDBA 5HQLA 4FSAA 4NI3A 1A4MA 5FJTA 3LCFA 2XGBA 2F61A 3WQOA 1DL3A 1OFPA 3A23A 3E0VA 1P6BA 2ZUUA 4OZOA 2W0UA 3PZOA 5A8MA 4DJDA 2QAFA 5FI8A 4QISA 5C2CA 4WKAA 1J9YA 5LXEA 1J18A 2UY3A 3QH2A 4HU0A 3TQKA 4L6HA 4IFKA 4GE8A 4O1AA 2FVKA 2YL8A 1NFGA 1DIDA 3IPWA 2C7FA 2YFNA 3TP4A 1RQEA 4DEFA 2WWCA 1ZCOA 2REQA 4U2ZA 3N2MA 1V0MA 2EPMX 4UMBA 4ZXLA 3WF3A 4JQ3A 3EOUA 4QJ5B 4JQ4A 5DT7A 3QPEA 1QUMA 5CPTA 1Q66A 4AD1A 5KMYA 4ZODA 5GJMA 1W9BM 5FACA 4GO9A 3W1TA 2G0WA 3IIZA 4GNJA 3S2LA 1OGSA 3KS6A 3WDJA 3UZXA 5ABHA 3L4ZA 1QW9A 2RDXA 3GAYA 4MY1A 1IYXA 4M56A 3GBDA 5AYYA 3S2NA 3UGRA 1HX0A 2GVGA 3EPMA 2MUCA 3TCSA 3LV6A 4ZOAA 4IQJA 1RAKA 1SYTA 3E2RA 5K9CA 2GUUA 1JRCA 3IAPA 1FP8A 1BRLA 4O50A 4MYXA 4A8IA 1SZRA 3TTEA 3RMEA 5FEXA 4IMEA 1V77A 1KC7A 4YHGA 4E4PA 3EDEA 4R7WA 1Q6OA 2AL2A 4WD0A 2OX4A 1OM0A 5DMMA 5I06A 1LP6A 4UTTA 3DX5A 3NA8A 3FAXA 4K39A 1HL2A 2W5FA 3M4HA 1WO2A 4NXSA 4GISA 4MJ4A 4B90A 4DAFA 4EACA 3THDA 4A22A 3CT7A 1E6XM 1TUXA 3ZYZA 2OSXA 2V2CA 1VCGA 2DVTA 4AWTA 5TD4A 3WUGA 2RGLA 1Q6RA 3S1VA 3L12A 3C52A 3Q2DA 3KRZA 3S5ZA 3W37A 1DJHA 1GK8A 2KX9A 1UG6A 4P8WA 4YPJA 4DPQA 1MQQA 3L4WA 4PUKA 4J2MA 5REQB 3LHWA 2IXVA 4DJEC 1W3TA 2GJXA 2HVNA 4G1KA 1E9IA 4AX7A 1E5JA 5A8GA 2IKIA 5D9PA 3HV8A 1GTHA 1VFLA 4WDWA 5CEWA 2Z27A 3DFHA 4GZEA 4AZ5A 4P8UA 2BVTA 2WMGA 4O57A 4DVOA 4L64A 4W93A 1O60A 1OT2A 1EWEA 1VBHA 3U0HA 3M1ZA 4PR4A 2Y70A 2B31A 2WMKA 4PMXA 4H3DA 2ZRZA 1S39A 1CBGA 1SW7A 2QF7A 1GVQA 1QHZA 1SZEA 4F2BA 3S5YA 4N02A 3SCSA 1CDGA 3LB0A 2ALRA 3F5LA 4PBEA 3B8VA 1WUEA 3ZO9A 3KBMA 3EWZA 4QDWA 4UUIA 2OSWA 2B81A 3LTSA 5G1MA 2TYSA 5DRCA 3U3HA 3O6AA 3DDMA 3JUGA 1ZAHA 1VPXA 3FSTA 3H2EA 1HT6A 2BOEX 2IQTA 1U5VA 3CB8A 3G3DA 1MUWA 1ONWA 3NEVA 4E8DA 3CPUA 4GK8A 4ZE4A 2V5LA 4MFDA 4O28A 3F03K 1ELSA 4PB5A 1FUYA 3W2LA 4QNEA 1WXZA 4M7SA 2V5CA 4KS0A 4AIUA 3WD3A 2GWNA 2RDUA 3PZUA 3BW2A 4O0ZA 1LOQA 1M6JA 3CTTA 1Y65A 3CMFA 3CZGA 3TROA 5FD0A 1O68A 2C1GA 3VM5A 4QHRA 3JVAA 4V27A 3TZFA 1H0IA 3NEHA 3RILA 4JHZA 3UYCA 1JZ2A 1OFEA 1RJRA 3Q94A 2EJAA 1TPC1 1WV2A 4HZMA 2BGSA 3EOSA 1FRBA 3GXDA 4O0QA 3PZQA 3PUOA 3GWQA 3ZVHB 1HN1A 1XRTA 3AFBA 2QCMA 1B3WA 3VKAA 1NF0A 5AKQA 4B4HA 1GVRA 4ML9A 3AO0A 1UWQA 2O9OA 3VO0A 3B40A 1LT7A 1WDDA 2CLEA 3ARUA 5M03A 1A5AA 2A3BA 4JFTA 3COTA 4ZQCA 3VC6A 2A2IA 2I56A 4LAOA 1T6MA 3P80A 3N12A 4AYGA 4DWSC 1PIFA 1NQKA 1WXJA 2R94A 4CD6A 3GR8A 3BJTA 1ZAIA 1A5KC 3QR0A 4PL2A 3B0PA 5CSUA 3PSVA 5I23A 2RGMA 3CC1A 4D1IA 4G8TA 5M17A 3WFZA 4DF1A 3ZVIA 3O6DA 3DOPA 1AQ0A 1MEIA 3UP8A 3CWHA 1W9VA 3M0JA 1O7AA 3M0KA 3WIJA 3AJXA 3TV8A 1TPWA 2HVOA 1UD3A 5HMDA 5MKGB 4YCPA 2ESCA 5G4HC 1CGUA 4NYYA 5AY7A 2C3ZA 3EDKA 3JU2A 3UJEA 3WD1A 1IF2A 3C56A 4MLRA 3XINA 1IWAA 2G3NA 4XBKA 3MC5A 2I5IA 3NXLA 2OGJA 4TTUA 5A6LA 4UCGA 3VX1A 2AQOA 3KWSA 1XC6A 3QY6A 2Y5JA 3V0TA 2ZTJA 1Q13A 2VFHA 1ISXA 7ODCA 2BXYA 4TQTA 2PLJA 3MUY1 5BYWA 1A5BA 3S1GA 5D05A 3IEBA 1PIIA 2WPBA 1HKWA 1UWRA 1GEQA 1KXTA 3PZ9A 3CUXA 3ZLHA 2ZZ3A 4AC7C 4GZJA 4DJDC 7CGTA 3WH9A 2YCEA 1LLZA 1OG6A 3A64A 3CHVA 4GIAA 5LA0A 2ACUA 4ERIA 4XKMA 1S1PA 1VFFA 3P67A 2PRMA 2VX4A 3L2IA 4NZFA 1KQYA 3VINA 3TJ4A 1DHKA 4GUIA 1PZ2A 3T4WA 5FF4A 5JUVA 1OK6A 3UG8A 1WKDA 2WCSA 2QCFA 3P0WA 4B5SA 2V3FA 4BQ3A 2IQ0A 1W2VA 2HPMA 3P5YA 3EX3A 5FF7A 2QQ6A 3HJZA 4ERAA 2OKOA 4WSJA 1W6TA 4GXMA 3WJYA 1RH9A 4MWAE 5FJJA 2OZ8A 3OW1A 2Q8LA 5G4WA 2G5WA 4HHPA 5BU9A 5AVHA 3ANUA 2J8TA 3IUDA 3PTQA 3VYLA 1N2VA 1GTEA 1H60A 4X2PA 4UQEA 1TRIA 3TC3A 1X6UA 5E5CA 5HANA 5IHRA 4UNKA 3W2NA 4UZSA 3L66A 1TV7A 4P61A 3E5BA 3PJWA 1WNOA 3AS1A 1KRMA 2BVWA 1SVDA 3R58A 4A8LA 1QVBA 1V02E 4ZL1A 1MDLA 4W84A 3T05A 3NIYA 5DY3A 1LYXA 2VD8A 4NQ1A 2BBFA 5XINA 3TAKA 3W02A 4YLWA 4WDXA 4UTTC 2C91A 3KOFA 4OGZA 8TIMA 2ISDA 1K7XA 4OWGA 2FQIA 2E77A 5LZLA 2G3FA 1RY0A 2QHAA 2XN0A 1BXCA 4CNSA 2YBVA 2PAJA 4JKKA 5K9XA 2ZXDA 5H6HA 5CGMA 2G97A 5AZ0A 2PTXA 4WDTA 6REQB 1DV7A 1I2OA 4Q8QA 3GDKA 4NNAA 