7ATJA

Recombinant horseradish peroxidase c1a complex with cyanide and ferulic acid
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
305
structure length
305
Chain Sequence
QLTPTFYDNSCPNVSNIVRDTIVNELRSDPRIAASILRLHFHDCFVNGCDASILLDNTTSFRTEKDAFGNANSARGFPVIDRMKAAVESACPRTVSCADLLTIAAQQSVTLAGGPSWRVPLGRRDSLQAFLDLANANLPAPFFTLPQLKDSFRNVGLNRSSDLVALSGGHTFGKNQCRFIMDRLYNFSNTGLPDPTLNTTYLQTLRGLCPLNGNLSALVDFDLRTPTIFDNKYYVNLEEQKGLIQSDQELFSSPNATDTIPLVRSFANSTQTFFNAFVEAMDRMGNITPLTGTQGQIRLNCRVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of the horseradish peroxidase C-ferulic acid complex and the ternary complex with cyanide suggest how peroxidases oxidize small phenolic substrates.
pubmed doi rcsb
molecule keywords PEROXIDASE C1A
molecule tags Oxidoreductase
source organism Armoracia rusticana
total genus 117
structure length 305
sequence length 305
ec nomenclature ec 1.11.1.7: Peroxidase.
pdb deposition date 1999-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00141 peroxidase Peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.420.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 2 Peroxidase, domain 2 7atjA02
1.10.520.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 1 Peroxidase; domain 1 7atjA01
5SW6A 5SYUA 4NVJB 3VLLA 2XIHA 1H3JA 4BLYA 1GZAA 3RRWA 4JM9A 1CCLA 1H5FA 4NVFA 3M27A 1DSEA 5AOGA 3E2OA 1YYGA 2XILA 2VCFX 3M23A 5FNBA 3FMUA 5SYWA 1ML2A 4BLLA 4C50A 3ZCHA 5CICA 1S73A 2RC2X 1CMUA 4JQJA 1MKQA 2RBZX 5KQ6A 3Q3UA 2VKAA 1QO4A 1U2JA 3RIVA 5SX3A 3VLHA 2B12A 2RC0X 5SX2A 1CCKA 2GHEX 1JDRA 5KQ0A 5JQRA 1AEQA 1LY8A 4JM6A 4P4QA 2EUNA 3FM4A 3ZCYA 1CCPA 1KRJA 1AC4A 4JN0A 2CCPA 3VLMA 4JMSA 1FHFA 3WXOA 4NVCA 4NVOB 4JM5A 1SJ2A 1AEKA 3M8MA 5KQ3A 1AENA 2AQDA 1U74A 1OAFA 1ARPA 4JQNA 1AEVA 1AEMA 1DCCA 2VO2X 4BLNA 1H5LA 