7PTDA

Phosphatidylinositol-specific phospholipase c mutant r163k
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
296
structure length
296
Chain Sequence
ASSVNELENWSKWMQPIPDSIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKKYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQDKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQDYINEKWSPLLYQEVIRANKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the roles of active site residues in phosphatidylinositol-specific phospholipase C from Bacillus cereus by site-directed mutagenesis.
pubmed doi rcsb
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
source organism Bacillus cereus
molecule tags Hydrolase
total genus 92
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1997-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 7ptdA00
4S3GA 5PTDA 4I9TA 1QASA 2O55A 3QR0A 5T91A 4I9JA 4F2BA 3KS6A 1XX1A 1DJYA 1QATA 2OTDA 3EA3A 3I10A 3V1HA 3EA2A 1T6MA 4OECA 4I8YA 3EA1A 2OR2A 3KS5A 2OOGA 4F2UA 4RV3A 1YDYA 2ISDA 1DJWA 2PZ0A 1O1ZA 5T9CE 6PTDA 3CH0A 4R7OA 4F2TA 3QR1A 5T9BG 3NO3A 2F9RA 3QVQA 2PTDA 4RW3A 1VD6A 2FJUB 4QJ4B 2P76A 1AODA 3OHMB 3H4WA 1ZCCA 4GNKB 4I9MA 1DJIA 1DJZA 1GYMA 7PTDA 2PLCA 1DJGA 3V18A 1PTGA 3RLHA 1PTDA 3V16A 3PTDA 4QJ3B 1T8QA 3MZ2A 3H4XA 1DJHA 1V8EA 4QJ5B 3L12A 1DJXA 3RLGA 4PTDA 4Q6XA 4I90A 4RW5A 2ZKMX
chains in the Genus database with same CATH superfamily
2EHHA 4DF0A 2DH3A 4EPKA 4C6PA 1R2TA 4ORMA 2G0WA 2Q8LA 4BHYA 1KW1A 1CXEA 1S5NA 5E6YA 4MTVA 4B16A 1UZ1A 4WGXA 3GTXA 1Q8JA 2V38A 4MF4A 2NT0A 1BG9A 1DWHM 1YQ2A 3M0JA 5A2BA 4B2DA 1XIHA 2O56A 3QGVA 3EXTA 3JW7A 4YVXA 2PWVA 1C29A 3HFYA 3R94A 3FXGA 4O8AA 1XJBA 3W7HA 3UZXA 4GO8A 3LRMA 4GNJA 1JQVA 4PCPA 3A4JA 2PD9A 2V3DA 3HOJA 2F2KA 3FEQA 3VE9A 1PX3A 4AYGA 2J77A 1OK6A 1ONWA 1KV5A 4S1FA 1X8FA 1CLVA 4PMRA 1XR2A 3S1VA 1KM4A 5BWFA 2I7GA 1WDQA 4QSFA 4RK8A 1P4CA 1ZHAA 2PF0A 4GI8A 2NV1A 2CWNA 4WJ8A 1RR2A 2PDYA 3U4FA 4QJ3B 3H24A 4O1BA 3TP4A 2VYOA 4N6FA 1PX8A 3G1YA 2Y63A 4IF2A 1F4AA 1EIXA 1ZAJA 1MXGA 1RVKA 2WM0A 4M6UA 1XGDA 1B2YA 2WPBA 3CPGA 4H00A 4YTUA 2QVHA 3WQ6A 2PTWA 2NUWA 3MV11 3RG6A 3H23A 1J9YA 1RK6A 3LCXA 3R43A 3UZ5A 4ZO7A 4RX0A 1LWIA 3CUHA 2OGYA 2WCSA 4YHGA 5JH2A 4V28A 3GRIA 4B5TA 1OIMA 2E6YA 5AYYA 1A47A 2OX1A 4PUDA 3VKDA 3FA5A 3MUXA 1ADDA 2ZUTA 1H7NA 2WMIA 1LLZA 2CLHA 3CLWA 3B40A 1D3HA 3TFCA 5EMMA 4JCLA 3W29A 1VPYA 3QSTA 1ICPA 3BW2A 3KBMA 2FGBA 3G0XA 3KRUA 4JAWA 4NJIA 3WNMA 2Q71A 1O60A 3OHMB 4PTXA 5FF0A 5MF5A 2PDJA 3WELA 1KM6A 4AWSA 1I8JA 2Y5JA 2Y7FA 4S3CA 3E9AA 4OV9A 5LHEA 4XO6A 4ZOAA 2V8ZA 5FSDC 3VKKA 5K4XA 5CLWA 4XZIA 1XYBA 3SB0A 5A6TC 3W86A 1NDYA 4LS1A 4PR4A 1DJHA 1G94A 2HISA 5G4HC 3TYZA 3T08A 3FAXA 1P1MA 3W1TA 4H9YA 1JDEA 2KX9A 1E9ZB 2X0SA 3ID7A 5JBEA 4H6KA 3U2ZA 2NX1A 3UY8A 1KD0A 2ISFA 2Y8UA 4GQRA 1YMYA 1RBOB 4CNNA 3TC3A 1XRFA 4N6EA 4LRSA 3SCOA 3CHDA 5CSUA 4FPSA 3RN6A 5JBFA 5D2WA 1SR0A 3IVUA 1E3XA 1BPLB 5C5YA 5JBDA 1UUOA 3I7QA 2FKPA 2W66A 4IUGA 1KGWA 4KWVA 3BCJA 4LYRA 3F03K 3UBPC 3K30A 2O7QA 3OVGA 4IIDA 6PTDA 3W6MA 3RMJA 5DMYA 3A23A 3ZLHA 4GK8A 1J93A 1Q85A 2GYIA 3SN4A 1JRCA 1GOXA 1TVLA 2F6KA 4HHPA 4DZIA 3BOFA 1XFBA 2EG6A 5CGTA 4O11A 3KDOA 3TZFA 9RUBA 2BY2A 2DZAA 3LERA 1TTPA 3VKJA 4MG4A 4HOXA 2JK2A 3N4AA 4IGNA 2A3HA 1AMYA 1GVEA 2OYKA 3R0KA 2R8WA 4XSLA 4ZENA 4DPQA 5I00A 4PCFA 1KBLA 1QR7A 1XUZA 4B5UA 1FWHC 2OEKA 3TNBA 3ZSSA 1ISWA 3UZYA 3SECA 3W53A 7REQB 3IWPA 4B5VA 5C9ZA 3T44A 1BAGA 2ZZ6A 2QCGA 3FJ4A 3LG3A 1VCGA 5D2XA 2XTKA 1E51A 3W7KA 3O6DA 2X7VA 4MMWA 2YDRA 4QDPA 3D3AA 3N9SA 3UJSA 4AB4A 3C2VA 4IJCA 1H7PA 1SJBA 1SJCA 5LIYX 4JX4A 5E1QA 2YZ5A 1NFPA 2I5IA 1W17A 3AUJA 3URQA 3LCHA 1JAEA 3W3OA 5J04A 1FDZA 2CLFA 5AYZA 1XD0A 4O54A 1S2UA 2WK2A 2YCLB 5AVNA 4A8IA 1XC6A 3HJZA 1EC9A 1EGMA 4AHPA 1T0OA 1FCQA 4MPKA 4IL0A 4DJED 5A8MA 1WA3A 2HJPA 1EIBA 1V6YA 3VOFA 2YL6A 4J7RA 1YNYA 3RITA 4HPGA 2MNRA 3I65A 1NEYA 1HQTA 4XAYA 4NJKA 2VEPA 2WSKA 3EKLA 3KBNA 3JZEA 2WCGA 3RGTA 3DU0A 3MPGA 3U4AA 4IXXA 2R1PA 2CEQA 2D22A 3G0SA 4N4QA 3XIMA 4KERA 2EPHA 2R9RA 1IXQA 5BU6A 4NX0A 4NAFA 2J88A 3DGRA 3QHNA 2P10A 1NWTA 4GUJA 4FNRA 4PL2A 3SN0A 5DX7A 1W9VA 4LNCA 3MW7A 3CTTA 2OWCA 5BWAA 1PYMA 4NZ3A 3B8UA 1ZLPA 3FVMA 3AIVA 5ABHA 2Z1WA 2WMKA 5EFFA 4F79A 3NDZA 4HPXA 3GFXA 4H8NA 1G5AA 1YBQB 2PDMA 2X2GA 3MYPA 4PGLA 2PDUA 4E2VA 3N29A 1VFUA 5AY7A 3TJXA 3CM4A 1M5WA 4R7OA 5FJOA 2XN0A 5AB3A 5BZAA 3KL3A 1VPXA 1X98A 3HPXA 1IXOA 1LZOA 1WYIA 2E4TA 2QJHA 4XBSA 4GVFA 3LS9A 1JPKA 2XG9A 3MB9A 2G3IA 1S2TA 4MLJA 5A8QA 2V69A 2H9AB 3TJLA 1W3LA 4XKYB 5CPMA 3TX9A 4BQ4A 1G9HA 1YTEA 1XXXA 4GZJA 1QWKA 1Q8AA 5LA0A 1PVNA 4E3VA 1WOAA 3LTYA 2OEJA 2VC5A 1N7KA 2BX7A 4F0RA 3IIPA 1YTKA 3G77A 4S3FA 3BGGA 2A0NA 5EMKA 2C0AA 3FXYA 3UGVA 4J3XA 4UTWC 3AHVA 4B5WA 4W7VA 1W1A1 3LPFA 5EA9A 3U48A 1DJYA 3MT1A 4N7QA 1JGMA 3NM3A 1N82A 5JMUA 1LL6A 2PP3A 1UP2A 3G1DA 5HNRA 4HD5A 2PU0A 3NGFA 3AXIA 3GBEA 1K8XA 3WD1A 1OIFA 5HBFA 2FQIA 2DVUA 4XUYA 3S2NA 1VFMA 3QLLA 3W27A 3GAYA 4AW7A 3KLKA 4O16A 3DI0A 1F07A 1O1ZA 2QIWA 5C8BB 3S9YA 1EXPA 4NZ5A 1UD6A 1W9UA 3GLCA 3VFLA 1XISA 1A50A 3DH7A 1EHNA 1DYSA 4EWND 4UTHA 1JZ8A 4LVAA 5FF2A 4QBXA 