1BSLA 4PMUA 3NCOA 4H8HA 4JIRA 1V3JA 3C3UA 3M0MA 2WVTA 3MDWA 4AQLA 4IGHA 4CCEA 1L6YA 5LIWX 1EBGA 3CYVA 3QY8A 3HG3A 1UYQA 5MF5A 3TFCA 5GNYA 4A8NA 3VCRA 1EZWA 4GHRA 3KZPA 2XG9A 3FCPA 3P61A 3ZIZA 3IS4A 4JX4A 4UOZA 3LPPA 3S2CA 4QFUA 4DO6A 1E55A 4JPGA 1TMQA 1A5MC 5FCZA 2Z4GA 4I7WA 1RP8A 4BQ5A 3VIJA 3V5CA 1XGZA 1B54A 1CT5A 2OFJA 5LKYA 1JCTA 4I3GA 1SMAA 1AJ0A 2GOUA 2QUVA 4QG9A 1ECEA 4B9YA 2WXDM 3ZT6A 2PGFA 1O1ZA 2VUNA 2Y88A 5REQA 3SFKA 3VOFA 3GVGA 1TE6A 2DZVA 5C55A 2E1WA 4TXEA 3P3BA 4GCXA 2WZIA 4AD4A 2IXUA 1PCWA 2ZRWA 1RJPA 2PMQA 3MYPA 2A21A 3GIQA 3TIMA 2KAUC 4B5XA 4LAUA 3NAVA 2NZLA 3GK0A 2Z2BA 3VD9A 3C61A 2XHYA 1OCJA 3SZ8A 3QMRA 4HA3A 5EMKA 4JN6A 1E9LA 2JIEA 2XFFA 2X0SA 3T44A 4N0RA 4HN4A 9RUBA 3UXDA 5A8NA 1KBLA 4LY4A 4UTLA 3NL6A 1QW7A 2NWRA 1AG1O 2XIQA 1NF7A 2A0NA 2FTPA 3BH4A 4LAMA 2CITA 4O11A 1P5BA 3EMQA 4I6KA 4PB3A 4EWND 1C91A 1H7XA 3CV6A 4WJXA 3T6CA 4LEQA 3BZGA 3K8MA 3NM3A 4JHOA 1OFBA 4HNTA 3BURA 3WKZA 3K8LA 4IM4A 1D3CA 4UC5A 2Q01A 5HK4A 4HK7A 1XR2A 2XJ7A 3OEXA 3M0LA 4JFUA 3CWNA 3LXBA 3OVRA 3L67A 5LNUA 4LT9A 1EX5A 3PBUA 2E28A 4IISA 4XAYA 1EF3A 3AHVA 3ABZA 4Q8WA 1KTCA 1Y5WA 3ABSA 1P48A 2ZX8A 5HUOA 3ZVHA 3JRKA 1UMYA 2GDUA 1BPLB 1HVXA 5H91A 2QF8A 3ANYA 2ODOA 2GSEA 2J7HA 3V5FA 2O4QA 2OGYA 1J6OA 3NL5A 3NGJA 2YYTA 5D09A 1TV8A 2QCGA 1UC4A 5FA5A 3BC9A 4HNUA 4KWOA 1FWAC 4DZIA 4U3AA 4UQ9A 3T2PA 3CS2A 2J62A 1U83A 4M8UA 3UYIA 4HA0A 4RX0A 3GXPA 4R53A 3TSDA 1ADDA 4FNRA 5CCZA 4IX0A 5LA1A 3I6TA 4IPPA 3SQSA 3ELFA 3MUCA 3QF0A 2DZBA 2PDFA 2X1RA 2GSJA 2Z0IA 3KP0A 4JQAA 3FYPA 5A2AA 5MKGA 3PWGA 1B3VA 1AD4A 1G4TA 1E6NA 3VABA 2D2OA 4NX0A 2XVGA 2J77A 4F48A 4HMCA 2TRSA 3KUMA 1BYCA 1PYMA 3UFYA 1MZHA 1JPIA 1EQPA 3W6MA 2WZMA 4O17A 1W3KA 3KP1A 1DJIA 1QCWA 3ITXA 5GNZA 4QITA 3AICA 4KBXA 4U10A 3GVRA 1FWCC 4UTIA 1VZWA 4XTDA 2ZE0A 4IICA 2X1TA 5FIPA 3PBVA 3UY7A 2WSPA 1KFCA 2WK2A 2PS2A 3VDGA 1CGVA 3LZ5A 3EX1A 3G2GA 5FSDC 1W1ZA 4LU0A 8RUCA 3GDMA 3KBWA 3PZTA 4JKLA 2RJHA 4UFIA 2FH8A 4B4FA 4EPEC 4HCDA 4MZYA 4UFLA 3DBPA 1OWQA 1Y5VA 1XFCA 4DY1A 1EF2A 1FWSA 3R8RA 4B3ZA 1KFJA 2PWDA 4PODA 3W87A 3NPWA 4AD5A 1ZP4A 2X0YA 4EF8A 1A5OC 1WKEA 3DH7A 5D38A 2P8BA 4I5UA 2B0MA 5EBUA 1ENUA 2GDQA 1L2QA 4HQVA 3FKRA 3VD3A 3FEMA 1X97A 5EB8A 3A4WA 1K1DA 4ZGYA 4I8DA 4LANA 1A3XA 5F4WA 1E4IA 2NQJA 1KCKA 3RPTA 1U1JA 4PCNA 5M1TA 1S2WA 4GI6A 3GTFA 1H0GA 2PEVA 2W3ZA 4GI8A 4L56A 3UNDA 1XLGA 1OT1A 4ZB2A 5HOSA 4GLEA 4HZ6A 4NU7A 3FJ4A 1GONA 4F0LA 2E8YA 1BTMA 2MNRA 1QTWA 2EO7A 3WK1A 4WX2A 1BTCA 3MBDA 1FA2A 4FZIA 1CXEA 5LIUX 1GQNA 2DSZA 3A9BA 3OBEA 2J27A 1QNSA 2CESA 3RX4A 1L6GA 2UZ9A 4ZENA 3ABRA 3HQNA 1XLMA 2Y7GA 1HW6A 1OX5A 1VQTA 4WRHA 3TYBA 3EWWA 4LAZA 1R3TA 3UEQA 1ISWA 3KOZA 1D7FA 4WGHA 3VIGA 2X16A 1V3KA 1VAHA 3UJSA 4NZ3A 4W7VA 5AOUA 1R3YA 2PWFA 1IXNA 1NOUA 1K4HA 2F7FA 1EC8A 4OBTA 3I7RA 4CLMA 4MM1A 4JL1A 1XKJA 3PBGA 2P0OA 2PZ0A 4ZCWA 3LBMA 1C29A 4K7YA 1RBLA 1OFDA 1HO4A 2F38A 6REQA 1BWVA 3AC0A 4H9MA 3M5XA 3OLDA 5D9OA 1K70A 3WBWA 4AZGA 3HPAA 5CBBA 1G7UA 1LOLA 2B7NA 2FFIA 1LOSA 3MANA 3PUGA 2WJDA 3PPFA 4YU1A 5T26A 4DUVA 4GOAA 3L65A 4LPCA 4AZHA 1TE1A 4DO4A 1PBGA 3NYZA 2YA2A 1HG3A 3RO8A 3DG7A 4YWIA 4KPLA 3SIZA 4M51A 4GBDA 3VILA 3BGGA 4YVPA 3F5JA 3RPMA 1P0BA 1HJWA 3WQ4A 2GGIA 4KWUA 5DMLA 3M16A 3L4VA 2E6FA 3CNYA 3UGVA 1NARA 1H11A 3ATZA 4P7QA 1PDZA 1I45A 2R1LA 4JKMA 4EOUA 4WGXA 3THCA 3N13A 5B7ZA 1XIBA 1TWIA 3BCJA 1TCMA 2IW0A 2ZUMA 3MWAA 3VMPA 4EXQA 1L2UA 2PCQA 9CGTA 2OSYA 4S38A 1FXQA 1TR1A 1QI4A 3R4IA 1EKOA 1EGVA 2WVSA 4DWDA 3SCQA 4O8AA 1H7NA 1V7AA 4AVOA 1CB7B 4K68A 4M1RA 3T8QA 5E1QA 3EWUA 1DJYA 4MKNA 4PSPA 4E4FA 5TAOA 2E6YA 4JTEA 2OLHA 1OZMA 5JMUA 3KL0A 1NY1A 3BPWA 3TYCA 3WBEA 1ITCA 4JL2A 3KOWA 1L6SA 4NRRA 1E0UA 2Y0FA 4PZVA 3BL3A 1EP1A 3UNTA 1OBAA 2VGGA 4ZE5A 2NXHA 2L5HA 3W6YA 4XD4A 5CZJA 1KGXA 1GNXA 4AEFA 1K9TA 1VGAA 7TAAA 1VFUA 1GOIA 1PO9A 3VGEA 1MRQA 4RZ5A 4GC3A 2ZX5A 3ES7A 