2BCNA 5CIEA 1CCBA 4NVLA 5SXSA 2EUQA 2ANZA 1H5IA 2GHDX 5SX1A 5AMMA 1RYCA 2V2EA 4NVEA 4NVIB 1BEPA 3M26A 1SBMA 4CVIA 2IA8A 2B0ZA 5SX0B 1Z53A 1YZRA 1LLPA 4A7MA 1H5DA 1ZBZA 1CMQA 1IYNA 1GZBA 1QGJA 3M28A 1KXMA 6ATJA 1CPEA 1GX2A 1CCGA 1BGPA 2E39A 3M2FA 4XV8A 5KQ2A 4BLKA 1SCHA 2AS1A 5ALAA 1PA2A 4XV5A 1H5GA 1MKRA 4USCA 1EBEA 2RBXX 3M2DA 5L02A 2RBVX 4JQMA 4A78A 1ARVA 1KZMA 2EUUA 2GB8A 1U2LA 7CCPA 1HSRA 4CCPA 1MN2A 4OQ7A 4NVAA 4FEFA 4JMZA 3CCPA 3M2AA 1AEJA 2XJ8A 1A2FA 1CPGA 2YCGA 5AL9A 1H5AA 3UW8A 2CEPA 1AC8A 2XJ5A 5SXXA 1DJ5A 5KQKA 5SXQA 2XJ6A 1DSOA 3M2EA 1W4YA 3VLIA 5JHZA 4BM4A 1B80A 1H5MA 5SX7A 2RBYX 3M2GA 1CPDA 3X16A 1ARXA 1GW2A 3M5QA 4CCXA 4BM0A 1ARUA 5FNEA 1H5CA 2AS6A 4CZNA 4BM1A 2GHHX 1GWTA 4XVAA 3M2CA 2EUTA 4CZOA 4BLXA 2ICVA 2E3BA 5JPRA 3UT2A 4NVBA 5SYVA 2GHCX 1YYDA 1H5JA 2GHKX 4JMAA 4NFGA 1LYKA 1UB2A 3VLKA 1DSGA 4BLZA 4BM3A 2X07A 5CIFA 1OAGA 1C8IA 2JTIA 2W23A 5CCPA 2AS4A 1BEMA 4JPLA 5SYYA 3E2NA 4C51A 2RBTX 1DSPA 1ATJA 4JQKA 1V0HX 5CIBA 1AEHA 4XV6A 4ATJA 5KQIA 4XV4A 3FKGA 5CJHA 3R98A 4FDQA 5ABOA 5SX0A 1BEKA 1BEQA 1CCIA 2Y6AA 2B10A 2VCSA 1LY9A 1AETA 1ARYA 1B82A 1AEDA 1QPAA 2GGNX 1U75A 5KSKA 1YZPA 7ATJA 4NVNB 4JB4A 5CIGA 4NVDA 5JHXA 5CIHA 5SYJA 1H5EA 5SYKA 3WNUA 2YLJA 3EXBA 5SYXA 3FM6A 1DS4A 5EJTA 1CYFA 4A5GA 4A6ZA 5SYLA 1DJ1A 1GWUA 1KXNA 1H5HA 1CCEA 4G05A 2Y6BA 3HDLA 5KQHA 4JMBA 2BOQA 5ABNA 4JM8A 3M2HA 3M29A 3M2IA 5SXWA 1APXA 2PCCA 2CCDA 4FCNA 5SYIA 6CCPA 2RBWX 1ARWA 5SW4A 2RBUX 1W4WA 4PAEA 1ITKA 1SOGA 1AEEA 1H5KA 2Y5AA 5SYHA 1STQA 4CZQA 3M25A 5ABQA 1AEGA 1CCJA 2AS3A 3FJWA 2VCNA 5JHYA 2CYPA 4CZRA 2XIFA 2ATJA 1S6VA 2WD4A 1ZBYA 2EUPA 2CCAA 1AA4A 1LGAA 4NVMB 5SXTA 1MK8A 3M2BA 2CL4X 4JPTA 4JPUA 1BEJA 4CVJA 2X08A 4JMWA 2VNXX 1HCHA 4A71A 2VNZX 4XV7A 5L86A 4CUOA 2E3AA 2XI6A 2EUSA 5SXRA 3CCXA 2EURA 3ZCGA 4FCSA 1AEUA 2PCBA 1LYCA 2V23A 