7AHTA

Structure of the n-domain of the k+/h+ antiporter subunit khtt at ph 7.5
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
69
structure length
65
Chain Sequence
GLNIKENDLPGIGKKFEIETRSHEKMTIIIHDDGRREIYRFNDELLSNISLDDSEARQIAAILGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords K(+)/H(+) antiporter subunit KhtT
publication title c-di-AMP, a likely master regulator of bacterial K + homeostasis machinery, activates a K + exporter
doi rcsb
source organism Bacillus subtilis (strain 168)
total genus 14
structure length 65
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-09-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...