2NVDA 1JCXA 4HD5A 3URAA 3CTLA 3IACA 2DZSA 3R2GA 1EDQA 1OZQA 2A3AA 4FAMA 4JTJA 3O06A 4C1NB 3H2OA 1CEOA 2XZ7A 2ZX6A 4M1BA 4RNHA 5EFDA 2BP1A 1MNSA 4MMWA 1XF0A 2J24A 3LRLA 4LNYA 4C6EA 2A6NA 1ADOA 3R43A 1A5LC 2VELA 3HURA 3G1RA 5IDZA 4HTYA 4AZ6A 2CLOA 2Z25A 4Y2WA 1R3QA 3I4KA 4J3ZA 2PC8A 3LNPA 4KW2A 2QJNA 3KL5A 4KWSA 4HJFA 6TIMA 3OYXA 3I7QA 4R33A 3IGSA 3GNXA 1JDEA 2GGJA 3B8UA 3CIVA 3MCNA 5EFFA 3CZKA 3GKFA 3STPA 3CL8A 3WL1A 1RCQA 1TIMA 1A80A 2EG6A 3KRUA 3BO9A 4GNKB 1VEOA 4S3CA 2JKEA 1S3TC 4XZMX 1JCYA 3BG5A 3P0XA 2WCGA 4AD0A 3WLJA 1WZKA 3O1NA 1PZ3A 1XYMA 3B4YA 2DSVA 2YOCA 2CNCA 3QJAA 1YPXA 5BNKA 3LLFA 1QNPA 4AEOA 1CGWA 4AVFA 1OC7A 3DECA 2CLKA 3LSBA 3WJZA 4JIIX 1H1NA 4K6AA 3WLNA 5BXSA 2P3EA 1X1ZA 4LH8A 1MW1A 4FR6A 2FJUB 3GU9A 2QR6A 4S3DA 1VF8A 3M7SA 1RD5A 3GH4A 3W76A 1W1B1 1GVOA 3SUWA 3LD5A 5C70A 4G7EB 2WKGA 3NWRA 4GQQA 1RLCL 1O66A 1Q4WA 1FH9A 1W5NA 1IXPA 4XAFA 3RFAA 1F05A 1C90A 5HXMA 1DTUA 1R9XA 2PA6A 3V18A 2RH9A 3VOIA 3H55A 5B80A 4MWAB 3FHQA 2WNWA 3GAKA 4LF1A 1OEPA 5C7VA 3UPBA 2G96A 3S3GA 3NFUA 1CXFA 1XIFA 3TTOA 3BE7A 1RHCA 1RVKA 2JKAA 3OZMA 4ZZ9A 1VD6A 2Y24A 4C65A 5FL1A 2A3LA 5D32A 5HUPA 2POTA 2VGBA 4GO8A 3DGRA 2E1DA 4JTGA 2Z7KA 3FVMA 3KDNA 3TXZA 3KW3A 1DWAM 5F1VA 2W62A 3WQCA 3CHDA 5A3HA 1E3XA 3GM8A 3CXOA 1LL6A 5SWUA 1VBRA 3LMZA 3F7JA 1LQAA 2QT3A 3K1DA 2CZVA 4CCCA 2IPWA 5CAHA 2Y1HA 3LLDA 3H6OA 2ZICA 2PDMA 3SY5A 2RFGA 2JK2A 1GW1A 3W6LA 3LHZA 3BLIA 5F2IA 2QIIA 1R2RA 1DJZA 1BAGA 3AMKA 1LQ0A 3E2QA 5FEPA 2I5QA 4IIGA 4IQLA 5M2FX 4GH3A 2WW5A 3ZS4A 2TODA 5AC4A 1CXLA 4HNNA 4H9YA 4UXDA 5E70A 3GX9A 4V2XA 1FDZA 1H1ZA 1R2SA 4F2UA 5IHSA 4NZ4A 1XXXA 4AD3A 1YDYA 2Q71A 5IBXC 5T9CE 3MQTA 4E4UA 3EX6A 1DIEA 1UA3A 2OXNA 3BV4A 2QCNA 5HWJA 3KFTA 3TYDA 1BVWA 3RG6A 4O1DA 3N4EA 1K8ZA 4PULA 3CZLA 4NILA 3WNKA 4AXNA 4ZQMA 3KOYA 1I2QA 1T5AA 3W85A 2WLZA 2V3DA 3EKLA 3VIMA 3BLOA 4EPDC 3DG3A 3W83A 2IQDA 2PDGA 4INFA 4NIRA 2NX3A 4H83A 2HBVA 1E73M 4BJHA 2YSWA 5HQEA 4RV3A 1CENA 2IPFA 4YTQA 4E3TA 1DXEA 4UR9A 1IZJA 5A69A 2RKXA 3MWCA 2PDNA 3E2VA 1W3JA 3BOFA 3E49A 3EA3A 4LW7A 1JF5A 4FX6M 4JN7A 1RA5A 4FOJA 4JIEA 5AB3A 1CCWB 3W88A 1TTIA 2WBGA 4CNUA 4KESA 2INEA 3T2QA 3SRFA 2QVHA 1A3WA 3SR7A 4H9ZA 4ZFCA 4HNOA 4IGNA 1XBVA 4X63A 1JI1A 2ADAA 1C7TA 1XLBA 1ZTVA 3IAQA 3BJSA 5HA7A 3EXSA 4XD3A 4HSNA 4RZ6A 3H2CA 4GINA 1TPDA 1BSIA 1YBQB 3GVWA 3AHXA 4AH7A 3ENLA 2ISWA 2V81A 1PX3A 4JD4A 3VXGA 1DQUA 4AWEA 1XIJA 4GCAA 3PFMA 1M03A 2XH0A 4Z1BA 1S5MA 2CHNA 3CO8A 3VZYA 4BEQA 1NM9A 3IVSA 2XWDA 3GD6A 1HGYA 2QV5A 1DIOA 2GK1B 1DE6A 3ME3A 2E68A 2Y7DA 2H9AB 2WOQA 1QRQA 4FLRA 1SO5A 1EJVC 3RLHA 2PDKA 1Q8AA 2XUCA 4O1BA 1QHPA 4DUOA 2WZHA 2B4GA 1ONXA 4POCA 3MKVA 3RXZA 4PCPA 1W9UA 4NJHA 1UWUA 1J10A 2XGIA 4A6GA 4RZBA 3G5EA 4HA4A 4YJ5A 6ENLA 2CBJA 4Z2HA 4RE3A 1E5NA 2ZYFA 5AYXA 3EZ4A 1IEQA 2VC9A 4H2CA 1GVSA 3ZZ1A 1RCXB 3UWWA 4PE8A 3AAMA 2YCIX 3PTMA 2DSUA 2OQLA 1BGGA 4GC4A 3BW4A 1A5NC 3WF4A 3V1PA 4GBUA 3G1FA 4YTSA 1O12A 3BAWA 4JY9A 2X2YA 3UZZA 1WDQA 3G24A 3GXFA 2QAPA 1F74A 4UTJA 1PZ1A 1S38A 1BWKA 2YBTA 3QRHA 2GFTA 1K3UA 5HPOA 3IUHA 7ENLA 4GGHA 3HO8A 4DWSD 3XISA 2NQZA 4GY1A 1NP2A 2RUSA 5A2BA 1X39A 3IGHX 2NQHA 1J0ZA 4UFHA 1E9YB 4IMCA 2C1HA 3U5UA 1KXQA 1FVPA 4C1NA 4BF5A 4HYVA 4C1LA 1H1YA 3DHPA 1RQBA 3GC2A 4NZJA 1NDYA 1LROA 4NNCA 3EMCA 2V8ZA 1QK0A 5C8BB 4DZAA 3WBYA 3R94A 1WDRA 2I57A 4B3LA 1UWSA 3AXXA 4IOTA 5F2LA 4HMNA 2HXUA 5HULA 3T1GA 5BOOA 3WMLA 1JZ5A 5LHFA 4HVXA 3M6YA 3E0LA 2PDWA 3OB8A 1N55A 4J1OA 1FHUA 2OVLA 4Y7EA 3POCA 5HINA 4LUJA 2ICSA 2CBIA 2VEPA 3MTWA 1IV8A 4RDZA 2GYIA 1JPDX 4D2JA 3AIUA 4DHGA 4EANA 2IKGA 4GMEA 1LDCA 3OQ8A 1VS1A 2YDQA 3TN6A 4CN1A 1TCDA 2PTYA 3LHUA 5CJMA 3C2OA 4BI6A 3G1HA 4L65A 1VP5A 5GQBA 2UWFA 3ARRA 1KR0A 3H4GA 3KLKA 4O4VA 3W7IA 3VDBA 1NH6A 3O15A 4IMAA 4DJDD 4OOUA 4JY8A 1RK5A 4IXHA 1KBBA 2YFOA 4IIBA 4WSHA 3MMTA 4LCRA 4E2DA 1AVAA 4YVVA 3SGUA 3AS3A 3KVKA 2VC5A 