7AOIXP

Trypanosoma brucei mitochondrial ribosome large subunit assembly intermediate
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
371
structure length
371
Chain Sequence
HARYRPLSLRARQTLSEKSDDLQYHVVTQEWFGERVDSFLTCHYPQWDYETIKRLVQQGHIYRYRKNGKKKFTRLTDRLEFDELLVVPTRAFWEKQLAPPSGVLEETDGPKFKLSATAREMAHNMVLFKNEHVIVINKPHGLPMMPTDDPQEMSIAAMLPAWKFTNVAKPVVCHNLDRETSGCVVLARTRNAHRMLGRMFVKRVVPNSVYWSFCVGKPTVNYGRVRMHFDITRGNKGDIIVARPSPTKTSKVAIAEFVVNASALEFGSFISFYPLTTRRHQERIMAAHALRCPVLGDAKYGGDAAFPSSLSLFWDPENKGLPLHLHHRKIQLPYKNTAGEFICVTAPLPTQMEKTFKKLGWPCEVDDPLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords bL28m
publication title Interconnected assembly factors regulate the biogenesis of mitoribosomal large subunit
rcsb
total genus 70
structure length 371
sequence length 371
ec nomenclature
pdb deposition date 2020-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
XP PF00849 PseudoU_synth_2 RNA pseudouridylate synthase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...