2OB3A 5DEZA 1NOWA 1HKJA 1V3MA 3SY1A 1R7OA 3KVMA 1JR1A 1LG1A 4RE3A 4J3SA 1CW2A 1KFKA 4IFKB 1GEQA 1JIBA 5ABGA 2NVCA 4D1JA 4LJ3A 4B2DD 2CZVA 5KINA 4G5DA 3RF9A 2OCZA 3O15A 4NZFA 2VR2A 4QE4A 4GHRA 2Z6IA 3QHOA 3MZ2A 3NQCA 3E12A 3T09A 3L23A 4L4OA 3QV8A 3I68A 1GOOA 4FP1A 1XDJA 1TX2A 2B7NA 4HOWA 1QASA 4G8TA 1GVQA 2XZ9A 4I5UA 3WBEA 1F8IA 1LM1A 3UQNA 3SUUA 3VD9A 1B57A 3ZR6A 3NZPA 5A6BA 1KBIA 4JTFA 5IDIA 4DLFA 1JXJA 1TPB1 2YYUA 4ZA0A 3BURA 2OFJA 3EX4A 4TMBA 3S5NA 8A3HA 2E1DA 4MKSA 2VEGA 4ZSTA 3KS5A 1HL9A 1QK0A 3B0YA 3ZT7A 4JNZA 1A5CA 1G69A 2H8XA 4UFMA 1CENA 1J79A 3BSGA 3ZMRA 2GLKA 3RDKA 4DXVA 2PC8A 3DN5A 1PDZA 1E55A 1PZ3A 3BGJA 2CLMA 1KCZA 1XPGA 1VFOA 3MSRA 3BLEA 2QGHA 1ZRQA 3GO2A 3IJLA 3E6EA 4ZOCA 2VC9A 4HA1A 3VVGA 1IWPA 3VNMA 3ITOA 1XINA 5A2CA 3WF3A 3JZUA 1G0CA 1B3YA 5K9XA 3C6CA 2VD8A 2P76A 3GVQA 4PB5A 1KCKA 1ISZA 2VJXA 3VIJA 2OVLA 3T4CA 1QI2A 1H7OA 1RQHA 4DM1A 1EP2A 1MVYA 3EWZA 3FOKA 3GH5A 3UXLA 3S2MA 3QKEA 3WH9A 3NFUA 2CLPA 2XIQA 4J40A 2OSYA 1LRNA 2JBMA 2G95A 4UTWA 2ISWA 4NIRA 3PZVA 2VVNA 3GC2A 1EHAA 1Z41A 3LY0A 6TAAA 4HPJA 5T8GA 3C3UA 3R5EA 4IPNB 1HP5A 1EUAA 1MW1A 4OVXA 2ZWYA 1KM1A 1AH4A 4BI7A 1P0DA 3MU7A 4Z0JA 4US6A 3REQA 3G22A 4ZFCA 2JGQA 3BJSA 3MDWA 4HHHA 1D3CA 4BJHA 5C2CA 3HV8A 3LCWA 5HOSA 3PB2A 4L65A 4C6LA 1YDOA 2AKZA 3VOHA 1TPH1 3A9BA 1K8YA 2OZTA 4EPEC 3AYTA 3AIEA 5IBXA 1K6AA 3NPVA 3M0HA 3GNRA 1SZFA 1VD6A 5CGQA 4QJ4B 2OLAA 2OLSA 3TXVA 1N8FA 4WJXA 2DVTA 3SADA 1PZ2A 4XVDA 2VXNA 4DQWA 1E4NA 5C7VA 2WHJA 3E74A 2NXGA 4MVAA 3BL3A 1SO5A 1ZJIA 5C7HA 1GG0A 1FKXA 3V4BA 3O07A 3OVRA 4O4VA 5M1TA 4QG9A 3VUPA 3BAKA 3W1LA 1B3OA 1CIUA 1VHNA 4AEOA 5LIWX 3LLFA 2YDSA 4IPIA 2EKGA 2HV5A 3NG3A 1MFUA 1QOQA 5A3HA 1LBFA 1TJ0A 2XFYA 3H26A 3VDGA 4N0RA 4AX6A 1V0MA 2O92A 4WZHA 3E3HA 5EMYA 4FNUA 3AJXA 1QTWA 4ML9A 2H90A 3ZJ7A 4OUIA 4W9TA 1XH2A 3E49A 3VKBA 2PDGA 4X3ZA 1UOZA 5HXMA 1EWDA 2YKKA 1TA3B 5TQLA 4L1WA 4JS3A 1GPFA 5CPTA 7ENLA 3MBFA 1GYNA 3VNDA 4PFMA 1GHSA 2G41A 2C1IA 2XSXA 5E0KA 4AZGA 3VNJA 1BVWA 1IE7C 3QYQA 3Q94A 1AFSA 4UB9A 4WDTA 1ME9A 3VOGA 4L1XA 5K2ZA 1TJ1A 3EKGA 1FWWA 4JGDA 3G0UA 3TCSA 5EYWA 2HROA 1QO5A 3DDMA 3RR1A 4AAJA 1ZAIA 3CPUA 4QG8A 3LSCA 4FNSA 2P88A 3TTYA 1KGUA 1MZRA 4LVBA 3TJ4A 3M47A 1FDYA 4DAFA 3WEMA 1BTCA 1TR1A 3FYYA 3ITYA 4QFUA 3EPNA 5J8LA 1CXFA 3VGHA 1A5OC 1P0BA 5A8PA 3UNTA 4U33A 2YB1A 2YFNA 2EKCA 2YW4A 4K36A 1ODUA 3FDGA 2IKJA 1OFEA 4YS1A 4C6KA 1PWLA 1UD8A 2PDBA 4L6HA 2QS8A 1I4NA 1V7AA 3ARZA 1VRXA 1BXBA 1R8LA 2WZTA 3N1AA 4O1CA 2R24A 3R8RA 2PDIA 5FEPA 2VDHA 1K8ZA 4AHOA 1VC4A 3TA9A 4PYSA 4RNHA 1WDDA 1YPIA 3VO0A 5F2GA 4P7QA 1S5MA 1VBUA 2GVLA 1XW8A 1DQXA 2QCMA 2O9TA 3QRHA 5F4SA 1TPEA 1DQUA 3GHTA 3W1MA 3U7BA 4J2MA 3SY8A 4IGHA 1K03A 4MZ8A 3LHYA 3MP3A 2NLYA 3VIPA 4WKHA 4H2HA 1G4SA 4JQAA 2BY3A 5D02A 1Q7QA 1QI0A 2B81A 5D9OA 3B04A 4GNKB 3P0WA 1I2OA 1FH9A 3UG8A 2CBUA 4BWLA 1FRBA 1PKNA 3N6JA 4FR1A 4GCAA 2FZ9A 1VJZA 4RE0A 1CBGA 1W5NA 1B30A 1JEZA 1YTDA 1Z6KA 1EPXA 1E0VA 2W63A 4O0KA 3S4TA 4KEUA 3R2GA 3EKZA 1OFAA 4LEQA 4XD5A 3AS1A 3KBSA 3KCOA 1YRRA 3UEQA 2FJKA 1IEIA 2C6QA 1P1XA 4R27A 4XD3A 4GNVA 4JTQA 4Z1DA 3NQBA 1IZCA 4TVDA 3L0KA 2PDPA 3V0SA 3DFHA 3UR8A 1O12A 1EJSC 2INFA 2IPGA 3VIGA 4AXNA 1OG0A 1C92A 3B8VA 1BGAA 3MMTA 2VO5A 1MW0A 4XUGA 4DYJA 2ATMA 2QF8A 4B4HA 1YDNA 3LHWA 3GG7A 3HURA 4K2SA 1GVIA 3TLQA 4XTIA 1RV8A 4MNLA 1W31A 4OV4A 1VEOA 3AALA 3ZJ6A 1C8XA 1JULA 5A95A 3TU9A 4JQ1A 4NF7A 1FHDA 2WM1A 3PBWA 2WC4A 4A8RA 3QBUA 3QPZA 2YA0A 4RL3A 3CUIA 3RPTA 1REQB 4JTLA 4JX6A 1TCDA 4HZ8A 1JPMA 1S5TA 4GYPA 1JD7A 1T5AA 3VKAA 3S6DA 1GVRA 3ANVA 2FVLA 2VFHA 5CPNA 1IIHA 5I07A 4GX8A 2RJGA 5FL1A 2P50A 3HF3A 2GVGA 3WFLA 4LVDA 3SW6A 3ZZ1A 1JNDA 1OC7A 4OOUA 6TIMA 2XZ7A 1AD1A 5XINA 1OCQA 4UR7A 1KM5A 3MO7A 1QDSA 3P82A 4PUEA 3RUBL 2KAUC 3LQGA 3TA6A 4LUJA 3ZO9A 2E6DA 1TPDA 3P2VA 5D9PA 3OBAA 4JFUA 2V5KA 4MWAB 4O1DA 3GXFA 3SUTA 3K8LA 2A3AA 4XKMA 3N2BA 3KTXA 1JPDX 3UR5A 3CQHA 4Y2WA 4HYWA 4NJHA 1J0YA 3BAJA 4I5RA 3QQ0A 2WAGA 3L4VA 4AVNA 4CCCA 2POTA 1RHCA 1S3TC 1VYRA 3GUGA 4R33A 5HQLA 4Q4MA 4DN1A 2ZWZA 1S46A 2D2HA 3CL7A 3MI6A 4M29A 3WKZA 4NNBA 3HG4A 2DU2A 1X1OA 3LV5A 3OZYA 3OGSA 5A6BD 4YYCA 3M6YA 4U4MA 2P1FA 2FB2A 1M01A 4ZVJA 1UKTA 1KXQA 1WKFA 4XZHA 4GO9A 1UOKA 2ZXDA 4FHAA 2WBKA 4LWWA 3EX3A 3NQEA 3NSNA 4WX2A 5EU9A 1UCWA 5FEXA 1Z8AA 3D5HA 1W32A 3UXIA 2CFFA 3DEQA 1GGOA 5IOBA 2GSHA 1QCWA 2ZA1A 4PSRA 4QG6A 3O6YX 4ZQPA 4AU0A 1N2VA 3TQVA 3SRKA 3PF3A 3ZVHB 4K8EA 4AZCA 4IICA 3ES8A 1VFTA 4CD7A 1TV8A 4MY1A 4WDUA 5J5RA 1XG3A 2YOCA 2XIBA 2BG5A 3HB9A 1XV8A 1R3QA 3AZRA 3VYLA 2OEMA 1EZ2A 1GKPA 3WEOA 2GQAA 3O6AA 3UPBA 4ZQRA 5HA7A 3MKKA 5FJRA 2PRHA 3UVAA 3N6QA 1R3RA 1XRSA 4M6VA 4R3UA 2ACSA 3TYEA 9XIAA 3GG0A 2ISVA 5REQA 3NNTA 4MFEA 4JICA 4RNIA 2QVNA 2QCCA 4J3WA 3FFSA 1PCKA 3EWWA 1FWBC 3EOSA 4KS0A 1Q5MA 1N8WA 3H53A 4IPPA 5A8NA 3U3HA 4P7OA 1W3NA 1E40A 1V4YA 1F9CA 1DXIA 1GZGA 3T2QA 3S2CA 5K7JA 5KSWA 3DFYA 4YVVA 4XSMA 4P2VA 3TYBA 3QY8A 3MSGA 5K9CA 2AMXA 4JEJA 4MLRA 3M6DA 3AIUA 4CCZA 2FZBA 1BSLA 2I9UA 3PPHA 4ZQOA 3GHRA 4NXKA 4MUPA 4HN4A 3EOLA 1Z9AA 2NSOA 3HBLA 5AC5A 3KUMA 3GNDA 4UC5A 1IT8A 2OT1A 4GQ0A 4WHBA 3WQVA 1OF6A 3KM8A 1YADA 5GJNA 5K4ZA 