1JDFA 3GU1A 4QRNA 1V03A 3URBA 1H7WA 4OUIA 4LFYA 1Q6GA 5E9XA 3DEQA 3XIMA 4GY7A 2C0AA 4A3HA 2VR4A 1E6QM 1HKKA 2EPNA 3M0XA 3G0XA 3AXKA 3UESA 5HJXA 4EPKA 4A8RA 4Y8EA 2JGQA 3RX3A 3WUEA 2FPVA 1CGXA 2NVCA 3LGDA 4KEUA 2NWSA 3KHDA 4PUDA 4G7EA 1GOWA 1S5WA 3S1UA 3R12A 2Q8ZA 1EJTC 3WF2A 1UR8A 4JEJA 4Y90A 2OT0A 3LBCA 5BXRA 4LCSA 4MNMA 5FF3A 4US5A 1M04A 6TAAA 5DCBA 4UWMA 2PWHA 1FCUA 1Q5MA 1GG0A 5CC3A 3NGFA 2VCBA 2DV0A 1YPIA 4NI8A 3BUVA 4MPKA 4MWAA 5IM51 5C54A 2DSKA 3QHMA 3AROA 1IGSA 2JEQA 3OBAA 1CWYA 3STFA 4JTLA 1SU5A 1UOKA 2QNEA 4R7OA 2EBNA 1ZENA 5LIYX 2VI0A 2ZWYA 3G8RA 3WK0A 3HU7A 2FTYA 2D2HA 1O5KA 1U1HA 3LI0A 1XIMA 1OC5A 5AYIA 3QOKA 1XLCA 1FY6A 1L9WA 1XISA 4XO7A 1V02A 2ZXQA 2HROA 3IJ9A 4L1GA 5I0DA 5K3VA 6A3HA 4F0MA 3RLUA 3LCIA 4ADUA 3RHGA 4CEUC 2PSNA 4DZ5A 2BDQA 4TX8A 3SJNA 5A95A 3SI9A 3QV7A 1ZJHA 4ZSUA 3FN9A 3LU2A 3UZWA 1VRDA 1VFTA 1IIGA 1U2YA 1W3LA 5F4SA 3VFCA 4D8LA 1ZUAX 2PGWA 3OZYA 3UWUA 3AYVA 1KQZA 3DU0A 3F2DA 3D46A 3ITLA 1DQWA 4CNNA 3ARXA 1D3GA 2DY3A 1TKKA 3C0LA 4J40A 3U6WA 3LG3A 3OU8A 3IARA 3IVTA 4A3YA 5CPLA 2ZZ2A 5FJRA 2NW0A 3W7OA 4JTFA 1JI2A 4DYEA 3CASA 1GJPA 4WOQA 2GVYA 2DU2A 4H9VA 4PTVA 4J2PA 5I03A 2DQXA 4ZTYA 4D72A 2ZZ1A 2EF9A 5I09A 4W86A 2NV9A 1XLKA 4PEEA 3TQ0A 3M0YA 3MUZ1 2J7FA 4R34A 1V3HA 3S83A 1FXPA 1VIWA 4QLJA 4PMZA 5I6SA 2DZUA 1KM0A 1D8WA 1QK2A 1FBAA 4B3KA 3SCWA 3W7HA 3KBSA 3TC6A 3FFSA 4Y6GA 3ONBA 1BG9A 3QSTA 3KTXA 1EIBA 3KCJA 4C6JA 4ZOCA 2ZUNA 4GUHA 2GDVA 3E38A 1VR6A 2GUBA 3GO2A 1YBQA 1VYSX 3RU8X 1NU5A 1ZY9A 4BF7A 1EQCA 4X0NA 1P1MA 3S6DA 3MUAA 1NP0A 4KFOA 3NPXA 1GYLA 4IMGA 2YLLA 4HNVA 1R46A 4J3TA 3UU0A 4M6UA 2GK1A 4GJ1A 4I9JA 4ICMA 4GNVA 1UD6A 1TUFA 3PZMA 2H9AA 3KBNA 3ABOA 4MB3A 2WMFA 4ZO7A 1K9EA 4EE9A 4CNTA 3FA4A 5AHIA 1C7SA 1XLAA 3OQEA 5C2GA 2AAAA 1QWGA 2CLHA 4MSSA 5HMEA 3RNDA 4FR1A 1A53A 5IRPA 1JNEA 3DC8A 4IMDA 3W9ZA 4AZ7A 3Q37A 4D6HA 3QHOA 1P0KA 1OABA 2OZ0A 5U7SA 4YVXA 1Q7QA 1NWSA 4W8BA 3LMYA 2YW3A 4LOCA 1Q6QA 1A47A 4JTTA 3SEPA 3QKZA 2FZ9A 2GJRA 3HBLA 5A8OA 5DBUA 4CD7A 5ABGA 1ONEA 2CU0A 2H3BA 5F2MA 2CHRA 1QU4A 2B7QA 4PL1A 3O63A 2J7BA 4TV5A 3L2LA 2PWEA 3P14A 2PLKA 3NQ8A 3WBAA 3GH5A 2UY4A 1QW8A 1KM5A 4HGXA 4CUCA 4FX7A 4RXGA 3OA3A 5CBIA 5K2ZA 3BMWA 1UBSA 3GFXA 4PMQA 3VGBA 2HK1A 3F4VA 1GKRA 1R6WA 1DEDA 3H12A 3QQ1A 3SQMA 3NQAA 2ZRVA 2ZTKA 1UZHA 4PTDA 3WX7A 1K8CA 2FZDA 2WO5A 4PUJA 5FESA 4AMCA 3GG1A 1PS9A 2OKTA 1VB9A 3P7YA 1REQB 4MVAA 2E0PA 3M46A 3UWZA 2Y85A 2HMCA 5TBOA 3I4EA 3N2BA 2VZTA 4XKYB 1H5VA 2WSYA 4HK5A 4ASTA 3MU7A 1P0NA 2WC4A 4IG2B 2O9PA 2NT0A 4F0SA 3L2MA 5H2ZA 2VJXA 2GGGA 3H21A 1KCLA 2QS8A 3F4CA 4AHPA 2GVLA 4ZOBA 2BS9A 1KLYA 1CLVA 3UVAA 2I9EA 4JTKA 1IXQA 2PZNA 3LK6A 1AJ2A 3MO7A 1AW2A 4GYJA 4QBXA 3NNTA 4W9TA 3FY1A 1XBYA 1SO6A 1TJRA 2R9RA 4JQ1A 4XZ9A 2DT3A 3TUUA 3T55A 1OB0A 1TTPA 4Z08A 1HJVA 1VPYA 3TOYA 1KBJA 1XS2A 1BYDA 1LWHA 2WHJA 2PGRA 4OOZA 4LVFA 4DBWA 1QXLA 3PAOA 1ZZMA 3CEPA 1VFMA 3IJ8A 1W3NA 2Q8XA 2QVNA 4U5KA 1EA0A 2EQDA 1FWFC 1KV8A 5AC5A 1OVDA 3NQ6A 3TVAA 4NP7A 1E1FA 5CPSA 1JDCA 5I3KA 1V6VA 2OYLA 4KFPA 1JD7A 1FWWA 4MWAC 2O55A 1E40A 3WELA 1LRNA 4H6KA 2ZC8A 3I7SA 3WLHA 4P7NA 3EWBX 3KBJA 1I1XA 1SJDA 3M47A 3GNDA 2VGFA 4D1JA 1LTDA 4XX6A 4QQ3A 1IZCA 4MZ1A 3FNDA 4UQAA 5BMXA 1G4SA 3O05A 3RPDA 3MSRA 1CGTA 1JF6A 4GQRA 4MJMA 2VFGA 1J2WA 1DBTA 4AD2A 3LPGA 1PTDA 1D7KA 3TJLA 3UZJA 4H7CA 2DPEA 5C9UA 5FAJA 1A0EA 4LYRA 1F73A 3WQDA 3EBVA 3SN4A 4CQ8A 2LLEA 2ZVRA 4QX4A 1G6CA 2BX7A 3C2YA 3I65A 4UQCA 1PVNA 1WZAA 4XZNX 3ZR6A 2FHBA 3FDGA 3RAOA 3LHTA 3E0WA 3SN1A 1V6YA 1SW0A 4LS0A 1BF2A 3B05A 3H7VA 1VENA 2A79A 2XZ9A 4GZ7A 1JZ6A 2XGZA 2KZHA 2OOGA 3W2JA 1BEUA 1CGYA 4UIOA 4RL3A 4RDYA 4BQ4A 3B9EA 4UBPC 4MB4A 3MI2A 4GFSA 2G3MA 4OV9A 4WZHA 3ATYA 1JULA 2Z1VA 3NDYA 1CTNA 2XFWA 3SCNA 3ZOAA 3Q45A 1GUVA 3ERPA 4U28A 3TONA 4L6DA 4LV9A 2PLMA 3KVLA 3VOCA 4JICA 2Y2WA 3PB2A 4O0KA 1FHDA 4FLOA 3AYRA 1XIGA 1CNVA 5DN1A 