7AICC

Muts-mutl in clamp state (kinked clamp domain)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
312
structure length
265
Chain Sequence
VERPASVVKELVENSLDAGATRIDIDIERGGAKLIRIRDNGSGIKKDELALALARGEALASISSVSRLTLTSRTAEQQEAWQAYAVTVKPAAHPVGTTLEVLDLFYNTPARRKFLRTEKTEFNHIDEIIRRIALARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAILGTAFLEQALAIEWQHGDLTLRGWVADPNHTTPALAEIQYFYVNGRMMRDRLINHAIRQAYEDKLGADQQPAFVLYLEISRLVHDFIYQGVLSVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA mismatch repair protein MutS
publication title The selection process of licensing a DNA mismatch for repair
doi rcsb
source organism Escherichia coli (strain k12)
total genus 67
structure length 265
sequence length 312
ec nomenclature
pdb deposition date 2020-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01119 DNA_mis_repair DNA mismatch repair protein, C-terminal domain
C PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...