3W7QA 2WNZA 3WDPP 4PTDA 3IIXA 7TAAA 2QCNA 3GYCA 2WNNA 1OABA 3ALGA 3ABRA 2J79A 3R79A 1HJXA 4PTVA 1RJQA 4YXGA 2JF7A 4C1LA 4C6NA 1WZLA 1EOMA 3IPWA 1EO5A 2VENA 1Q65A 5CBBA 4FXRA 4O52A 4UTUA 4NY2A 2Y7DA 3O16A 1J5SA 1XP3A 1K9EA 3DAQA 1EDGA 5T9CE 3GSMA 4XZWA 1MW3A 5KETA 3CIXA 1MUWA 1EF2A 1FWNA 1EJUC 4J2PA 4DB7A 1S1RA 4M82A 1W56A 3ABXA 1RY0A 4U31A 3VIFA 1X7IA 5DELA 1TMLA 1FX6A 3A24A 2EPLX 2FVMA 3U2OA 2L5HA 4ZO8A 1CCWB 2A7RA 2I57A 4PB4A 2QQ6A 1J18A 4ZODA 2ZDRA 4G1KA 3T55A 2GGIA 4DAIA 3UFYA 3E0IA 3ARPA 2CBJA 2BOEX 2XINA 1X97A 4EIVA 2QIIA 1L8PA 2BVYA 1AA1B 2YPIA 1B3XA 3UJEA 2WLZA 3UCCA 1GVOA 3IV8A 4ZSUA 4DY1A 2AGTA 4CNOA 5LNWA 5AOUA 3FJ6A 2J24A 4QR6A 5B7YA 3HA1A 1BYDA 3WMLA 1V6UA 1VZWA 1R5YA 3G6LA 1TVPA 3BQ6A 3W01A 3GU2A 1H4PA 3W7IA 2ALDA 2E5CA 1C91A 5DMLA 2OWWA 3O06A 4LBUA 1OZMA 1TO3A 2ZRVA 1TUFA 3THDA 4O17A 3UW6A 2FPTA 2OOGA 3DECA 4Q33A 1CYGA 5I77A 1OX4B 3B97A 4RPQA 4MIMA 1A80A 3MMWA 4A3YA 2J66A 4RV8A 1TQJA 3GG1A 3RJYA 2QUNA 4FALA 1R87A 3VCNA 3KAOA 1LL4A 2DT0A 4DRSA 3UWZA 1P7TA 3A47A 1EZWA 1EB3A 3WQCA 1A3XA 4H7CA 5E0FA 4NNAA 3GH4A 3M46A 1W3KA 4C1KA 4Q4SA 4Q8MA 3GNOA 2IW0A 1ZU8A 3BAIA 3LXBA 4GIAA 3VMOA 3EDDA 4JQ2A 1W9XA 1ELSA 3NIYA 2Y7EA 1EFZA 1MZHA 5HMSA 1R3SA 4QDMA 4LBRA 3V5OA 1H2JA 2VWTA 3E2SA 4LNYA 3UZZA 2NX9A 4H9TA 1MRQA 3R25A 5ECUA 3CNYA 1L6WA 3Q4DA 1RAKA 1JFXA 3DBPA 3GG8A 3RRXA 4ZQMA 4AVOA 4D8ZA 5RUBA 3LNMA 4OGZA 3S6TA 4CNUA 1LP6A 2OU4A 1IGWA 2ZZ5A 4RZBA 1FFRA 4DUVA 4FXJA 4DXKA 4GACA 4FSAA 3WLOA 4PMNA 3MA8A 1XYFA 1XX1A 3GVVA 2Q6ZA 4KFNA 3WJWA 2O0TA 2E5DA 1G1YA 1GOQA 5DCDA 4ATDA 3O0KA 3PBYA 1M65A 1CZ1A 4OJYA 2CWXA 4F48A 4B4FA 4A8LA 4DF1A 4I8YA 1MUCA 3L7RA 1BGGA 4Y8FA 1DV7A 1JCNA 3EX1A 5CJMA 2D2JA 4JKKA 5D2YA 5HJYA 3RMEA 4EOUA 2QYGA 3GQYA 4LC6A 4QQ3A 3VIIA 3MWCA 4D8AA 3KRSA 3GE7A 2WHKA 4GVGA 2WWCA 4Z08A 3BMWA 5A6LA 5DO8A 5HATA 1XRVA 4C7GA 3WY1A 4F66A 4L4MA 4EXBA 2FGZA 2W0UA 4BF7A 4HA3A 1IIGA 4MNKA 1LQAA 1PO9A 1ZCOA 1RH9A 2I1OA 3UG3A 4DUOA 1XFCA 1DJNA 5BXSA 4GABA 3MV01 2GSEA 4GVHA 4AWTA 2BOGX 2WMJA 1HUVA 3FW6A 3GDRA 4WCJA 5AVHA 4RE4A 2V82A 3RPMA 4HP5A 4AD5A 3BSMA 1QW9A 3OPSA 1OK4A 3HU7A 1B0IA 5DXXA 5T91A 1WZKA 3DZ1A 1UH2A 1VLIA 1R38A 1Z7AA 2F2HA 3L0GA 1XGEA 4PCNA 2FZMA 2Z7KA 2HRWA 1XLEA 1V79A 3AXKA 3CAVA 3VIMA 3HGJA 3HGSA 3TYDA 4MM1A 4DJDC 2XVLA 1F3XA 4L9ZA 1RPKA 4B3ZA 3VZZA 3RCYA 4HZMA 3UU0A 5LKYA 3JR2A 3FX4A 5H1WA 2VL4A 2BVDA 4P7NA 4CQ9A 1Z48A 2Y70A 3CWHA 1E6ZA 2PTDA 1A5MC 1I1WA 4LCSA 5AHEA 3TW7A 3WLIA 2NXHA 1H0IA 1VGAA 4DVOA 2FJUB 3RU8X 5CPOA 3WBXA 4L4PA 4C6MA 1S2VA 2DZWA 2GJXB 2XFWA 3ONCA 2DJXA 2ZQ0A 1BTMA 4JEQA 4Q4OA 3HTWA 3EB2A 4NZJA 3UYCA 3DG7A 5CPLA 3RILA 1DIDA 3MCOA 1BRLB 2ABBA 3BE7A 3GW0A 1KRCC 3PZNA 3K1DA 2CESA 4PZVA 3A64A 3GR4A 4P8UA 2G97A 3GZAA 5FI8A 4AQLA 1QNRA 2XGBA 1Q6QA 4CNSA 1YX1A 1AJ0A 4O13A 4C1NA 1JPIA 2GGEA 2NZLA 1GORA 3L2LA 1V7YA 5HR7A 1TZZA 3PSWA 2ZX7A 5JQ9A 3GIPA 1SPQA 3ABZA 4UQDA 4BR1A 4X22A 1TWZA 4MJZA 1PX4A 4IIEA 1OZQA 3KZSA 4GQGA 5GNYA 2WC3A 2FFCA 3UA4A 1UYQA 3N15A 1UUQA 1B9BA 1V6WA 3K5XA 1VRDA 5AKQA 1EWEA 1LRQA 1UA7A 2HCVA 4JFVA 4D6GA 1U5HA 4W88A 3PWAA 1DTNA 4J3UA 3DG6A 1ODZA 1OC6A 4PTWA 3EPOA 3RJXA 2VVSA 3I6EA 3BSHA 1W3IA 4HCDA 4X61A 4LW7A 3ZR5A 5CCZA 1QFEA 1XQLA 2YX0A 3AXHA 4IFRA 1SFTA 3TC6A 5A1AA 1GHRA 1US2A 1VENA 3PWIA 2V3EA 1H1YA 3KRZA 2OELA 4D6IA 3WFZA 4R7WA 1M41A 4ATWA 1HJWA 4YWSA 1BSIA 4C6OA 1H49A 3BARA 3CTLA 3BICA 3SRHA 2ZX8A 5I3FA 3Q45A 4KCWA 1WUEA 3KBVA 1JQXA 4DJFA 3ITTA 4AY7A 3RCNA 3CZGA 2A3EA 5EMUA 3R11A 4FAMA 2C0HA 4OHQA 1K4HA 1KRAC 1XSKA 4PA8A 3AIBA 1B4EA 1UB3A 4D6CA 2WSRA 4I9AA 4LY4A 1Q4NX 4CU7A 2VT0A 4QJ1A 3LBMA 2DQXA 2BHYA 3GU1A 3QV7A 3SFWA 3MUZ1 4IMAA 2YL8A 1U1HA 3HQ1A 2V30A 1W9PA 1PB0A 3M1ZA 2BXZA 1GG1A 4CCEA 2J7CA 3B06A 4MAZA 3ARRA 3N3TA 3CQJA 2WMGA 3W6LA 2OZ8A 1BWKA 3AAMA 4A21A 5D09A 2HK1A 2BMBA 1RVGA 1W5MA 3BCFA 3KHDA 1CT5A 1J5TA 1K3UA 1ICSA 2Z4GA 3TAKA 2PB1A 1JZ7A 1PZ1A 5CC7A 2QHAA 4M8UA 1WDPA 2HZGA 3LD5A 4N4PA 2YW3A 1KBJA 1LRTA 3T6CA 1HN1A 4F0SA 4Y9PA 3SSJA 1EBGA 2CLOA 4K1WA 2PWEA 3BJFA 1ITUA 2DT2A 2V63A 3W73A 3R1ZA 2WV8A 4MZ1A 2VC7A 3AQUA 3APGA 3WENA 4Z2LA 3CHEA 4S3EA 4W93A 4GJJA 4WXYA 4DLMA 3SEPA 4ZFMA 5DRCA 1Z44A 4FOJA 4JXCA 4F8XA 4ALDA 3G1SA 3KVLA 3K8MA 4IP7A 5CPQA 4UTMA 1JUBA 1U2YA 2FB3A 3TR9A 4NP7A 1WZAA 3CK5A 1EJVC 3A4AA 3B8WA 3FJLA 3N4EA 4Y9AA 1QI5A 1QBBA 3BLLA 3R6IA 3HQOA 1PHWA 1RK5A 4NHVA 5F2IA 5F4WA 4GZEA 2PBGA 1I0DA 3VNKA 1HF6A 1W1TA 3O3RA 2ADAA 2Y6ZA 2VHLA 2Z1KA 2OZ0A 2H6RA 3ZWTA 5F2MA 2J8TA 5LNVA 4CLMA 4GGBA 2J7FA 3AYVA 2AL1A 3S1WA 3RHGA 1O66A 3V1PA 2YLLA 3UYIA 3DFOA 2EXOA 1TJ2A 2AAAA 5HWNA 4L5ZA 3R8GA 3LV6A 3M7SA 1GQJA 3LLXA 4RW3A 3TV8A 1I2RA 4RR4A 2OO0A 4V2XA 1TQXA 1E15A 1E6NA 4BKNA 4WY0B 4FR6A 3THUA 1PIGA 4POCA 4QAIA 4GINA 2BOFX 2QJGA 4EK7A 1I60A 3K4DA 3SR7A 2X42A 1YDVA 3C8NA 4Z17A 3U2EA 3P93A 1FWAC 4B5SA 4AZ5A 4H4IA 4JY9A 2Y8VA 3E96A 5CQ1A 2D73A 1QT1A 2WLYA 1IXNA 3I6RA 1OFDA 3M7WA 1XQKA 5CXPA 2GVJA 1CB7B 1XLJA 4YU1A 1TSIA 3APTA 3WNNA 1UPMB 4H6EA 4QISA 7XIMA 4Y7EA 3JS3A 1KB3A 3AS2A 4CUCA 3VABA 2G3NA 4XV0A 6REQA 4RE2A 2C18A 4AHQA 2GJPA 5LGZA 2HBVA 2JALA 3C2EA 3VAVA 1MXSA 4LUSA 4PL1A 1GTHA 2OODA 3CUGA 