7A23I

Plant mitochondrial respiratory complex i
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
481
structure length
481
Chain Sequence
LAVFPEIFIINATFILLIHGVVFSTSKKYDYPPLASNVGWLGLLSVLITLLLLAAGAPLLTIAHLFWNNLFRRDNFTYFCQIFLLLSTAGTISMCFDFFDQERFDAFEFIVLILLSTCGMLFMISAYDLIAMYLAIELQSLCFYVIAASKRKSEFSTEAGLKYLILGAFSSGILLFGCSMIYGSTGATHFDQLAKILTGYEITGARSSGIFMGILFIAVGFLFKITAVPFHMWAPDIYEGSPTPVTAFLSIAPKISIFANILRVFIYGSYGATLQQIFFFCSIASMILGALAAMAQTKVKRLLAYSSIGHVGYICIGFSCGTIEGIQSLLIGIFIYALMTMDAFAIVLALRQTRVKYIADLGALAKTNPILAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLALVGVVTSVIGCFYYIRLVKRMFFDTPRTWILYEPMDRNKSLLLAMTSFFITLFLLYPSPLFSVTHQMALSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords 51kDa
publication title Specific features and assembly of the plant mitochondrial complex I revealed by cryo-EM.
pubmed doi rcsb
total genus 177
structure length 481
sequence length 481
ec nomenclature ec 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).
pdb deposition date 2020-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00361 Proton_antipo_M Proton-conducting membrane transporter
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...