5SW5A 2RC1X 1AEBA 3R99A 1A2GA 1SDQA 1BESA 2N18A 5CIDA 4NVHB 1CCAA 1CMTA 5D6MA 2AS2A 1CCCA 1AEOA 3FM1A 5KSFA 1AESA 4JMVA 1CPFA 1MNPA 1BJ9A 1KOKA 1BVAA 1H55A 5EJXA 1JCIA 1CMPA 5SX6A 1GWOA 3VLJA 1B85A 1H58A 4NVGB 1H57A 1AEFA 1U2KA 3ATJA 4GEDA 4JMTA 2B11A 2EUOA 4NVKB 4CZPA 4BM2A 1CK6A 3RIWA 5L05A 1MN1A
chains in the Genus database with same CATH superfamily
5SW6A 5SYUA 4NVJB 3VLLA 2XIHA 1H3JA 4BLYA 5CD4J 1GZAA 3RRWA 4JM9A 1CCLA 1H5FA 4NVFA 3WA8A 3M27A 1DSEA 5AOGA 3E2OA 1YYGA 2XILA 2VCFX 3M23A 5FNBA 3FMUA 5SYWA 1ML2A 4BLLA 4C50A 3ZCHA 5CICA 1S73A 2RC2X 1CMUA 4JQJA 1MKQA 2JMXA 2RBZX 5KQ6A 3Q3UA 2VKAA 1QO4A 1U2JA 3RIVA 5SX3A 3VLHA 2B12A 2RC0X 5SX2A 1CCKA 2GHEX 1JDRA 5KQ0A 5JQRA 1AEQA 1LY8A 4JM6A 4P4QA 2EUNA 3FM4A 3ZCYA 1CCPA 1KRJA 1AC4A 4JN0A 2CCPA 3VLMA 4JMSA 1FHFA 3WXOA 5H9FB 4H7AA 4NVCA 4NVOB 4JZAA 4QYZB 4JM5A 1SJ2A 1AEKA 3M8MA 5KQ3A 1AENA 2AQDA 1U74A 4H79A 1OAFA 1ARPA 4JQNA 1AEVA 1AEMA 1DCCA 2VO2X 2ZCAA 4BLNA 1H5LA 2BCNA 5CIEA 1CCBA 4NVLA 5SXSA 2EUQA 2ANZA 1H5IA 2GHDX 5SX1A 5AMMA 1RYCA 2V2EA 4NVEA 4NVIB 1BEPA 3M26A 1SBMA 4CVIA 2IA8A 2B0ZA 5SX0B 1Z53A 1YZRA 1LLPA 2BO5A 4A7MA 1H5DA 1ZBZA 1CMQA 1IYNA 1GZBA 1QGJA 3M28A 1KXMA 6ATJA 1CPEA 1GX2A 1CCGA 1BGPA 2E39A 3M2FA 4XV8A 5KQ2A 4BLKA 1SCHA 2AS1A 5ALAA 4GKFA 1PA2A 4XV5A 1H5GA 1MKRA 4USCA 2A7UB 1EBEA 2RBXX 3M2DA 5L02A 2RBVX 4JQMA 4A78A 1ARVA 1KZMA 2EUUA 2GB8A 1U2LA 7CCPA 1HSRA 4CCPA 1MN2A 4OQ7A 4NVAA 4FEFA 4JMZA 3CCPA 3M2AA 1AEJA 2XJ8A 1A2FA 1CPGA 2YCGA 5AL9A 1H5AA 3UW8A 2CEPA 1AC8A 2XJ5A 5SXXA 1DJ5A 5KQKA 5SXQA 2XJ6A 1DSOA 3M2EA 1W4YA 3VLIA 5JHZA 4BM4A 1B80A 1H5MA 5SX7A 2RBYX 3M2GA 1CPDA 3X16A 1ARXA 1GW2A 3M5QA 4CCXA 4BM0A 1ARUA 5FNEA 1H5CA 2AS6A 4CZNA 4BM1A 2GHHX 1GWTA 4XVAA 3M2CA 2EUTA 4CZOA 4BLXA 2ICVA 2E3BA 5JPRA 3UT2A 2WSSS 4NVBA 5SYVA 2GHCX 1YYDA 1H5JA 2GHKX 4JMAA 