1QPNA 4ZEPA 4OWGA 2TPSA 5TF0A 2XVGA 8CGTA 4NRRA 3EZ4A 3QTPA 3ES7A 1LTDA 3WL0A 1TTIA 4AG0A 5A5WA 2V6AA 2BY0A 2CLEA 4A22A 2WJDA 1NH6A 3WSUA 5AHIA 5BOOA 4FF7A 1WP6A 3N19B 3W4RA 4C6DA 4DO7A 3BG3A 3MDUA 1SVDA 2PC4A 4OIFA 3MSDA 3AOFA 4BF5A 1H41A 3NQMA 2GWGA 2P0OA 2NQ5A 5ABFA 1LYXA 1B3VA 3CV7A 4H7VA 3VZXA 3MJMA 4HJWA 1XL9A 4IPJA 1W5OA 2DIKA 1V8EA 4IP5A 2EJAA 2MANA 4UZUA 1YLVA 4IG2B 5K9DA 5D8ZA 1JUEA 1V93A 2G3JA 3GTIA 4PMZA 3VE7A 1JL8A 4U2ZA 5M03A 1IHIA 3Q65A 1W3JA 2XGIA 1XLKA 2QJIA 4W5UA 1LQ0A 1S2WA 4G6CA 3GD6A 3MHUA 3OW1A 1A0DA 1HL2A 1WAUA 3NQDA 3VCCA 4B92A 3WK1A 2VFEA 3CHVA 1L0PA 4EXAA 3MVIA 3H2FA 3CUFA 1YPFA 4J3ZA 5AHLA 1UKPA 4K38A 1BXCA 2HWGA 1PYFA 3PZIA 4LH8A 2PDHA 1JFHA 3DI1A 2ZIDA 2PGFA 1BYBA 3AS3A 5HINA 4IX2A 1J2WA 1VB9A 3LCLA 3LPGA 1ICQA 3QFWA 1CECA 2TAAA 2DZUA 5I5RA 3XINA 5E5CA 4S2BA 2XH7A 1XYAA 2DT3A 2QDHA 2G8ZA 4BA0A 4X2RA 3ITCA 3W7MA 5HNTA 3EWBX 4JZ5A 4W7WA 2IQDA 4QHRA 4DNMA 1KO0A 4JNYA 3AYSA 2XFRA 3V5FA 4GBDA 2EAWA 1C3FA 2VZTA 3G5EA 1EDTA 2NX3A 1OGBA 1DBTA 1TV5A 1V51A 4WIWA 2OQHA 1SSGA 1RA5A 2IXUA 4NU7A 3E5PA 4HHMA 3CWNA 5DQPA 4ZB2A 3T42A 5C2XA 3KCJA 4KWSA 4AD3A 2QAFA 1ALDA 1A5NC 2Y5EA 1QI3A 1E9YB 1SJAA 4M3PA 5D30A 3LRLA 2BGQA 3AU6A 3UPMA 4BY3A 2OTDA 1EL3A 2DORA 3BDKA 3WJXA 3W1UA 3WQ8A 3VDCA 1GOWA 4GJIA 4BCEA 3LZ3A 1TIMA 1S38A 3MS8A 1ZP4A 2GDVA 3P5ZA 3NJ3A 3V36A 4LYKA 1KR0A 1ZAHA 4CD8A 2Y4SA 3AO0A 3VX1A 7A3HA 4MAVA 3JVAA 5BW6A 5C70A 4LS0A 2V0TA 4S3AA 1X96A 3F2CA 1KCXA 5D33A 3R7MA 3IRSA 3CUZA 3MUY1 1UA3A 2CZEA 3LEPA 1UC4A 1ISVA 3N34A 3GXDA 1LG2A 2DZPA 4H2CA 3SCUA 4E4UA 4GD0A 1SR9A 1TVNA 2GVYA 5DFAA 1EJRC 2X0HA 3W7EA 2D3NA 1K9DA 4PMDA 2W92A 3W26A 4S2CA 4L7ZA 3COTA 3KWXA 3GM8A 5AYIA 4FLRA 2QJNA 2ZX6A 3L65A 2Q01A 1DPMA 4HYRA 3IGUA 5DN1A 3SZ8A 2RDWA 4CQBA 3QKZA 5H6HA 4A3HA 3ZT6A 4LANA 4W85A 4M7TA 1LOQA 3KFTA 1JCJA 4KESA 4QE5A 3PN8A 4I90A 4FX8A 4IIGA 4DJEC 2HPIA 4ZZ9A 2AQWA 1H1ZA 3D47A 2JKPA 3BMXA 5D32A 3B8SA 4LY8A 4MFDA 4URIA 2YXGA 4PMXA 3UP8A 3ARTA 4ZBCA 1LDCA 3W2UA 1Q4WA 3AMLA 4DHGA 2J8FA 3GTFA 5M3WA 1P6WA 4QS5A 4P7RA 3VI2A 1BF2A 3DESA 2X1SA 3TYCA 2ANUA 4KPLA 1M03A 4AD0A 3NTYA 2DDXA 3HFTA 4XBKA 1GQNA 4A29A 1MDRA 2C1HA 4ZB0A 2VFDA 4B5NA 4DJFD 5GPRA 1AG1O 3SIZA 1KA9F 1JYNA 3PJXA 4DM2A 2Z24A 2TODA 1TKKA 4BF9A 2QUMA 3T0CA 1E4MM 3ZXWA 5EL1A 2WXDM 3CZEA 3TWBA 1U33A 3GXPA 3UJ2A 1J0JA 1LT7A 3S47A 2O9RA 2X0YA 3BW3A 1BWLA 1HJVA 4GGHA 3W1XA 1WBJA 3RX2A 4XAZA 1DJIA 2ACRA 4Q4RA 3SJ3A 2FLIA 3N2OA 4I8DA 4LU0A 3VNIA 1NP2A 2A5HA 3TN3A 2UY3A 3VDBA 5TBOA 4YTTA 5I6SA 3PPGA 2A2IA 4UTFA 3S9IA 3KP1A 5HUOA 2B4GA 2R1NA 3N9RA 1WAWA 5EPDA 4RPPA 3L4WA 1FWJC 1EEXA 2FTPA 4ZGYA 1HNYA 3WD4A 4F2BA 4M24A 3SQMA 4HJFA 4AIBA 1D7FA 4O18A 3S0CA 1CGXA 1ZQ5A 1H60A 3V1HA 4MB5A 3BCDA 4X9SA 4JTCA 1RD6A 1DVJA 1XUUA 1KFEA 1Q6DA 3MCNA 1E56A 3W00A 5JXQA 1O94A 1OJXA 3VIOA 2IPWA 5J5DA 3KVJA 1KFWA 3QZAA 1XICA 1RXOB 4GOAA 1PKLA 4KBXA 4PODA 3K46A 5REQB 4O15A 4LUTB 2OWXA 4A4AA 4XVEA 3THQA 1ML1A 2WVUA 1AL7A 2DSZA 4IM4A 4Q3MA 5ECVA 1EC7A 1I2PA 1PIIA 4E4FA 5A69A 3CQKA 1IEQA 5AC8A 3VNYA 3EEGA 4YPJA 3SGZA 2X1RA 3AC0A 3QW3A 1YNQA 3W2MA 1JZ3A 4AH7A 4OZOA 3EYPA 1A53A 3ZT5A 2PODA 4HU0A 4CNPA 1PTGA 1PTDA 2AL2A 4U5IA 4EP8C 3H4XA 4N02A 4OOZA 2XU2A 1PCWA 4OBTA 1J6OA 4LVGA 4N42A 1IT7A 4V27A 4IISA 1JDCA 2YGYA 4UTTA 1BVZA 2VQUA 2PGEA 2YXXA 3M0XA 9CGTA 4MDPA 1LJYA 3VC6A 4CEXC 1YXYA 2VFFA 4GMEA 5L6UA 1DIEA 6ENLA 1FDJA 1DP0A 2REQB 3H70A 1KFCA 3OGVA 3WLPA 3VA8A 5FSEC 3B4YA 5IFPA 1TPFA 1H51A 4O4WA 2VR5A 3H4GA 3BXWA 1EA0A 2V9DA 5AFDA 4KFOA 1W1IE 3OLGA 3SN1A 1E1CB 3L21A 4IMCA 1QNPA 1ONXA 3DC0A 4QM1A 4OE7A 2PWFA 1Q2SA 2GOUA 3O1NA 3W81A 1K8CA 1WNOA 2W61A 1RP8A 3STEA 4HQVA 1AZ2A 3CZLA 3S8HA 1U1UA 1Y7VA 4IJRA 5BRQA 4CQAA 1I75A 3ARUA 4DBDA 1JDFA 1F7BA 2J8GA 1OYBA 3NZQA 3URAA 1AQ0A 3QZEA 5FJIA 3VIKA 4C6EA 4A2SA 2G96A 3KOYA 1A3HA 5A6KA 2E8YA 3PFMA 3KEHA 3NL6A 3NM1A 3M64A 1WDSA 1GT8A 4GUIA 5BXRA 2VTFA 4EANA 4CQ8A 3N2MA 4B90A 4GKTA 1EYWA 1U5VA 4B5XA 3RLUA 2PZNA 1L2QA 1JGIA 3HMJG 5L9FA 3A3HA 4FMVA 3BUVA 4NX5A 3UCDA 3W24A 3E0VA 1XDMA 4PBGA 1CTNA 1XIMA 1MNSA 4U5KA 3A22A 3S9ZA 3OYZA 1KQYA 3L4XA 5EFDA 1QRQA 3B0PA 4ILSA 5H2ZA 1E9LA 3AYRA 1DWFM 2RKXA 1U83A 5JU6A 1PS9A 2X16A 3QM3A 4KFPA 4QNEA 2EGZA 3FKRA 4FOKA 1V0LA 3MHGA 3PZUA 3W76A 3NEHA 2V5LA 4TTGA 1J01A 1D9EA 5GNZA 3TWAA 3LYEA 4HCHA 1FP8A 4KKXA 2GPTA 2Y24A 1UWAA 4Q4PA 1EUNA 1JNEA 2DH2A 3P61A 3KL5A 2PDLA 1UD5A 2Z2AA 2D0HA 3CPRA 1JJKA 3S46A 2DFAA 1PEZA 2H3DA 1Q6EA 1ZJAA 5K3VA 3V18A 4I7WA 3V16A 2F7FA 2VKZG 4H41A 4OT7A 3K2GA 3WDQA 4XTDA 3OYXA 5CZ0A 2ZRUA 4Y6GA 3UNDA 4H9MA 3G8RA 1I6NA 5CZTA 4QP0A 1LBLA 4RNJA 5FIPA 1FCUA 1XHGA 2X30A 1H7XA 3WQPA 1B3WA 3AICA 1PZ0A 2FH8A 4O1FA 1OWQA 1AL8A 2EPMX 1WBHA 3NOYA 2Y0FA 2HS8A 1JI2A 1O68A 3WLLA 2PFHA 3FYOA 4AC1X 3BZJA 1YDYA 3OOQA 2HBXA 1F2JA 3LHZA 3CO8A 4HNCA 4KCUA 1KV8A 1XBXA 2DUAA 2O9PA 2W6RA 1MQRA 1GZJA 3M0MA 3LCIA 3VNZA 5T9BG 1LQ2A 2Y1HA 4EAMA 7ODCA 3CUXA 3GDMA 2J7EA 1UPPA 4XAFA 4YL2A 2DPEA 4K8GA 4HYVA 1A49A 1J0ZA 1B9ZA 1FWGC 3UGRA 3C3NA 3C2FA 3M4HA 1JDAA 4PEKA 5G2IA 2Y5SA 3T4WA 1H61A 5KZMA 2ZX5A 4HNUA 5GJPA 4PBEA 1UD2A 2OG9A 1H7WA 1AQFA 4LAOA 3NQFA 3P8IA 