4WXZA 2OB3A 1YKWA 4R85A 1W9PA 3S9YA 1VCFA 3PBWA 4C7DA 4WCJA 1RPXA 4Y9OA 5GJNA 3H2MA 3HGOA 2YIHA 1ZAJA 1LF1A 1TVPA 5FF0A 2PLCA 3ARQA 2V67A 3KHJA 3A5VA 3DBNA 1Q63A 3D3AA 2UY5A 4GQ0A 1FFQA 4MY8A 1S2VA 5M5DA 3N9SA 4O10A 1MQRA 1XQKA 4R3UA 1QASA 3WK2A 3RK8A 3M44A 1K03A 1BQGA 5A6MA 1SSGA 1BKSA 2PRLA 3FIGA 3H26A 3T08A 1JL8A 3N6HA 2NQLA 3GTHA 4HN8A 1CZ1A 3B04A 4N4PA 5TF0A 1G4EA 1L0PA 4MF4A 5F7UA 1EB3A 3IUIA 4P7LA 2Y4SA 3BZJA 2CIPA 2QJJA 2WJFA 5MHBA 3ISIX 1MUMA 2BY3A 1UD8A 4S3JA 3W23A 4PBGA 2QPXA 4F9DA 4NAEB 2D22A 2VGIA 3NSNA 3OZOA 3CLMA 3O6CA 4M82A 2ZCGA 2JE8A 4NXKA 1RBOB 4MADA 2F6UA 4XZHA 2BHUA 2F2HA 5HPCA 3FA5A 2BLEA 1YDVA 2YL9A 1SGJA 5C0QA 1R3RA 1P1XA 2CBUA 3ZR4A 3QSRA 5DEZA 2GJXB 2O0TA 3W24A 1PV8A 1M65A 1XIHA 2QULA 4CCDA 3EEGA 4MJ2A 1OCBA 2BMBA 4GZIA 4GVFA 1JCJA 2G4FA 4PGLA 3Q65A 1JFHA 4KT2A 3EB2A 4LVGA 4PMJA 3W72A 3EPOA 3ABQA 4QIUA 4HPNA 4KFNA 4IX2A 2WSKA 3OGSA 5FAGA 3UCDA 1TV3A 1AUSL 1FH7A 4FNUA 4Q4KA 1TJ0A 3OG3A 1W56A 4LUSB 3K4DA 4X3ZA 3HIJA 2GWGA 2VVNA 4MDOA 3E0IA 3CMGA 1UD2A 3E9AA 1GQIA 1US3A 5ENLA 2W63A 4ML4A 3PPGA 7REQB 3AIEA 2R1KA 4JFSA 3BDKA 2R82A 2NLYA 1XYCA 3G3MA 1W8SA 3S1XA 2INFA 3WMBA 3STCA 4FNTA 2UV8G 4J35A 1JIBA 2PE4A 3U7BA 4S1FA 2RAGA 4HU4A 1KO0A 1TPB1 4X2RA 3SM0A 4PRTA 1P6CA 6ALDA 2C14A 3GG8A 3TLQA 2C19A 3W29A 4QDMA 4B91A 5A94A 2BFGA 3SCUA 4LBUA 4AZCB 3H2FA 5KINA 1REQA 4Q4RA 3FDKA 4FK9A 3URNA 1NOWA 3QTGA 1K9FA 3MCMA 4XKYA 3K1GA 3U48A 3MKKA 3QPYA 4JIHA 3VIOA 1J96A 4IG2A 1HKIA 4MHBA 1PKLA 2BZNA 2W61A 3UA4A 4UQBA 1V51A 5E6YA 4J5NA 1F2JA 3GHUA 4L5ZA 2OMAA 3VPLA 1QNRA 4XV0A 5AZ1A 1XSJA 2PDIA 1A5UA 2X7VA 3AHTA 2W6RA 1IXOA 4M19A 1KTNA 2WAGA 4QEHA 5K9DA 1OC6A 4GWEA 1D2KA 2E09A 3BXWA 3CT2A 1KKRA 3APTA 5J5DA 1QNOA 3URQA 1JVNA 1VBUA 1HQTA 3CMJA 3VNIA 4OT7A 1V3LA 1N8IA 1SUXA 3ZMRA 2Y63A 4ICCX 1RA0A 3WEZA 3SGGA 1UASA 3LXCA 4JS3A 3YPIA 3W7RA 4LVBA 1TRDA 3ICJA 3VIKA 3FVDA 1AMYA 2HWGA 5EGRA 2PWGA 1UQZA 3LYEA 4IPNB 4G5DA 1CPUA 2ZOXA 3KL3A 4YTRA 1KD0A 2RDTA 3WJSA 4U3CA 3W22A 4LC6A 4AY1A 3QZAA 1QWKA 2DW7A 2NQ5A 4XZIA 3O6YX 2P5NA 1RP9A 5DXXA 4S23A 3KCOA 1DXIA 4G1NA 2BHYA 3EWCA 2OQYA 1K4GA 3NL2A 3WF0A 1NDZA 5G1YA 4EX4A 4MAZA 1FX6A 1B3OA 1EP2A 2PBGA 1WDWA 1YRRA 5GJPA 1K02A 2WANA 1VC4A 3GDTA 2H6RA 1U5JA 3VCCA 4H9XA 1XLFA 2GSHA 5HR6A 5I7GA 4HPHA 4AW7A 3T0AA 3S1WA 1MUCA 1VLWA 4FPSA 2ZZ4A 4HSHA 1RUSA 1WKFA 1V3MA 2A1YA 1HJUA 2QXWA 2V5BA 1BGAA 1T8XA 3CQHA 4PEKA 2Y6ZA 3OJGA 3W1UA 4BR1A 4JNYA 5C9ZA 3I68A 1JCLA 3GXIA 5IXEA 3S2JA 3WDIA 1DVJA 3V75A 1TJPA 1UR9A 4MZ8A 3WUFA 1J0IA 2FZ8A 1OF6A 5G2WA 3G0SA 3NQ2A 3IIPA 4O15A 2QJHA 4HYWA 2D73A 4GX9A 1QI2A 4DYJA 3WLLA 5I77A 5I3IA 2GPTA 3CAVA 1YNPA 1UKQA 5G4EA 1F07A 4IWWA 2NX1A 3F4NA 2P1FA 1OD0A 4W87A 3W75A 4ADSA 4Q4PA 3AYSA 2ZUSA 3EGJA 1C9WA 2IPGA 4P8VA 3WJXA 3KVMA 4B5UA 1ISVA 3SUTA 4AX6A 5DELA 4FHAA 4FO4A 1XI3A 2XIBA 5HMFA 4WF7A 2NX9A 2X09A 5ABEA 5KETA 1WZLA 1HL9A 3TC7A 3GYEA 3RRXA 3D6NA 1TPH1 3LCHA 5D4YA 3BWWA 2AL1A 1H7RA 4DUWA 3AUJA 5AC8A 5GPRA 5FEZA 1NFPA 4KRZA 4Q8PA 4NRSA 2YL5A 2DVUA 3UPMA 2ISSA 3A3XA 1XQLA 1KWGA 1WAWA 4Z1YA 1UHVA 2AMGA 4QLKA 3WMCA 3LA4A 4LV4A 5KITA 4HMDA 2VDGA 1EJ7L 1Z3NA 4Z1CA 3GNPA 5D2TA 2E8ZA 4XO6A 3WDPP 3DXIA 2ZA2A 1Q8JA 1EOKA 2G8ZA 3O16A 3L9CA 3DHDA 1UMLA 3UG5A 4JDBA 2TMDA 2VFEA 1XFBA 4AXKA 1GOQA 4Z0JA 2D2GA 2WNNA 1TMHA 1W91A 3BARA 1A5SA 4AWUA 1JZ8A 1YTDA 1FCQA 2AGTA 4DF0A 3AZTA 1DQXA 4BWLA 5JBDA 3C4UA 3CUFA 3MVIA 1ME8A 3WG6A 3WH8A 1FWBC 2OO6A 3IIOA 3TSMA 4L4PA 3K46A 2CBVA 4NAEA 3PAJA 2F6XA 3MSDA 1MEWA 4RDVA 4C6MA 2YXOA 3FYOA 3TNOA 2BGQA 1POJA 3ALFA 4LUIA 2X2GA 3VGHA 3WH6A 3PBMA 4NSBA 2HISA 1KFBA 4X61A 4JTHA 2EJ1A 2W9MA 4H4IA 3DI0A 1YTKA 3QPZA 2VR2A 1UIPA 3AIQA 3FJ6A 3HG2A 4KWWA 4P2VA 3A5FA 6PTDA 5LHEA 3S6OA 1SR0A 1AH3A 3N19B 1XDMA 4Z2GA 1AH4A 4H9TA 4MIMA 3W7NA 1FDYA 3PN8A 4ZO8A 4UR7A 1V6XA 2BWGA 1CLKA 2F84A 3T2OA 3JS3A 4QS5A 4ZOEA 4C6CA 3RX2A 