7AGX1F

Apo-state type 3 secretion system export apparatus complex from salmonella enterica typhimurium
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
257
structure length
257
Chain Sequence
MFYALYFEIHHLVASAALGFARVAPIFFFLPFLNSGVLSGAPRNAIIILVALGVWPHALNEAPPFLSVAMIPLVLQEAAVGVMLGCLLSWPFWVMHALGCIIDNQRGATLSSSIDPANGIDTSEMANFLNMFAAVVYLQNGGLVTMVDVLNKSYQLCDPMNECTPSLPPLLTFINQVAQNALVLASPVVLVLLLSEVFLGLLSRFAPQMNAFAISLTVKSGIAVLIMLLYFSPVLPDNVLRLSFQATGLSSWFYERG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Surface presentation of antigens protein SpaP
publication title Substrate-engaged type III secretion system structures reveal gating mechanism for unfolded protein translocation
doi rcsb
total genus 75
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2020-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1F PF01311 Bac_export_1 Bacterial export proteins, family 1
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...