5FF7A 3W75A 3LHVA 3SY5A 3STGA 5DCBA 2ZVIA 2IMRA 3OZOA 3LBOA 3P5YA 2PLMA 1QJWA 4U3AA 2XSAA 1MI3A 3TUUA 3TOYA 3M41A 4YLWA 3LQLA 3V7PA 5I79A 3RX4A 3MUIA 1OEPA 4BI6A 5CG0A 1JZ6A 5FEZA 1GJPA 3EAUA 1UMYA 3ELFA 4IGSA 3KS6A 4R5EA 3OA5A 4PMUA 2CBIA 2A7NA 5CJ5A 3GX9A 1V02A 2PWHA 3C0QA 3QMSA 1KFLA 2Q09A 4JIPA 3OEXA 3TW9A 1W2PA 1D8WA 1US3A 1S2AA 1WKDA 4LYQA 4S3KA 1JYWA 3GH7A 4DIAA 1T96A 1LLOA 2R94A 3CYJA 4ENLA 1AW2A 2P5NA 5MKGB 3TKFA 2WHLA 5SWUA 4AZBA 1YYAA 2YCJA 1KCLA 2TRSA 1MQPA 1VCFA 3BAXA 1W2VA 2ZDSA 4WDXA 3P62A 8XIAA 2J75A 3AUOA 5BMXA 2VX4A 1UUMA 2FZDA 2YCLA 4Q7BA 3UWUA 1LUCA 1I2NA 1V02E 2HMCA 3ORWA 3S5YA 2HE8A 3BJTA 3ZJKA 1KKRA 1ZP3A 4GRSA 2PGWA 1R9YA 3B05A 3AHZA 4QLJA 2WBGA 4PMVA 2ZXQA 4HU4A 3DFTA 1XYCA 3PULA 1O5KA 3QY7A 4WSJA 3H6OA 2Y85A 3CEPA 5TD4A 2X09A 3MVTA 1VFFA 3WMCA 2FPYA 3ZIZA 2ZRZA 2E3ZA 5TNVA 3TC7A 3SI9A 3E1F1 5AECA 3H21A 3ITGA 4UQBA 1E6PA 4ACZA 2PDWA 1JZ4A 2BHUA 1TFVA 1VR6A 1RPXA 2NT1A 5IFTA 3W70A 4CU6A 5CBJA 1YBQA 3BC9A 2QF7A 1BKHA 4LBSA 3TQPA 3FV9A 2JQXA 4AD2A 3CMFA 1JI1A 4QSHA 3TIMA 2F38A 4D9PA 3ONBA 2WZIA 3UD6A 3Q67A 4BK9A 4JNMA 4XZNX 3WZ0E 1CGTA 2XWEA 4R7JA 1A5AA 2TSYA 2WB5A 2GJNA 3A21A 2FYMA 4IWWA 2PWDA 2GK1A 4MY9A 3ANUA 2BHZA 3K4WA 3F2DA 2H9AA 2E40A 5DBUA 4MJ2A 4XKYA 4GY7A 4C6QA 2YL9A 4HA4A 1RCOB 3WJSA 1EOKA 1X6LA 4OUEA 1TWWA 4L4LA 4X9YA 1AW1A 5FD0A 3U7VA 1UKSA 4WUIA 3WLRA 3RNDA 1MW2A 2R6OA 3M0LA 4O57A 2XIIA 4CVWA 2QV4A 3W0KA 4TVCA 5DT7A 1CX9A 2P0IA 1DE6A 5EMLA 2WCAA 4O53A 1O7AA 4V33A 2VEIA 1JCXA 2EF9A 4JKLA 1AMKA 4H19A 3FIGA 4LTSA 4A3QA 2FHBA 1CGUA 3QR1A 4P8XA 1U5JA 2UY5A 4RZ5A 3TEVA 5E0CA 1VP5A 1N55A 2EQDA 4GXPA 3IJ9A 1UD4A 3DUGA 5CC5A 1Q45A 2J4GA 4W8AA 1UD3A 3EBVA 1UROA 3TSDA 3W23A 1FWEC 3DGBA 1V08A 4I5XA 1PIFA 5I3HA 3ARYA 3AZSA 1RJPA 4N9CA 1QOXA 1KWGA 3LM7A 1A0EA 4QQUA 2GQ3A 1W5QA 5B7ZA 1DJZA 3P0XA 4NI3A 3W25A 1UC5A 2O4QA 1CEOA 1K70A 1EYEA 4IFKA 1RBLA 3FEMA 3PZOA 3ALFA 3G1RA 1RD5A 4LB4A 2DQWA 3C0JA 4UMCA 4AVFA 3P7YA 3IVTA 5D4YA 4DWDA 3LNPA 3WMSA 5G4WA 1CXLA 3QMRA 4I6VA 3PM6A 4FIQA 2WJZA 5BU9A 1X7FA 2XDFA 2ZRWA 3M44A 1QXLA 4YCPA 1E70M 4NYUA 1NJJA 5A8GA 4IIHA 3TN6A 1XIIA 1V3KA 2PMQA 3P14A 4JBRA 3LPPA 4R88A 3B9DA 1IEVA 3W7PA 5C55A 3SUSA 4O12A 3CMJA 1BF6A 3G24A 3W87A 2J78A 3S2LA 1GKQA 4DPPA 4FB7A 4XBJA 1Q63A 4WLCA 1AD4A 2VEMA 2VRKA 4MDOA 3VD4A 1QOPA 4PEEA 3VX0A 3MSYA 4MB3A 3VGBA 3M5ZA 5D05A 4E2BA 4PUJA 3WLTA 1TREA 3SCVA 4WF7A 4UOQA 1UWSA 4XAPA 3OLIA 1PUDA 3QGKC 2ZOXA 3PS7A 5HWJA 2GUUA 3AHXA 3NCOA 4DWSA 4LAZA 3ANYA 2FGLA 4ADSA 5FEWA 3LDVA 1V03A 1O1HA 3S1XA 1NARA 1A3WA 3A5FA 3LA4A 5LGXA 5CAHA 3GTHA 1XH0A 1V0KA 3POCA 3M0IA 3QTGA 1SZEA 5BCAA 2ATSA 3MKVA 2WNWA 5FKYA 4M1BA 3TROA 1VEMA 1VLWA 1NFBA 2DEPA 1V77A 3RIKA 2FHCA 3W28A 2YLAA 2VCBA 2XHYA 4R53A 5IBXC 3T05A 4PUWA 6REQB 1JYXA 3GXTA 1W6TA 1QU4A 3MHFA 2JEPA 4NL1A 3NZ1A 3IK4A 2W91A 1NFGA 3AMKA 3QR3A 1ZL1A 3NO3A 4JKMA 2UV8G 1Y8BA 4UTLA 1AK5A 3UCQA 3S1GA 4M6PA 2YBTA 3WQEA 3FVDA 4GPNA 1Q66A 4Q8OA 4UTIA 5LYRA 2XN2A 4GYKA 4XISA 1ECQA 3H4WA 3VC5A 3S3GA 3W2NA 1TPWA 2BXVA 1GQKA 1SW7A 1FQ0A 4FEZA 5ENLA 3WK0A 3TQ0A 3W38A 1T7LA 4QROA 4F9DA 5ABFB 2GOKA 3DBNA 5DBTA 2WW5A 3BGAA 2WANA 2V68A 4KIRA 2Y88A 4J4KA 3DFNA 2E68A 3UG5A 4GUHA 4Q6XA 4REQA 2ZBTA 2VX6A 5HMEA 3H8AA 3HV9A 1KXHA 4JDBA 3NQAA 4W7UA 1E6QM 3H7UA 2CLKA 2ODOA 4KCVA 3TTEA 3G18A 1DEDA 4MYAA 4FS9A 2NW0A 1JCTA 1J0KA 5U7SA 5B80A 1FFQA 4LAUA 3AMCA 4RDVA 4B3LA 3CASA 2QT3A 1EKOA 3W37A 5E09A 4AY1A 1QNSA 1EQPA 3OU8A 4IQJA 4G7EB 2V5JA 4GA8A 3D0CA 4EVZA 3HGRA 3GDTA 1XI3A 1UH4A 3AI0A 1IF2A 3W9ZA 3WD2A 2OQYA 1W1VA 5CSSA 5HJXA 1TA3A 3NURA 5DF0A 5I2UA 1FWFC 3L66A 3AJ7A 1TELA 1ITQA 2W9MA 1NQ6A 2Y62A 4UIOA 2J74A 3NDOA 4IPLA 3CXOA 4NAEB 3KE0A 1NDVA 2CIPA 1DL3A 4AZ7A 1T8XA 3KZPA 4CQCA 4FNPA 2VM8A 4C6CA 3VGGA 2VUNA 4GZ7A 2OXNA 4MNMA 1SFLA 4Y8EA 1L6FA 1FP9A 1L2UA 2I17A 1TV7A 2A79A 7TIMA 4RLIA 2ZC8A 5C9RA 1WB0A 1HT6A 3I4KA 3VDHA 3NO5A 1EF3A 2DZSA 4K37A 3OP2A 5ABTA 3M0ZA 3GXMA 3IJDA 5FOOA 2GGGA 4UBPC 5FL0A 3CC1A 4KCTA 4DO4A 2O55A 3W1NA 1HFBA 3WNKA 5EBAA 3CAQA 3FGCA 1JCLA 4J3TA 4ZOEA 2P53A 2IKGA 7CGTA 3TFXA 1YIXA 2MUCA 4OFCA 1HX0A 4Y96A 2WO5A 1XPYA 1TTJA 2ISDA 1KFBA 1J11A 1C7TA 1OT2A 1DJQA 2ZZ7A 2UY4A 4W87A 1JG9A 3G3DA 3WG6A 3FS2A 4JFTA 4K1GA 2OT0A 4S39A 2Q8XA 4HN8A 3PNUA 1X1NA 3W84A 4BWLC 5LXXA 2ZUNA 3L68A 5CSYA 3CV6A 2D20A 3E5BA 3M07A 4J28A 3AWNA 1SZRA 4KEVA 1HZYA 2E5BA 1W91A 3WLKX 1HKVA 3RX3A 2XGZA 3UVIA 1LLWA 2DSWA 1H7RA 4JOMA 2WVVB 4MUZA 1W1ZA 5LNRA 5CSRA 1C8VA 3STPA 3SQLA 3LUTA 1OY0A 2OZ3A 3L12A 1G4TA 4FLOA 5DMNA 4PTNA 3R0UA 2KZHA 3W7JA 1VIZA 1HJQA 3B8TA 2HDJA 3HZ3A 1J6PA 1DKWA 2DP3A 2RGLA 5HQEA 3C8FA 4R9XA 3DKLA 2CXEA 2CETA 1B1YA 1HW6A 1Q6RA 3N25A 2VZSA 4MHBA 4ZTXA 5BOFA 3GW3A 2H3BA 2WYSA 2WVTA 4AZ6A 4KF1A 4LT9A 1MO0A 3W7NA 1S2CA 4AMAA 4RZ4A 3R12A 4D6FA 1NTHA 4FNQA 3CS2A 2ZVRA 5C6MA 2QXWA 1ADOA 4JDYA 1YXDA 1BXNA 1ZB5A 4UR8A 3SUVA 3WBYA 4H01A 1P0NA 4PN2A 3L4YA 1I9CB 2A6LA 1B31A 3I6TA 2Z2BA 1GJUA 4GY0A 5CJNA 3WF1A 3W1AA 4GYPC 1PKMA 1FY6A 1T40A 1CLXA 4TMCA 4KGLA 2WSPA 3RCMA 3T40A 3WJZA 2XVPA 4KGJA 4WQ6A 3IJQA 4LF2A 1DWAM 3L5MA 1QNQA 4K39A 1O4UA 1E4IA 3W2KA 3EOEA 2NUXA 3NWRA 2Z6JA 