7ABGA3

Human pre-bact-1 spliceosome
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
70
structure length
62
Chain Sequence
ALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHEREQVVLGLYIVRGDNVAVIGEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing
molecule keywords Nuclear cap-binding protein subunit 1
publication title Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
pubmed doi rcsb
total genus 11
structure length 62
sequence length 70
ec nomenclature
pdb deposition date 2020-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A3 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...