4NFGA 1LYKA 1UB2A 3VLKA 1DSGA 4BLZA 4BM3A 2X07A 5CIFA 1OAGA 1C8IA 2JTIA 2W23A 5CCPA 2AS4A 1BEMA 4JPLA 5SYYA 3E2NA 4U7UB 3X1LF 4C51A 2RBTX 1DSPA 1ATJA 4JQKA 1V0HX 5CIBA 1AEHA 4XV6A 4ATJA 5KQIA 4XV4A 3FKGA 5CJHA 3R98A 4FDQA 5ABOA 5SX0A 1BEKA 1BEQA 1CCIA 2Y6AA 2B10A 2VCSA 1LY9A 1AETA 1ARYA 1B82A 1AEDA 1QPAA 2GGNX 1U75A 5KSKA 1YZPA 7ATJA 4NVNB 4JB4A 5CIGA 4NVDA 5JHXA 5CIHA 5SYJA 1H5EA 5SYKA 3WNUA 2YLJA 3EXBA 5SYXA 3FM6A 1DS4A 5EJTA 1CYFA 4A5GA 4A6ZA 5SYLA 1DJ1A 1GWUA 1KXNA 1H5HA 1CCEA 4G05A 2Y6BA 3HDLA 5KQHA 4JMBA 2BOQA 5ABNA 4JM8A 3M2HA 3M29A 3M2IA 5SXWA 1APXA 2PCCA 2CCDA 4FCNA 5SYIA 6CCPA 2RBWX 1ARWA 5SW4A 2RBUX 1W4WA 4PAEA 1ITKA 1SOGA 1AEEA 1H5KA 2Y5AA 5SYHA 1STQA 4CZQA 3M25A 5ABQA 1AEGA 1CCJA 2AS3A 3FJWA 2VCNA 5JHYA 2CYPA 4CZRA 2XIFA 2ATJA 1S6VA 2WD4A 1ZBYA 2EUPA 2CCAA 1AA4A 1LGAA 4NVMB 5SXTA 1MK8A 1ABVA 3M2BA 2CL4X 4JPTA 2OEBA 4JPUA 1BEJA 4CVJA 2X08A 4JMWA 2VNXX 1HCHA 4A71A 5H9EB 2VNZX 4XV7A 5L86A 4CUOA 2E3AA 2XI6A 2EUSA 5SXRA 3CCXA 2EURA 3ZCGA 4FCSA 1AEUA 2PCBA 1LYCA 2V23A 5SW5A 2RC1X 1AEBA 3R99A 1A2GA 1SDQA 1BESA 2N18A 5CIDA 4NVHB 1CCAA 1CMTA 5D6MA 2AS2A 1CCCA 1AEOA 3FM1A 5KSFA 1AESA 4JMVA 1CPFA 1MNPA 1BJ9A 2ZOPA 1KOKA 1BVAA 1H55A 5EJXA 1JCIA 1CMPA 5SX6A 1GWOA 3VLJA 1B85A 1H58A 4NVGB 1H57A 1AEFA 1U2KA 3ATJA 4GEDA 4JMTA 2B11A 2EUOA 4NVKB 4CZPA 4BM2A 1CK6A 3RIWA 5L05A 1MN1A
chains in the Genus database with same CATH topology
5SW6A 5SYUA 4NVJB 3VLLA 2XIHA 1H3JA 4BLYA 5CD4J 1GZAA 3RRWA 4JM9A 1CCLA 1H5FA 4NVFA 3WA8A 3M27A 1DSEA 5AOGA 3E2OA 1YYGA 2XILA 2VCFX 3M23A 5FNBA 3FMUA 5SYWA 1ML2A 4BLLA 4C50A 3ZCHA 5CICA 1S73A 2RC2X 1CMUA 4JQJA 1MKQA 2RBZX 5KQ6A 3Q3UA 2VKAA 1QO4A 1U2JA 3RIVA 5SX3A 3VLHA 2B12A 2RC0X 5SX2A 1CCKA 2GHEX 1JDRA 5KQ0A 5JQRA 1AEQA 1LY8A 4JM6A 4P4QA 2EUNA 3FM4A 3ZCYA 1CCPA 1KRJA 1AC4A 4JN0A 2CCPA 3VLMA 4JMSA 