2BGSA 2AOSA 1GWJA 1REQA 3NXLA 4YJ5A 1GOMA 2D0FA 4B9YA 4PC8A 2PEVA 3H7VA 3RLHA 1MRAA 4Z1CA 3L2MA 4W8LA 3CT7A 3ZM8A 1SJDA 3AIQA 3T78A 4ZB5A 1Q6OA 5G2WA 4UFKA 3DCPA 2Z1SA 4L6DA 2EJ1A 4GISA 2XWDA 2QJMA 1TV4A 1DXEA 3CEUA 4HK5A 3SO7A 2E9BA 2E9LA 4HMDA 3PFRA 1GYLA 4EX4A 3VILA 4K3ZA 1OCNA 4GG9A 3UT0A 3T8LA 5BRBA 4LUYA 1F05A 2RJHA 1F3EA 1G7UA 4IQDA 3LSBA 1ZJBA 3ZWSA 3VM7A 4RV3A 1DIKA 1ZNNA 4LRTA 1A4LA 1Q7MA 1PDYA 3QQWA 4MWAA 2HEJA 4GWEA 2CYGA 4F0HA 1OGGA 4UUIA 1GK8A 3PTKA 4IMDA 1YKWA 1XLLA 4OTKA 4E8GA 4A05A 5HNUA 4AIEA 2ZUSA 1OD8A 1BFNA 2BVTA 4HZ6A 3W07A 1DORA 4EKJA 1XLGA 4WJEA 1XLIA 3NQ7A 4Q4QA 1UJPA 3U0HA 2GUYA 5D37A 3T9PA 1YE6A 2BWGA 1VJSA 4ERGA 4GIRA 4YHEA 2X1IA 3AMDA 1Q6LA 4XD4A 4PUUA 1TPC1 2CU0A 1OCJA 2OX4A 3AIWA 4MWAE 3YPIA 2V2DA 3R10A 1WX0A 4Z2GA 1VF8A 1IYXA 1F3TA 4DX3A 3P60A 4UQ9A 4IFOA 2VMFA 1E73M 1RJRA 2AL2B 2WZHA 4QTGA 1FHLA 3PJUA 2ZZ1A 4ML4A 4AEFA 3RLVA 3SM0A 3BTNA 3UY7A 2WNQA 4MNJA 1R9XA 1V3HA 1BG4A 3ABSA 3WQ4A 3ZVHA 1VFSA 5DY2A 5D38A 4DBEA 3P84A 3T0BA 3AS0A 4DWSD 2D0GA 5HUPA 3RU6A 4Z42C 4ECLA 1G4EA 2R1LA 1EJTC 1UR0A 3DFQA 2BZNA 2Y7GA 3ARXA 3EMQA 3WL1A 1UWQA 4HPHA 3OO2A 3BANA 1V3IA 4PMYA 2I14A 3CH0A 4BFAA 3UR7A 4UTKA 3WFAA 3F5KA 2E09A 3K4AA 2PTXA 2YYTA 2ZZ3A 1H5VA 2VWSA 4HNOA 4DI9A 1L9WA 1XLCA 1JF5A 4ORIA 3E2VA 1R3WA 4X2PA 1TPVA 3BW4A 1DWIM 3CZJA 3L4UA 4MZYA 1K7FA 4HTYA 4NRSA 4W8BA 4AIOA 4G9PA 5BOEA 1UBSA 2FPVA 2NQZA 4NXSA 3QY6A 1DJGA 3H12A 2QCDB 3TMQA 1VAHA 4Q8UA 5BXTA 3TN4A 4K8HA 2YA1A 3A9IA 3ICJA 1QHOA 2IS7A 2ONEA 2C1GA 2VDGA 2TYSA 1KFJA 2LLEA 2JF6A 3E2RA 4QE1A 3CQIA 1UR2A 2F6UA 2BVWA 4HKPA 2PE4A 3IK2A 4F0LA 2C15A 6A3HA 1QI4A 1FOBA 4J35A 4ONVA 3PZTA 1GONA 3EB4A 4QDWA 1M6JA 3H2MA 3ITXA 1JUKA 1V3LA 4HIBA 2PF8A 4FO4A 4PE8A 3ISIX 1UQZA 1HJSA 2PTYA 3JRKA 1C9DA 2VELA 4W84A 1HGYA 3TOPA 1OGSA 4NI8A 4AX7A 4IHCA 1TMHA 1YXCA 4I7UA 4D71A 1UZHA 1NIUA 4Z2KA 1UR8A 2OJPA 3BVJA 4GXMA 1XLBA 1A5LC 3L0NA 4HK6A 3LU2A 5XIAA 4LSBA 2XN1A 3E0FA 3KBJA 3QV6A 3PANA 4LAMA 4ZO9A 4C6IA 2IQTA 2XIJA 3IJ8A 6XIMA 2HE5A 3TR2A 1POJA 1Z69A 2I56A 2VDIA 5DMMA 2Y2WA 4A8NA 1OYAA 4E0CA 1T41A 2X1UA 4XIMA 1NF0A 1X1ZA 3FLUA 4MB4A 1FTXA 4GI6A 1HTIA 1SZNA 1W5PA 4MKVA 1B90A 2ZUUA 5AZ0A 3SRDA 3HGOA 3T7VA 1S1PA 1R47A 1RBAA 5IHRA 3W7GA 4M6QA 1UZ4A 1FKWA 3L4TA 3WO8A 2WPGA 1WUFA 3CHFA 2JEQA 3ATYA 3RR4A 3WD0A 3A5VA 3PSVA 4BQ5A 4E3TA 3T1GA 1V5XA 3B3DA 1XF0A 3LOTA 5HDRA 3H22A 2G37A 4O28A 3IARA 4L64A 1TJRA 4H3DA 1FWTA 3BLOA 1QATA 4FOUA 5A6JA 4QRNA 3T0DA 2J27A 2EPOA 1FBAA 3BK0A 1G4PA 1XYZA 4NASA 4BEQA 1NDWA 1M9HA 1WQ5A 1B4KA 3BG9A 3T0AA 2FHFA 3L5LA 2JKEA 4X0NA 1F74A 3EDJA 3GFZA 3CV2A 1NVMA 1CDGA 2ABAA 3TNOA 4GY1A 4HSNA 3PZ9A 1XBVA 4NUWA 5AC7A 1OX4A 4NNCA 3MBDA 3QVQA 2G4JA 3OTRA 5ABEA 3OB8A 3PK7A 3EXSA 1M53A 4LS2A 1OYCA 3DENA 4IUOA 3EWYA 3R4IA 4MJMA 3VFCA 4KWUA 1UHVA 4JYEA 5JVLA 1GOIA 4RXGA 3WLSA 3PBGA 3S6OA 2ASHA 1OF8A 2ZUVA 6ALDA 3LHTA 4A35A 5GVJA 4WY0F 4JPGA 2PDXA 1XIJA 2Z25A 1XIGA 5H8UA 2D69A 3AROA 2AQVA 4P8WA 3KWSA 1EBHA 1V6TA 1MDLA 1PAMA 2Z28A 1K9TA 3M0YA 5C2GA 1GVSA 2PTZA 1FWDC 1J4EA 2VNCA 3PBMA 1SO6A 2ZTJA 3UJFA 1XIBA 2C3ZA 3ZLGA 2XYLA 3TJIA 3A4XA 3WNOA 1TX0A 1IR1A 2YJQA 1XIEA 3EA1A 4EWJA 3WQFA 2XM2A 1LWHA 4WR3A 4MYXA 3MP5A 2WMIB 1SW3A 1JDDA 2HQAA 4HOZA 2NXIA 1XS2A 1ZZMA 2ON3A 3VK5A 3STCA 4F9JA 3P3BA 1TWSA 4L9XA 4IMGA 1VBRA 3FJNA 4GKLA 4H9VA 3PTMA 3BV4A 1TPUA 1OVDA 3TLLA 3T2OA 4BS0A 2VFIA 2JKAA 4BI5A 3KRBA 3ERPA 3ZQ9A 4C5YA 1TE1A 1KM0A 3B9NA 2PU1A 3WQOA 1EO7A 3GDLA 2UZ9A 5CEWA 5E9AA 1QNVA 4QCFA 2OMAA 3DG3A 4JD4A 4F40A 4GI4A 3ABQA 4IMEA 8TIMA 1LUCB 3PY2A 2C14A 3U57A 1BHGA 4J5NA 5IXEA 1XWYA 3F5LA 4TU1A 1YPXA 3EDFA 1K6WA 4IX0A 1MSSA 2YCEA 3A6OA 3HPSA 3FNDA 4L9YA 4OBSA 3EB3A 2JGYA 1UQYA 4YIWA 5D03A 1YNPA 4FF5A 3C52A 3PJTA 4AIUA 2V5DA 2VZOA 3TAOA 2BP1A 3CAKA 1GVFA 2J9YA 2PDQA 1XM3A 2INZA 5I3JA 1OFRA 1ZBKA 3N2TA 2V81A 1XGZA 2HK0A 3SUWA 4ACZB 1PBGA 1C9WA 4HNTA 1VFHA 4QLKA 1WZMA 2BXYA 4JTGA 2BFGA 4DELA 1BEUA 3VM5A 2DT1A 1XYLA 5AC4A 2B31A 2O7SA 2PP0A 4F2TA 3C2RA 1FWCC 1C8YA 4IQLA 4AF0A 2QCEA 3DX5A 4NKCA 4NZ1A 3BLDA 4C6BA 3ITLA 3WNPA 5I23A 5G1MA 4WVXA 3UJRA 5C9WA 1AJ2A 1GW9A 4CVUA 5AZ1A 3NSMA 4LOCA 3R0DA 1KRMA 2J6XA 1KTBA 4FLSA 2DW6A 4D1IA 3O7UA 3F5JA 4CCDA 2CHNA 1SM9A 4HSOA 1I45A 2PLCA 2GJXA 1WXJA 4MWAD 3T07A 3KP0A 1ISXA 1NELA 4NSBA 2X05A 1E0TA 3EMCA 1RCXB 5HMDA 3URBA 4UMBA 2GK1B 1ZY9A 2WKGA 1BRLA 4ATLA 4LXFA 2G50A 5CH9A 3GC5A 5KEZA 4RW5A 2QUUA 4XX6A 4FLQA 2RAGA 3PG9A 1E5JA 3QR0A 4UQEA 2GQ9A 4O1AA 1CGWA 3WDIA 1TR9A 3ARQA 1W0MA 4WOZA 3GDBA 2A85A 2PAJA 1GUVA 3IJ7A 3NVTA 2AQOA 4M5PA 5FACA 1VJIA 3BLIA 1UWUA 5G4EA 2WVSA 1FCVA 2E77A 1WOBA 3UETA 1AQHA 5AYBA 2A21A 2PBOA 4ROQA 4W5ZA 1F73A 2PZ0A 4LUIA 4KRUA 1WXZA 5JUVA 1EDQA 3OG3A 3PBVA 4JY8A 4MOZA 4HB7A 4CGTA 3IGSA 1Y5XA 3KOFA 4UFLA 1T99A 2W5FA 1ZJHA 2QULA 4FZIA 4H8VA 5I7GA 3BLPX 4AZIA 2J7HA 3GVRA 4TO8A 3LTPA 2YR1A 5C9UA 4H8UA 3BOXA 1FUYA 4DJFC 5AHNA 1KM3A 1S39A 1KWKA 1S5VA 5EY5A 4MGGA 5HULA 5CAKA 2HSAA 4P8VA 3H2AA 1UP3A 4JQ4A 4LAKA 1JXKA 4NAFB 3P80A 1E6XM 2PRMA 2W27A 1FWSA 3MMDA 1GEHA 1HJUA 1VKFA 2UWFA 3RLGA 4O50A 3POHA 3RRAA 3WLQA 1SZGA 4R34A 4ERIA 3GKFA 3MQTA 4I9TA 1V6XA 