7AQOB

Yeast tho-sub2 complex dimer
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
603
structure length
563
Chain Sequence
SNTEELIQNSIGFLQKTFKALPVSFDSIRHEPLPSSMLHASVLNFEWEPLEKNISAIHDRDSLIDIILKRFIIDSMTLEKGLLNSCIGLDFVYNSRFNRSNPASWGNTFFELFSTIIDLLNSPSTFLKFWPYAESRIEWFKMNTSVEPVSLGESNLISYKQPLYEKLRHWNDILAKLENNDILNTVKHYNMKYKLENFLSELLPINEESNFNRSASISALQESDNEWNRSSSDVIFAADYNFVFYHLIICPIEFAFSDLEYKNDVDRSLSPLLDAILEIEENFYSKIKMNNRTRYSLEEALNTEYYANYDVMTPKLPVYMKHSNAMKMDRNEFWANLQNIKESDDYTLRPTIMDISLSNTTCLYKQLTQEDDDYYRKQFILQLCFTTNLIRNLISSDETRNFYKSCYLRENPLSDIDFENLDEVNKKRGLNLCSYICDNRVLKFYKIKDPDFYRVIRKLMSSDEKFTTAKIDGFKEFQNFRISKEKIPPPAFDETFKKFTFIKMGNKLINNVWKIPTGLDKIEQEVKKPEGVYEIIRQWQTLRFLRSRYLFDFDKVNEKTGVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords THO complex subunit 2
publication title Structural insights into the nucleic acid remodeling mechanisms of the yeast THO-Sub2 complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
total genus 134
structure length 563
sequence length 603
chains with identical sequence H
ec nomenclature
pdb deposition date 2020-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11957 efThoc1 THO complex subunit 1 transcription elongation factor
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...