1JG9A 2CZ5A 4S3AA 2PDXA 4FLQA 3PG9A 3POHA 5EY5A 4C7FA 1JUEA 1BVNP 2E6AA 3SCVA 4RPPA 1KM1A 2E7FA 1GQLA 1IEXA 2Z6IA 2D69A 4XAZA 3VUPA 3CQKA 4UCFA 4H41A 4C6FA 3MO4A 2JGYA 2F9RA 1XCWA 4ICNA 2Z29A 4LUSA 3BQ5A 2DIJA 3PSWA 2F8QA 1JYXA 1MZRA 3BLPX 3T8LA 3ZJ7A 4F8XA 1KKOA 8XIAA 1B31A 7REQA 3THQA 1C8QA 1HUVA 4Q33A 4DXKA 2GJLA 2ZE3A 4ROQA 2GUYA 1LCOA 2CZDA 4TR9A 3RLGA 1ZPTA 3TA9A 1B1YA 2PWUA 2XPKA 2I17A 4UFMA 1TVLA 1US0A 2GQAA 3QFWA 2Y8UA 1DJXA 3F5KA 5CBJA 4KCWA 4NY2A 3LEPA 4AZCA 1UH4A 2VQUA 1BYBA 4Q7BA 5HNUA 4ZB5A 1TVNA 3AMDA 4BI5A 3DFQA 2XINA 1FKXA 2O9RA 2OTDA 5CC5A 4JTCA 4C6BA 3GDRA 1ITXA 3AIRA 3DESA 2V6AA 4JIPA 4DJFA 4IFOA 3N15A 3W2MA 1X96A 4QE4A 3SCRA 4MUPA 1UKPA 1T41A 1XLIA 3O0FA 1JRBA 3WH5A 1BWLA 3R79A 4QDPA 2HNEA 4IFRA 3ZXWA 1TPVA 3GNRA 1QDSA 2ZBTA 1VFSA 2PDHA 3GBEA 5G1TA 1E0VA 3LNMA 4GX8A 4IPIA 1X8FA 1IWPA 3C0SA 1SW3A 1CXKA 2VZUA 5DRIA 4ZQOA 3LM7A 4REQB 6CGTA 4ZMGA 4YIWA 1PTAA 1AQMA 4U4MA 1TWSA 5I07A 4E0CA 3ARSA 1PSCA 4Z1AA 2INZA 2XM1A 1CYGA 1S2AA 1UR3M 5T8GA 3KEHA 1KLZA 1V5XA 4JDYA 5KZMA 5D9NA 3LXAA 4OKDA 1G0CA 2E5DA 5CSRA 1UKOA 3RDKA 3TYAA 4UQDA 4YHEA 5JXQA 4DPPA 1EHNA 2DZTA 4JBRA 3FXYA 1EPVA 4IPJA 2EG8A 5KSWA 4HCHA 3ITVA 3K13A 1B30A 4KCVA 1UPMB 4OIFA 2D23A 2NVAA 3JZUA 3WQEA 5FL0A 2FZMA 3UVIA 1JAEA 2G4JA 3ARZA 1M5WA 3NO5A 3DHFA 5HWNA 1F9CA 2XSBA 4MPQA 3SCPA 3M0HA 1L6WA 3M5YA 4Q6XA 3W7PA 4EKJA 3M5VA 1VEMA 1Q7MA 4MG4A 3HV9A 1B3YA 3RR1A 1DWHM 3V5OA 1KRAC 3RJXA 3HMJG 5EA9A 4QQUA 4HBKA 2FLIA 3UWEA 1B90A 1OIMA 1TX0A 2FFCA 4RE2A 1UH3A 2YJQA 2A3CA 1CI1A 3H2NA 4PMYA 3A12A 3T78A 1F3XA 2EPKX 1Z48A 3RGTA 2VEFA 1PB0A 3FX4A 4XWUA 4C7GA 4CQ9A 2O7QA 4WUIA 4Z2JA 3QOMA 4O1FA 4NAFA 3M0IA 2V9DA 2QDGA 2QMKA 3P62A 4PBFA 2H8ZA 3ZT5A 4CN4A 2Q3RA 4O1EA 5L6UA 1A0DA 3R0DA 1NIUA 5CJNA 3RRAA 4DELA 1DJGA 4HZ7A 4AU0A 1AL8A 3QMSA 1Z6KA 2E9BA 1LRTA 4J9JA 1Y5XA 2BB0A 4DN1A 1EGZA 3UT0A 4BFAA 4GPNA 4XIMA 1KV5A 3CUHA 3CAQA 3NZGA 1SFJA 1FWHC 3W1AA 3GUGA 1ODUA 2HCVA 2ZUTA 4JTDA 4BS0A 3SIMA 3QV9A 5CZKA 2J7DA 4ZVJA 4S2BA 1SMDA 4AC1X 1CXIA 4Q8TA 1SFLA 2HK0A 3RN6A 3U2CA 3QGAC 4X22A 3F4WA 2DSWA 3R8GA 1ZRQA 3AJ7A 3GDLA 1ALDA 1V93A 2DGAA 5JH1A 1QO2A 2OG9A 3EPNA 1R8LA 1B4KA 3LCLA 3RM8A 3H23A 3N14A 3CH0A 4BWLC 3WK3A 3PPCA 1GGOA 3N2XA 3VZZA 4KF1A 3G77A 2YLAA 3PFRA 1UPPA 1I75A 3VDAA 2RDWA 4AIEA 4FF5A 4DQWA 1MO0A 3FEQA 3VD5A 2BNJA 2ZUWA 5U4NA 4BK9A 1GHRA 4JTSA 1KM4A 3VKJA 3TKFA 4D6GA 3PANA 4HP5A 3N2TA 4AY7A 2UY2A 1OX4B 5KZDA 1UB3A 1EYEA 3LRKA 1C3FA 3CUZA 1LZOA 3NQFA 5FJIA 1X98A 1LBLA 1WZMA 1OY0A 4EF9A 3DKJA 4WSKA 5EPDA 1R3VA 3WD4A 2E4TA 4ZO6A 3B8WA 3CB3A 1J8VA 2QUUA 3RUBL 4Y96A 2QJMA 4XBJA 4LYPA 3PNUA 4LS2A 3SGZA 3AQUA 2CHOA 5JVLA 1GPFA 1XYAA 4PRRA 2VTFA 4EXBA 1XRVA 2G3IA 5I00A 2PDPA 2YB1A 1X1NA 1U22A 5JIWA 4LC8A 1I2NA 2FDSA 1W5MA 4AZBA 5EKYA 5CC7A 4V1XA 3FGCB 3W7QA 4H01A 2SFPA 1Z89A 1LG2A 3VDHA 4QSHA 1QPQA 3SY8A 1TV2A 4B5TA 3CHCA 4HHMA 3LPFA 3MV01 3U9IA 3AUOA 2Z1KA 3PY2A 3N73A 1TO3A 4TMBA 3GSMA 2G3JA 4HNCA 1XRSA 3W7GA 3NZQA 1RALA 3WD2A 1PIGA 3PP7A 1WAUA 4NZ5A 4DBDA 3ZJ8A 4WXYA 4LYQA 1XLHA 1QI3A 3N9RA 2YCKX 3NQCA 2HV5A 3EX2A 4DO5A 4TU1A 4AVNA 1BKHA 3S8HA 2A3EA 2V5DA 2VXNA 1QPNA 3WSUA 3C8FA 1FTXA 3H70A 5CSYA 2FMOA 3QY7A 1ICPA 7TIMA 3ZLGA 1XD0A 2VEKA 3ECQA 1OG0A 4EAYA 1E70M 3NG3A 1C8YA 2W27A 3N4FA 3O8AA 4FLSA 3ZQ9A 1R38A 2CZFA 2Z1XA 3EEZA 5PTDA 2G95A 4O4WA 4QAWA 2C18A 1KM2A 4US5D 4KMQA 5LXXA 6XIAA 4B5WA 1LG1A 2ABBA 4O16A 3TOPA 1Q3NA 5H1WA 5A2CA 2X8RA 2ZWZA 1RD6A 4MY9A 1ZP3A 4PFHA 4MWAD 3VIFA 2WZTA 1PYFA 1ZS2A 1EUNA 4WOZA 3PJXA 2FYMA 1XBZA 4UNIA 2Q3OA 3WH7A 4I9TA 4LVAA 3SFWA 3MA8A 3NDZA 4L9YA 3AXHA 1JQVA 5K4ZA 1EX1A 4JCMA 1KRBC 3D3FA 3BGAA 3ZJKA 1EWDA 1YNYA 4PC8A 1DJQA 2XU2A 3PZIA 5HNTA 3RITA 1EOMA 1NOFA 4YYFA 5E0CA 1RJQA 4REQA 2ACQA 4NNBA 2DUAA 1F61A 4Q7IA 1Q6CA 1NJJA 3QKEA 3S4TA 1KBIA 4LBRA 3DAQA 1YW1A 4E2BA 2QCDB 1LM1A 3PM6A 1OFRA 5HBFA 4HTBA 