5CZJA 4HMEA 1VBJA 4UXDA 2E6AA 3BG5A 1VBHA 3EWUA 1Y5VA 3ABOA 3WN6A 3DKJA 1RY8A 3PAJA 4D72A 1NQKA 3PUOA 4K68A 3WH8A 1JRBA 1IR2A 5TAOA 2C8NA 3BH4A 4D6DA 2ICSA 4KT2A 3W7LA 1LCOA 2EO7A 4L1GA 3EOUA 1HVQA 1K7XA 1HKMA 1M1BA 4QIUA 5I3IA 2QR6A 3RM4A 3USBA 3FKKA 5AN7A 4UNLA 1Q7ZA 4LGXA 2RHGA 2NSXA 2AAMA 4XZ9A 1DQWA 2B0MA 2QDEA 1KNWA 1XCFA 2A7PA 4L80A 1XKJA 2YBVA 3CUJA 1ZFJA 3QLDA 1AODA 1K4GA 4G2DA 2ZICA 4UMAA 2NQJA 1UIPA 2QZRA 3RXZA 1W8SA 4XB3A 3N2CA 4JQ3A 1X6NA 2QMKA 2VZVA 2GUBA 2FTWA 3WCZA 2PPGA 1LORA 2PDFA 2E8ZA 3MWAA 3OJGA 1T8QA 2OKTA 4Q7NA 1R3YA 3C2OA 4MJ4A 3B0UX 2WMFA 4DWSB 4E2OA 3BMVA 5IHSA 4AUBA 5KZEA 1AQMA 5DLCA 4K6AA 4U3CA 4HNVA 3C56A 1QPQA 2Z1BA 3VCRA 1OFOA 1OFPA 1Q6GA 4WGHA 1R46A 3ARWA 1UH3A 2NWRA 2YFOA 3A4WA 3KBWA 4AWUA 3LGDA 5KMYA 4GH1A 3LGGA 3W02A 3MY9A 3FA3A 4E8CA 1DTUA 5MHBA 1UJQA 3QW4B 3RO6A 3P81A 4M56A 3H55A 4LC8A 2RH9A 1F4HA 3I3DA 4XD6A 4TX9A 3GKAA 4QX4A 3I3EA 3P8JA 5DCEA 8XIMA 4PFHA 4AWEA 1XRTA 2F9RA 4H9XA 3CL6A 1SQ7A 3PR2A 3W85A 3WQWA 3IRDA 1WPCA 2WQPA 2BDQA 3AHTA 4C65A 4JN7A 1TE6A 5D04C 2YL5A 4Q6JA 4DYEA 5I24A 3WUEA 1LBMA 2G5WA 4JTUA 2PSNA 3WDJA 4UNKA 2I16A 4KWWA 5C0QA 3KOZA 3HQNA 3QXBA 3RAOA 2A3BA 2AKMA 4WRHA 3TSMA 3WLHA 1WV2A 1NDZA 1HKKA 4WY0A 2INEA 1DJXA 1TJPA 1H11A 4NJGA 4QGCA 1BD0A 1H62A 3B9OA 3SRFA 1EQCA 4UFHA 4REQB 3WUGA 2CLLA 3M5XA 4CNTA 1NSJA 1KXTA 1QWGA 1AH0A 1THFD 4M7SA 3PWGA 3N2XA 4B15A 4F2UA 1GPWA 3QV9A 1OX6A 4ZE5A 1LOSA 3I7RA 1TZ9A 2BS9A 2DVXA 2YCKX 4JL2A 3HMCA 1D2KA 3B9EA 4BQ2A 3DERA 4R85A 4DZHA 2QUTA 3LRKA 4N9EA 1EX1A 4GLEA 4IP4A 2NV9A 3VD5A 4PB3A 2ZC1A 1F6YA 5DT5A 3R89A 3OLDA 1GVYA 3OG2A 3GR8A 5IDZA 3HG5A 5GQBA 1ZBCA 3IIVA 2VOTA 4OKDA 3R8HA 1IWAA 1E43A 2VQTA 2B7PA 2IKIA 4Q8NA 3WJYA 1BYCA 1XIFA 4DYKA 1NOUA 3GNNA 3IAPA 5GNXA 2XH2A 2XPKA 3HIJA 1NM9A 2F61A 1V3JA 1M7PA 1BQGA 5HK4A 3IEBA 1I0BA 4G1NA 4LQ1A 3TONA 3P67A 4JHOA 3II1A 4IG2A 3GDKA 1SO3A 2OLHA 4TQTA 3REQB 4QLLA 1JCMP 2D24A 3MP4A 2XH0A 5T26A 2CZ5A 3IJIA 3CHCA 3M43A 1B54A 1V0NA 3FGCB 4Z1AA 1CI1A 2IXVA 3OA3A 1P6CA 2I5QA 3GBDA 2VFGA 3EDEA 4P7LA 3LK6A 3G1FA 2QAPA 3VXGA 1U1JA 1Z89A 5G5IA 2X7WA 3W1RA 1PKYA 1TRDA 2JIWA 4LEFA 4JX5A 1R3VA 1MNZA 5CG7A 1A5UA 2QDDA 5C71A 1YE4A 5I09A 3QN3A 1QHZA 4XWUA 2Y61A 2HNHA 3SBFA 3GUWA 1G7VA 3OQ8A 3TTOA 3IJ6A 3B8DA 5H8MA 1GYMA 4RDWA 1E72M 1POKA 3M16A 4NILA 2QJJA 1KBKA 2ZE3A 5FCZA 2GSJA 3NL3A 1F3WA 4FK9A 1B5TA 3FN9A 2B7QA 2PUZA 1F8MA 4WXZA 1QNOA 2Q3OA 2RDUA 1EXBA 4ZCWA 5IM51 2BBFA 5F4XA 1WCGA 1R6WA 3QSRA 2ZADA 4NT0A 4S3BA 3S83A 5F1VA 2R82A 1IGSA 4Q8VA 1KBBA 3LN3A 4W86A 2XVNA 3E38A 3TZNA 2XSBA 2QLYA 3IUIA 4F4RA 1OD0A 2G4FA 1EJWC 1E5NA 3OVQA 2VCCA 4DBSA 1EP3A 5LHFA 1IEWA 1DJWA 3ZLFA 4ZO6A 1HP4A 1VHCA 5H8PA 1TWIA 3VZYA 1DHKA 4I7VA 1TV2A 4Q8QA 3LM3A 3Q58A 1E1EA 3SCRA 5I3DA 2P8CA 4X0VA 5EBUA 1W9BM 1DHPA 2VUYA 1JCYA 2CHOA 3IS4A 2PLJA 1OX5A 4H83A 3V0TA 3DFPA 3IGXA 1E3ZA 5FESA 3H2CA 4UQAA 3FAWA 4YTQA 4R9OA 2C13A 3LMYA 1IZKA 1U30A 6XIAA 3NUKA 3GTNA 5C9XA 3DOPA 1ZCCA 4G7FA 2QCHA 3GVWA 3TTQA 4PUNA 4FX6M 2ZX9A 1LT8A 3JU2A 5G1YA 5DANA 3H7RA 2HTMA 3FY1A 1D7KA 4CKQA 5FAJA 2VC6A 2VZUA 3STFA 1KM2A 1I1XA 2JFEX 3WQGA 1R2SA 3IAQA 4S3GA 5PTDA 3G8EA 2W3ZA 1IWBA 1QK2A 1S3HA 4HBKA 3C61A 3N17A 1OADA 3UWYA 3OIXA 1EC8A 4S23A 2ZZ4A 3W71A 3DHUA 1AW5A 1LOLA 4EACA 4RNFA 3AIRA 1FHUA 3H2OA 4KMQA 2CNCA 3H2EA 3EX2A 4DXXA 5DY3A 4A3UA 2DZXA 1ZBVA 5A6AA 3R13A 3CBWA 1ZS2A 1E4LA 2BY1A 1LF1A 3OZPA 4NZ4A 1XSJA 1HKWA 1E9IA 3EWXA 3INPA 3RK8A 3CO4A 2D23A 4PTMA 3VDAA 4ICNA 2JIEA 4JFSA 4IJBA 2Z27A 3BLFA 1OM0A 2VGGA 3WH7A 5CZKA 2PS2A 4WKAA 4GYFA 4DUXA 5JIPA 4V1YA 1AZ1A 4QXIA 3IIOA 3WIJA 3G2GA 4I9MA 3U6WA 3XISA 5FJJA 1DXFA 1OFQA 3TMLA 1ITXA 1ME8A 4YN5A 3BLKA 2C71A 1R0MA 4Y9NA 2GVEA 4XAGA 2VI0A 1WXYA 3LCGA 4CU8A 1CXKA 2XH4A 3UWWA 4I6KA 3WLJA 4UOZA 1OG6A 1RZMA 2XIOA 1EP1A 2VGIA 2HPMA 2V2HA 1C93A 3D46A 2PWGA 2JE8A 4JTSA 3PVFA 3LXAA 3WQDA 3EX6A 4XK2A 3C2YA 3CWOX 3PNZA 1I2QA 2OSWA 2PCEA 1UR1A 3N04A 3GWQA 1R9ZA 1W9DM 1H09A 4Z1BA 3HPAA 4TIMA 1UWRA 4GC3A 1ISYA 2E7FA 3RYSA 4IZGA 4Q8WA 3LI0A 4XO7A 2XUCA 1QPKA 1FWRA 3C0LA 2ZRXA 1A0CA 1QVBA 2HVNA 3PZQA 4LUTA 1GZ1A 1UIOA 2PI6A 4M80A 2ACUA 3GVGA 1EPVA 4UTTC 1A5SA 3OZMA 1P6BA 4H9ZA 3RFAA 1R30A 1GQLA 4W89A 2O4MA 4J1OA 1J8VA 2A6NA 3AFBA 2YXOA 2Z1VA 1H1NA 3LENA 3A12A 3IANA 2WJEA 1SGJA 4ASTA 3WMBA 4PCSA 4GXWA 3N3MA 3SQSA 4ZXLA 3O8AA 5TIMA 1L8NA 3NYZA 2Z2UA 1OBAA 2NUYA 3EA3A 1CB2A 1NAL1 1ZGDA 3I10A 1E6RA 1Q2RA 3N4FA 2A3CA 1NY1A 4JTTA 2PGRA 3W7RA 3WK2A 3HJEA 1HGWA 1XBZA 1FA2A 1FH7A 4PBFA 3FDKA 5D9NA 5M5DA 2YZRA 3NQGA 3K13A 4NVTA 1U22A 3KLLA 2REQA 3W7DA 4CD6A 5FJPA 4FX7A 4QNWA 1TIWA 2IPFA 4AYSA 2EG8A 2GDUA 4YVPA 1OQFA 3EWDA 3P74A 1VBGA 3EXRA 3GZ3A 3NL2A 1FHVA 3WD3A 3LTSA 3APYA 1VYSX 4LCRA 1E1CA 3DHFA 3UA3A 1UMLA 3EGJA 4UNIA 3GHUA 3QQ1A 2NWSA 3O0FA 3N11A 2DZVA 4IH3A 1RA0A 2P3ZA 1YHTA 4LVFA 4GFIA 3WLNA 4KRTA 4DBWA 2VX7A 2F6XA 3ITVA 3GB6A 3W82A 4AZCB 3TE9A 2NQLA 4M1RA 4U28A 4QJ5B 1M3UA 3GK0A 3T2PA 4L56A 1J0HA 4QEEA 2OO6A 5HNNA 1VFLA 2J62A 3EMZA 3I3BA 4GVIA 3MO4A 4ADTA 3ZYZA 2FIQA 3CZ8A 5HPCA 4Y90A 4NG3A 2YSWA 3UESA 5U4NA 3PHAA 1KGXA 3GIQA 3UXKA 4C5ZA 5CGMA 1IT0A 2ZYFA 4WK9A 