7AS9T

Bacillus subtilis ribosome-associated quality control complex state a. ribosomal 50s subunit with peptidyl trna in the a/p position and rqch.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
115
structure length
115
Chain Sequence
MQKLIEDITKEQLRTDLPAFRPGDTLRVHVKVVEGNRERIQIFEGVVIKRRGGGISETFTVRKISYGVGVERTFPVHTPKIAKIEVVRYGKVRRAKLYYLRELRGKAARIKEIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Rqc2 homolog RqcH
publication title Structural Basis for Bacterial Ribosome-Associated Quality Control by RqcH and RqcP.
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
total genus 12
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2020-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01245 Ribosomal_L19 Ribosomal protein L19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...