7A0JAAA

Crystal structure of the crinkly wd40 ectodomain from the arabidopsis thaliana receptor kinase acr4
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
299
structure length
261
Chain Sequence
LGSMSSIAISYGEGGSVFCGLKSDGSHLVVCYGSNSAILYGTPGHLQFIGLTGGDGFMCGLLMLSHQPYCWGNSAFIQMGVPQPMTKGAEYLEVSAGDYHLCGLRKPIISSSLVDCWGYNMTRNFVFDKQLHSLSAGSEFNCALSSKDKSVFCWGVISLIPKEKKFQKIAAGGYHVCGILDGLESRVLCWGKDLPPKEPLLAVVGGKFYACGIKRYDHSAVCWGFFPAPTGIGFYDLAAGNYFTCGVLTGTSMSPVCWGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Serine/threonine-protein kinase-like protein ACR4
publication title Crystal structures of Arabidopsis and Physcomitrella CR4 reveal the molecular architecture of CRINKLY4 receptor kinases.
rcsb
source organism Arabidopsis thaliana
total genus 53
structure length 261
sequence length 299
chains with identical sequence BBB, CCC, DDD
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2020-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
AAA PF13540 RCC1_2 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...