1T6MA 2PDKA 1J12A 1TRIA 1UWIA 1KQZA 3IACA 1TB3A 2C19A 3C4UA 4YWIA 1K7EA 2OR2A 3W88A 4C6FA 4ZQCA 1OB0A 1RP9A 4E38A 3I4EA 3M0KA 3LX9A 2BTMA 5I02A 3KX6A 3EEZA 3PB0A 2FDSA 3IUHA 5HWMA 1MFVA 1XLMA 2HXTA 3SJNA 4A6GA 4MB1A 3UXDA 2CW6A 2RDTA 3QOKA 5A2AA 4PRRA 3GS6A 1ONRA 2TMDA 4MY8A 1JF6A 3VUSA 3QMTA 2ESCA 3WYZA 4ZR8A 4AD4A 4YYFA 1HKIA 1NU5A 2CPUA 2F84A 4KH2A 4RKAA 2ZXAA 1BVNP 1S5WA 1QW8A 4H7ZA 4RUBA 1GTEA 1NF7A 4TVUA 3W2LA 3LZ5A 3S1UA 1D8CA 1M7OA 1E0WA 1UW9A 4AZHA 4AY8A 3WUFA 3OVPA 5HJLA 4H9UA 4ZOBA 1VS1A 1NWUA 1IXPA 1TG7A 1XD1A 3GFYA 1ME7A 2QW5A 2AGKA 3LCFA 2NQHA 4KEMA 1W8GA 4HA0A 3O6CA 1DWJM 4JIEA 4JTHA 4US5A 2VEFA 1MYRA 1G01A 4F0KA 4EXQA 1F6KA 2XM1A 5A8OA 4UZSA 4A3RA 4O19A 3WBAA 2WC7A 4HPNA 3TN5A 1UKOA 4NZCA 1RALA 3S5OA 3V5CA 3FSTA 4ZQNA 3OGRA 3DC8A 2ACQA 3CLMA 4IIFA 1JPHA 5E70A 1PXGA 1PHQA 2C16A 2W79A 4JTEA 1H63A 3L67A 3OBEA 1MEWA 4LB3A 2E28A 2BODX 3PC0A 3UF9A 1BQCA 2A4AA 2D2OA 1US0A 3W7OA 3AZTA 1XIDA 3LGEA 1DIOA 3TQKA 5C54A 3QYSA 1EJXC 3N12A 1O5XA 3HPZA 3G6MA 1O5RA 4K7YA 3M5VA 1NWRA 3FHAA 4JR5A 3WF4A 2RFGA 3AU2A 1HVXA 2HVMA 3O9NA 4HMNA 3CB8A 5LNUA 3B0XA 5A6MA 3BAWA 2FH6A 3WH5A 2XIMA 3RM9A 4D6EA 1TTQA 2WMHA 4DBUA 4H1ZA 3PUEA 3KOXA 4Z0SA 1KTCA 2XISA 3T8QA 3DHDA 4JIHA 4JHMA 5HPOA 1V6VA 3FCPA 4LCQA 4I9JA 1WKEA 2RDXA 3WBWA 2I5GA 3N73A 1P43A 4KW2A 3CGTA 3WQ5A 1M7JA 4XZMX 4HVXA 4F3HA 1ADSA 1P7TB 1XYMA 4GQQA 1VEPA 4RCXA 4M0XA 3QF0A 3PUGA 1LL7A 3H54A 3U9IA 2V5CA 3UG4A 3O2LA 1RUSA 2WOQA 1GNXA 1X8CA 3BOLA 5EB8A 4AFYA 3M9YA 4YCOA 5MKGA 2J7BA 4HT3A 4ERAA 3EPMA 4RXFA 2V5BA 4C7FA 4BQ3A 4AF0B 3VOCA 2CZDA 2E1WA 4Z1YA 4IGMA 5M17A 4EPBC 4YTSA 1PL9A 4PSPA 2OSXA 2QGYA 2D1ZA 1NWSA 4LPCA 1K1DA 1UZDA 3B0VC 1VIWA 2DV0A 2R14A 2AMGA 2NV2A 2VRQA 2VD9A 1WDWA 1A5KC 4KETA 3ECQA 2DIJA 3UWEA 1Y0EA 2Y8KA 3NGJA 4HSHA 5KITA 4AMCA 1KLZA 5BMWA 4RJEA 2PCQA 4FA3A 2BSLA 1R2RA 2W67A 1SFJA 4JTDA 3LLDA 3WUBA 2WKLA 4GE8A 3RPDA 1SO4A 1NOFA 4ADUA 2ZKMX 3FHQA 1VYPX 4TOQA 2VOMA 4GIYA 3IUDA 1XBYA 1YEYA 4GZIA 1J0IA 3BAYA 1IV8A 3SURA 2PRLA 3DYMA 2FDMA 2ZA3A 2V67A 1JZ5A 4M81A 3TYAA 4PCTA 1W3HA 4HMCA 2OKOA 1PE1A 2WSQA 3LBCA 4YMZA 2YB4A 1JZ2A 2W4XA 1GJWA 1GQIA 4C6JA 2IQ0A 1PTAA 4QCEA 4DI8A 2CBVA 1Z32X 3L4ZA 2VP8A 4O8RA 1O95A 4LYPA 5HAOA 2DIEA 3KL0A 4J3VA 1XH1A 3GY1A 4FXFA 2GFTA 5A6SA 2VR4A 3IVSA 4LF1A 3W1QA 3W83A 5CZSA 3DHPA 4IMFA 1H0GA 3U2CA 3AXMA 3TW6A 2XVKA 1W1B1 4ZL1A 4KIEA 2DJLA 4WEVX 3W2JA 3NEVA 3VKCA 2OGJA 3SSZA 2YDAA 4E4PA 2BLEA 4XG1A 3CJPA 1HG3A 1UR4A 2DW7A 3FA4A 1RLDA 3C0SA 4D2JA 1BKSA 1BYAA 5EGRA 3ME3A 3VTRA 4PULA 3DYPA 8RUCA 3QEZA 4BEUA 3WH6A 1UBPC 2ALRA 3F7JA 2CHRA 1Z3NA 2EBNA 4QITA 7REQA 1ZUAX 2IPJA 4JIRA 3PPCA 2CLIA 2GL5A 2POZA 3VOIA 4B9ZA 4LFYA 5E93A 2WWDA 4DEFA 1M04A 2VX5A 4FI4A 3AISA 5LSMA 2J9XA 3HM7A 3VINA 3ZVIA 4MADA 4ZE4A 3EA2A 5HANA 3MZNA 5AHMA 1E1FA 2DSVA 3QC3A 4QEHA 3MMUA 4JTKA 1MUMA 1R7AA 3M5YA 2IKHA 5FF3A 1UP0A 3GHSA 2ZTKA 1K02A 2GJRA 2R1MA 4TXEA 1W54A 2J7GA 1LWJA 3P6LA 3KVKA 1FXPA 4U10A 2VGBA 3PBUA 2DZTA 2QMJA 3GR7A 3QGAC 4DJDA 5G2HA 3DFSA 4BZYA 4J27A 1MEIA 2QKFA 4CD5A 1UR3M 3LI1A 1ITCA 2DUZA 3NOEA 2CCRA 2R91A 4JYFA 3VD3A 5LXEA 3MI2A 4UWMA 2QPUA 2D2GA 7PTDA 4TUFA 1KLYA 5AC6A 3W7CA 3GYEA 4EAYA 4C1NB 3OHIA 2QV5A 1FXQA 1HL8A 1IZJA 2CKRA 3PTDA 2VEKA 4HTBA 1Q6FA 1SW0A 1AJZA 2E67A 1CXHA 3PZMA 3GXNA 3F1QA 2V3FA 4Y9MA 4LV4A 4DO5A 1G67A 3NQVA 3MUAA 3CB3A 5FA5A 4GFSA 1F61A 2CKSA 2WJFA 5LIKX 3F4WA 4Z2HA 1C7SA 1PV8A 3U5UA 2YDQA 4TV5A 4GQBA 4GYJA 5LA1A 1G6CA 2W62A 3NPUA 3QJAA 1UR9A 3AWOA 4UOJA 2DUXA 3VGEA 4Y9OA 4Q4KA 1P5BA 3CT2A 3IV3A 2G3MA 3K8KA 4PRTA 3HQPA 3E0WA 1XCXA 2A3LA 3HN3A 3FYPA 3LPOA 1VH7A 4YTRA 3K1GA 5LZLA 1UG6A 1JVNA 1O5QA 1MXDA 1TUXA 1EH9A 3VIHA 3HG3A 2YBUA 1EEPA 4JHZA 2YIHA 4DWSC 1HO1A 3DIPA 2BASA 1K9FA 2YCIX 3Q2DA 4NQ1A 3SCNA 4Q22A 2FTYA 4JIIX 4DZ5A 2J25A 4Q8TA 1NP0A 3KHJA 5DRIA 5D2TA 5EMJA 5F2LA 2CC0A 4PH6A 1QMLA 2ZUWA 4UCFA 1Q6CA 4CN4A 2QUVA 3O63A 2FZ8A 2C91A 3MANA 5AHFA 3TTSA 4ES4A 2Q02A 4N2YA 3PPFA 1SSDA 3G1HA 2DSKA 2ZA2A 1H3GA 3NXFA 1R85A 4GBUA 4GCXA 3A13A 3N9KA 5DXYA 1XDLA 4C91A 4IT1A 4S3JA 2E6FA 1O6IA 1HXJA 4JTIA 3NDYA 1YW1A 4WD0A 3QOMA 1JD9A 5KTLA 4IXHA 3SCPA 3L9CA 1ECEA 3IGHX 3KTCA 1KRBC 3PG8A 4I3GA 1L6YA 4XZLX 3ARSA 1M7XA 2P3EA 2FVKA 3UZWA 4OECA 3AHYA 5BNKA 4OBRA 2OPJA 2DSUA 3KW3A 3F4CA 4ICCX 1OSEA 4ZTYA 1GCYA 4TR9A 2XFFA 4UTJA 3LMZA 4PMOA 2SFPA 4V15A 4PMJA 1GW1A 3UZJA 3SGUA 4O0ZA 3QPYA 3DXIA 4US5D 1ZTVA 2PP1A 1J2BA 1ZENA 1RQEA 3QHMA 3LHUA 3F2BA 3VNLA 2OOFA 3ZOAA 5BYWA 4L61A 1OT1A 4P5UA 4C7DA 3HO8A 1CGYA 2X41A 3W72A 4Q8PA 4EPDC 4QS6A 4NJJA 9XIMA 2X2YA 1QHPA 5XIMA 3TXZA 6CGTA 4NYYA 4D8LA 3GNPA 4HCLA 2B7OA 1QAPA 5I06A 1WO2A 4E8DA 2QEZA 4KEZA 3THAA 5BRPA 4DUWA 3T0TA 3V0UA 4GIEA 3SCQA 4DNHA 1KKOA 2NLIA 3N13A 4N9BA 5D8WA 4GH3A 5KZ6A 3E02A 2GJLA 1FCBA 4N9DA 3B4UA 4QAWA 3S5ZA 1EGZA 3ZSTA 5FJUA 1Q13A 3NPWA 4PRWA 3HG2A 3T81A 1N8IA 2PLKA 1KTNA 3Q37A 4GUFA 1C8QA 5LIXX 3VD7A 2C7FA 4E6MA 2BGNE 3V3WA 2RUSA 1Y65A 3F4DA 1PWMA 2WZMA 3UPWA 3QH2A 4G7EA 3AMGA 4UFJA 3LXCA 4O10A 1L6SA 2D3LA 2E25A 3BQ5A 3ZR4A 2EG7A 1QUMA 1VCVA 4ZXOA 1OHLA 2CXGA 3CQ0A 4MKNA 2NVAA 3V35A 3GXIA 5I78A 2Q3RA 3VGFA 4HZ7A 1OFBA