7AHWAAA

The crystal structure of gene product pa4063 from pseudomonas aeruginosa
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
160
structure length
133
Chain Sequence
VAQLNVALDGKTLELELDSPAMNLVGFEHAASTDADKAAVAKARAQLEKPLELFALPVTAGCSVASQELRSPLFADIHAHYQLSCEKPELLKLLTLAEFFKRFPATQKIQVQLIGPDGQKGADLAPASAELKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Uncharacterized protein
publication title The crystal structure of gene product PA4063 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa pao1
total genus 29
structure length 133
sequence length 160
ec nomenclature
pdb deposition date 2020-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
AAA PF10986 DUF2796 Protein of unknown function (DUF2796)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...