4RR4A 1XLDA 1RV8A 3E6EA 1CW2A 1L8NA 4WY0B 2I5GA 2GL5A 1D9EA 5C9WA 2YZ5A 2CXEA 8A3HA 3CLWA 2D3NA 3A13A 5A1AA 2QGHA 4QTGA 3WLQA 4MDPA 3HGSA 2QJGA 1UD4A 4UFJA 3IJ7A 4ZEPA 4D6DA 4S3FA 3CM4A 1J93A 1TTQA 1JXJA 1UR2A 1TQJA 3AU6A 4GVHA 4Q8VA 5A6AA 1B0IA 4UMAA 3WZ0E 1R7AA 2VP8A 2XM2A 5DFAA 3G1VA 4C1KA 5CXPA 1UD5A 4GRSA 2FPTA 3BCFA 3N3TA 2EXOA 3QC3A 1OFOA 4NYUA 4RV8A 2XVLA 1XC4A 1IT8A 1PHQA 3N3MA 4JOMA 2Y89A 1G9HA 4LUYA 4CGTA 1YXCA 1ZJAA 4LX4A 3SURA 3W1LA 4ZSTA 1EPXA 4D6EA 4D6IA 2JKPA 3QLDA 5CSSA 4L7ZA 3L4UA 1W31A 1SO3A 2QEZA 4IPLA 3MI6A 1OYCA 4JIQA 1RK6A 4NT0A 2VC7A 3HMCA 1E0TA 4DYKA 4E6MA 3WLOA 2G37A 4UMCA 1H61A 1JCNA 3C6CA 1MSSA 4RE0A 4M3PA 2VZVA 3M7WA 1PUDA 4A2RA 4J3UA 1XW8A 4I5XA 3W27A 5JH2A 1YE4A 2VWSA 4ILSA 3AHYA 4TUFA 1QI0A 5AHMA 4DRSA 2DVXA 3EXTA 2PD5A 2VFDA 2X1IA 3NQGA 5EMYA 4KIEA 1AZ1A 2IMRA 2OZ3A 3VKCA 1J5TA 5GVJA 4XZWA 2BXVA 3CK5A 1E43A 3SUSA 3GFYA 1MW2A 1ZHAA 5T9BG 1W1IE 3S5NA 5BXTA 2WLYA 3WBXA 2VEMA 1UR4A 4CEXC 4IUOA 3ITTA 3G8EA 3T81A 3FHAA 4P7RA 3E2SA 4OFCA 4IQDA 1W1VA 3FOKA 1GQKA 4XZBA 3VIIA 4XD5A 3LTPA 1E1CB 3QXBA 4BZYA 5G2IA 5A6KA 1M3UA 4RCXA 1EZ2A 2NLIA 2OLAA 1RR2A 3WNPA 2C79A 3SADA 2J66A 1XG4A 3B0XA 3MI3A 2P8CA 3ABXA 3A22A 3WEMA 3IVUA 4J7RA 4I7UA 2QPUA 4G7FA 5EYWA 3UW6A 4AISA 4ES4A 4EXAA 4JQ2A 3SB0A 4NJGA 1D8CA 1X1OA 1XDLA 3HPXA 2XN2A 2Z1SA 2A85A 3M41A 4YMZA 5BOEA 1NWTA 3MVTA 2CFFA 1W17A 4FXFA 2V3GA 3PR2A 4JTRA 5CQ1A 3NVDA 3MUIA 5FSEC 5JBEA 1Q2RA 5BRQA 4NG3A 4LRTA 3GW3A 4JTAA 3WENA 2J74A 4HHLA 1WBHA 1WUFA 3RM4A 1BF6A 2EKGA 2ABAA 3VC5A 2XYLA 4WLCA 3WN6A 1F3EA 3MBFA 2TAAA 4DBUA 1EJUC 4DBSA 1M68A 1GHSA 1OX4A 5D2WA 3VKKA 1TB3A 3WJWA 5D9MA 2PTWA 3CUIA 3S9ZA 2NV2A 3DC0A 3DI1A 1P4CA 2Y5EA 1HO1A 4Z42C 4C60A 2FVMA 5HNNA 2J7CA 5BCAA 5IFPA 1H41A 5BRPA 1WB0A 2XIIA 4TO8A 2XIJA 1J11A 3N6JA 5CKSA 5LNSA 1VIZA 5AYBA 1OSEA 1S2UA 4JNZA 2J25A 4OTKA 1QOXA 4XSLA 5A6TC 2BVYA 3CJPA 4IP7A 4IIEA 1RSCA 4RW5A 1EP3A 3FGCA 5LSMA 5CGQA 3GNNA 3G18A 3IJDA 4IIFA 2YCJA 2EG7A 3F2CA 1W37A 1DKWA 2X05A 2P3ZA 1Q7ZA 1YX1A 1X7FA 3VKBA 3CAWA 4F2TA 3N34A 3LRMA 3MHGA 1E0XA 3GH7A 2DP3A 2BASA 4KETA 4XG1A 4FALA 5E6ZA 3IJQA 4W88A 2XSXA 4RPQA 4TMCA 1K9DA 2B7OA 2YCLB 3EA1A 3TYEA 1XP3A 2ATMA 2J88A 2DJXA 3ALGA 3W28A 2ZZ6A 3NQMA 4IGSA 2MANA 2R24A 3LQLA 3UXKA 9XIMA 4KGJA 4Y8FA 3WQGA 4J3XA 5AHNA 4ZQPA 4LCQA 1GPWA 4UOJA 1IT0A 4NJIA 5D33A 3PC0A 2PD9A 3A4JA 4W4QA 1NWUA 1EEXA 5J5RA 3K8KA 3QGVA 5FJUA 5IFTA 3HFYA 2ZDRA 1MYRA 1E6PA 3TFXA 3A4XA 3TTYA 3CZJA 4CN6A 2D2JA 1J2BA 2QUMA 2DH2A 3W3OA 1UUMA 4WKHA 4N9DA 1J0YA 1VEPA 1UWIA 5AC6A 1ZFJA 2Y7FA 2Z6JA 4ORIA 4J27A 3GTXA 3H7RA 3WNNA 1RY8A 1MW3A 3V1HA 5LNWA 1C92A 4K8EA 2DORA 3MJMA 3SUVA 1LT8A 5F2GA 1FWGC 4Y9NA 2QZRA 5AECA 2Z28A 1SFTA 3ID7A 1Q6DA 5LGXA 3M43A 1F6KA 2HVMA 3W7LA 1EXBA 5I78A 3KOXA 3W38A 4GYKA 2A6LA 4UR8A 1UR1A 5C7HA 4GKLA 1X6NA 3NTYA 2G41A 3AYTA 3C2EA 4Z2LA 1GOOA 5HMSA 2I16A 2V82A 2XISA 1T7LA 1XLLA 3L4XA 1A5CA 1ODZA 3AS0A 3WY1A 5G5IA 3RIKA 1A0CA 1MNZA 4CQDA 4DLFA 3UZYA 2GZXA 4K3ZA 4LF2A 4OE7A 1JUBA 1S3HA 1IEIA 3GB6A 2V30A 4IXXA 1NDWA 3HA1A 2QCDA 5LNRA 2WC7A 1DWJM 2X30A 4AYSA 1S5NA 2CEQA 4WY0A 3TN4A 4S3KA 4O19A 1FDJA 1TMLA 2VVSA 5AHLA 1E4LA 3LN3A 1W54A 3B0YA 1JZ3A 1FFRA 4KH2A 4OBRA 3BAXA 4LYKA 3P2VA 2R1NA 4KCTA 3GUWA 3LUTA 4O52A 1EA9C 3OVPA 4LJ3A 1G5AA 4BF9A 3F1QA 3NDOA 4N9CA 3G0UA 4JN8A 3QBUA 3U8GA 2J9XA 2AGKA 3NZ1A 4K1WA 4EIVA 3UR5A 3W7JA 3OVQA 2IKJA 1I0DA 4EWJA 1AH0A 1KGUA 2PU0A 4B9ZA 1HP5A 4LVDA 4DM2A 3T0TA 3GVQA 1D3HA 2VX7A 4JCLA 5FKYA 3EOLA 3JR2A 3GS6A 2QYGA 1M01A 3GHRA 4JYDA 2QGYA 1EFZA 4XAGA 1Z7AA 3TYZA 3TNBA 4NHVA 2HEJA 3LGGA 3B9DA 1V3IA 4KEVA 5AHEA 4EK7A 2ZQ0A 4K38A 3TXVA 3DFTA 3H24A 4MKSA 4QCEA 1HKMA 4F9JA 5CLTA 3N2CA 4PTWA 2CWXA 2Z1WA 3AWOA 3ITOA 3OZPA 1Q6LA 1GOXA 2GVEA 3NQBA 1FQ0A 2AMXA 2EPLX 3UXLA 3TQVA 5EMMA 4JAWA 1R87A 2VENA 1YMYA 1ZQ5A 1NQ6A 3CAKA 4H6QA 1XSKA 2XSAA 1I1WA 