7A1RA

Crystal structure of the c2b domain of trypanosoma brucei extended synaptotagmin (e-syt)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
121
structure length
121
Chain Sequence
GGGTLFVTVQRCRNLKNKETIGVSDPYVKLQLRKQTRKSPYISSTLNPDFNFEAALEVYDIRSDVLHISILDKNDLVKDRLMGTLRIMLSQVAAAPGDIIRGDMNLDPEGQISLELKLLRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lipid binding protein
molecule keywords Synaptotagmin
publication title Structural studies of the shortest extended synaptotagmin with only two C2 domains from Trypanosoma brucei .
pubmed doi rcsb
source organism Trypanosoma brucei equiperdum
total genus 25
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...