1Z69A 2I7GA 3OPSA 3WQVA 4IJRA 1AQFA 2YXGA 4KEZA 1F7BA 3HTWA 4QG6A 1ZU8A 1JPHA 2PTDA 1EL3A 3O7UA 5I3HA 5D30A 3S47A 3L0NA 1QR7A 1I60A 4A3UA 1SZFA 2CLFA 3IGXA 2HZGA 1E1CA 4PN2A 3W1NA 2QLYA 4BI7A 4GXWA 2E5BA 1YLVA 3TAOA 3INPA 4K37A 3B97A 1TREA 1TWDA 3TN5A 3HM7A 3TX9A 1LORA 3UXAA 3TTQA 4CCZA 1FCBA 2C16A 1M7XA 3W82A 3R89A 5CGTA 1XSIA 2ZKMX 1NSJA 4R88A 1W32A 1JEZA 1N8FA 2VX5A 4ZBCA 4UB9A 3WNOA 2WZEA 2Y8KA 4HZ8A 4N6FA 1DTNA 1VJSA 3RLVA 1QFEA 3USBA 3KX6A 4NF7A 2J4GA 1V0KA 1AQHA 3PUEA 2P53A 4GUJA 1JAKA 3WLKX 3VA8A 1KR1A 1EO7A 1HXJA 3CUGA 3DIPA 1F6YA 2V68A 1EXPA 4Q4SA 4EP8C 1MFUA 1Q2SA 4PUWA 1R9YA 4Q3MA 3BV7A 5KZEA 3VNMA 5T91A 1QNQA 5I02A 3UA3A 1HGWA 1KXVA 2BV9A 5AHFA 3DYPA 3UR7A 1WDSA 1TZZA 4FIQA 1BG4A 2R14A 3EOOA 3QLLA 1DJNA 4ATDA 3TU9A 1YEYA 3NQEA 3SY1A 3I3EA 3LCWA 3ZR5A 1XINA 2C8NA 3C2FA 3C5QA 2PWVA 2JF6A 4IUGA 1WDPA 4MB1A 5CG0A 3OP2A 5D02A 1GWJA 3K2GA 4F66A 2PU1A 1IEVA 5D2XA 3EB3A 3UETA 3CBWA 1V8EA 3G1AA 3TYUA 3DFYA 1V6WA 1LQ2A 2VMFA 4IP5A 1UUQA 4JZ5A 4O12A 3SSZA 1W2PA 3GU2A 2D0GA 4ZFMA 1W8GA 2YL6A 2XFRA 3NPUA 1PL9A 3FV9A 3ZM8A 5DCDA 4HA1A 3WO8A 5AYZA 1QBAA 2PPGA 2VRJA 4PUNA 2E9MA 2VFIA 1QPKA 3R13A 2YCLA 6XIMA 1JYVA 3PK7A 2Q02A 2ASHA 4XVEA 4NKCA 4DXVA 4AAJA 1EBHA 3W07A 3CU2A 3ZT7A 4XQ6A 1QO5A 4PCFA 1F6PA 3LENA 4P7OA 4V1YA 2VDIA 2WJZA 4IJBA 1JD9A 4DI8A 1ZBKA 2UBPC 1W1YA 2X41A 5DF0A 3TMQA 1AW1A 4GVGA 4XAPA 3MB9A 2C6QA 3PULA 4KQNA 3VAVA 1SJAA 4IMFA 4WK9A 1Y0EA 1IQ8A 1B9BA 3W81A 1A49A 2R91A 2Z2AA 3NOEA 5DQPA 3IIXA 1JDAA 4HPXA 2ZX7A 3N25A 1RVGA 3E12A 1MXSA 2C1IA 3B03A 3SCOA 3CPGA 3GVVA 3EDFA 4DO7A 1KM6A 3VIHA 2VKZG 2DW6A 3C0QA 2W92A 1RPKA 1F3WA 2Z26A 3J7HA 4D6CA 3CYJA 5DBTA 1O5XA 2YDSA 3PZGA 2CC0A 1H09A 3P60A 1UC5A 1J5SA 4H7VA 4YL2A 1K77A 2QUTA 4RXFA 4F79A 2ONEA 1GORA 3H54A 4MGGA 3CQJA 1PJ9A 3VOGA 3UWYA 4UTKA 4NVTA 3WUBA 3OLGA 2VRKA 3VNDA 3QTPA 4YTTA 1TYGA 1JR1A 4M81A 1FWRA 1TPUA 3CUJA 2WQDA 2F6KA 3MSYA 2YZRA 4XBSA 2PURA 4V28A 4FOUA 3AWNA 4XISA 3KDOA 4GY0A 4Q4OA 1FH8A 3HFTA 3KCLA 3QFEA 3S46A 4HPGA 2QDEA 2ALDA 2BOFX 4FEZA 4A2SA 4B5VA 4KWVA 1UZ1A 3VE7A 2PP3A 8CGTA 3LTYA 3VI2A 3QVQA 4S3BA 1E56A 3KRSA 1LUCB 4MAVA 4R9OA 1X38A 3MP5A 1MFVA 2OWWA 3B8SA 2X1UA 3SRHA 3ZFHA 4MUZA 2XDFA 3E0FA 4NZ1A 1HJXA 2OPJA 2CXGA 2PC4A 5I3GA 3FK4A 4Q8MA 1HKJA 3TH6A 2DT2A 3UXIA 1KGWA 3HGJA 5CPOA 4A35A 3A24A 3VX0A 3P8IA 1EJWC 1XGDA 2XVKA 4WDUA 1VJZA 3QEZA 1P6WA 2BOGX 1OK4A 1HTIA 2PTZA 4HJWA 1OINA 4ZO9A 3AIBA 3N29A 2PP0A 3I3BA 4I90A 3DERA 1UW9A 1DWFM 1XLEA 3H2AA 4UTUA 4M6QA 4C6KA 3BG3A 4GJIA 4QR6A 4ALDA 1EDTA 3OYZA 2VZOA 4O54A 1W1A1 1TFVA 1B2YA 2ATSA 3MMDA 3RM9A 3CHFA 4O53A 1IWBA 3TEVA 2OYMA 2NXIA 3EX4A 3KBVA 2WB5A 1ICSA 2P88A 3CV2A 1E6RA 3Q58A 1H5YA 2VUYA 3LV5A 3BW3A 2R1PA 3EB4A 1VFHA 2NUYA 4IF2A 1A3HA 4WIWA 1XGEA 5BROA 4GG9A 1XDJA 3N1AA 3GKAA 4DXXA 3GXTA 1L8PA 1DWGM 4FS9A 5TQLA 3O2LA 3DCPA 3AHZA 1O6IA 2OEKA 3IK2A 4S2CA 1G67A 3R5EA 5DO8A 1PX4A 3E74A 4FOKA 1FWNA 3LPOA 4PUUA 5D8WA 4X60A 1P43A 2VT0A 3W71A 4F40A 2VO5A 4UTMA 2HBXA 3DGBA 1UJQA 4CQAA 1OHLA 3A3HA 4OQVA 3RO6A 4CNPA 1TPEA 1TWZA 1J4EA 2YDAA 3GY1A 3LM3A 5E9AA 1R2TA 3APGA 1VH7A 2XH2A 3WFAA 1PKNA 2BSLA 4QSFA 3WD0A 3DFPA 4S3GA 5AN7A 3VNZA 2OO0A 1ZBVA 3ARPA 1C8VA 3PJUA 2VNCA 3TMLA 4PMDA 4J3VA 1BHGA 1I2RA 3EKZA 1B3XA 2O7SA 5DLCA 5FJOA 5LIKX 4E38A 4UZUA 2ZX9A 3MP4A 4CQBA 3CL6A 1XL9A 4BEUA 4FNPA 2WSRA 3A9IA 3NPVA 3UJFA 1JFXA 4GABA 3W00A 4IHCA 2PGEA 2ZRXA 1CLXA 1B9ZA 3QW3A 1FOBA 3APYA 3VFLA 1JJKA 3ZJ6A 4TVCA 3U2OA 4N4QA 3QGKC 4HOXA 1LBMA 3N04A 3VU2A 4LXFA 4J3WA 3MMUA 4AHOA 3OHIA 1XICA 4E3VA 3WCZA 1XYLA 4IP4A 4KRTA 4GKTA 4AY8A 2R6OA 3PB0A 3HQOA 1B3ZA 1KXHA 3OGVA 4QLLA 4A05A 4C5ZA 3N4AA 4OBSA 4PMRA 4WKFA 2GQ9A 1W1TA 3WFLA 1EDGA 1BVZA 1XKYA 3I3DA 4PTNA 8XIMA 1O5RA 3H53A 3OHMB 4I5RA 3TWBA 4DJFD 2HTMA 1ZJBA 4A4AA 1KCZA 4KCUA 3FYYA 1JZ7A 3GIYA 5FF2A 4TVDA 4B2DA 4N2YA 3W7EA 4JTUA 1XYBA 2HS6A