1FHFA 3WXOA 5H9FB 4H7AA 4NVCA 4NVOB 4JZAA 4QYZB 4JM5A 1SJ2A 1AEKA 3M8MA 5KQ3A 1AENA 2AQDA 1U74A 4H79A 1OAFA 1ARPA 4JQNA 1AEVA 1AEMA 1DCCA 2VO2X 2ZCAA 4BLNA 1H5LA 2BCNA 5CIEA 1CCBA 4NVLA 5SXSA 2EUQA 2ANZA 1H5IA 2GHDX 5SX1A 5AMMA 1RYCA 2V2EA 4NVEA 4NVIB 1BEPA 3M26A 1SBMA 4CVIA 2IA8A 2B0ZA 5SX0B 1Z53A 1YZRA 1LLPA 4A7MA 1H5DA 1ZBZA 1CMQA 1IYNA 1GZBA 1QGJA 3M28A 1KXMA 6ATJA 1CPEA 1GX2A 1CCGA 1BGPA 2E39A 3M2FA 4XV8A 5KQ2A 4BLKA 1SCHA 2AS1A 5ALAA 1PA2A 4XV5A 1H5GA 1MKRA 4USCA 1EBEA 2RBXX 3M2DA 5L02A 2RBVX 4JQMA 4A78A 1ARVA 1KZMA 2EUUA 2GB8A 1U2LA 7CCPA 1HSRA 4CCPA 1MN2A 4OQ7A 4NVAA 4FEFA 4JMZA 3CCPA 3M2AA 1AEJA 2XJ8A 1A2FA 1CPGA 2YCGA 5AL9A 1H5AA 3UW8A 2CEPA 1AC8A 2XJ5A 5SXXA 1DJ5A 5KQKA 5SXQA 2XJ6A 1DSOA 3M2EA 1W4YA 3VLIA 5JHZA 4BM4A 1B80A 1H5MA 5SX7A 2RBYX 3M2GA 1CPDA 3X16A 1ARXA 1GW2A 3M5QA 4CCXA 4BM0A 1ARUA 5FNEA 1H5CA 2AS6A 4CZNA 4BM1A 2GHHX 1GWTA 4XVAA 3M2CA 2EUTA 4CZOA 4BLXA 2ICVA 2E3BA 5JPRA 3UT2A 4NVBA 5SYVA 2GHCX 1YYDA 1H5JA 2GHKX 4JMAA 4NFGA 1LYKA 1UB2A 3VLKA 1DSGA 4BLZA 4BM3A 2X07A 5CIFA 1OAGA 1C8IA 2JTIA 2W23A 5CCPA 2AS4A 1BEMA 4JPLA 5SYYA 3E2NA 4U7UB 4C51A 2RBTX 1DSPA 1ATJA 4JQKA 1V0HX 5CIBA 1AEHA 4XV6A 4ATJA 5KQIA 4XV4A 3FKGA 5CJHA 3R98A 4FDQA 5ABOA 5SX0A 1BEKA 1BEQA 1CCIA 2Y6AA 2B10A 2VCSA 1LY9A 1AETA 1ARYA 1B82A 1AEDA 1QPAA 2GGNX 1U75A 5KSKA 1YZPA 7ATJA 4NVNB 4JB4A 5CIGA 4NVDA 5JHXA 5CIHA 5SYJA 1H5EA 5SYKA 3WNUA 2YLJA 3EXBA 5SYXA 3FM6A 1DS4A 5EJTA 1CYFA 4A5GA 4A6ZA 5SYLA 1DJ1A 1GWUA 1KXNA 1H5HA 1CCEA 4G05A 2Y6BA 3HDLA 5KQHA 4JMBA 2BOQA 5ABNA 4JM8A 3M2HA 3M29A 3M2IA 5SXWA 1APXA 2PCCA 2CCDA 4FCNA 5SYIA 6CCPA 2RBWX 1ARWA 5SW4A 2RBUX 1W4WA 4PAEA 1ITKA 1SOGA 1AEEA 1H5KA 2Y5AA 5SYHA 1STQA 4CZQA 3M25A 5ABQA 1AEGA 1CCJA 2AS3A 3FJWA 2VCNA 5JHYA 2CYPA 4CZRA 2XIFA 2ATJA 1S6VA 2WD4A 1ZBYA 2EUPA 2CCAA 1AA4A 1LGAA 4NVMB 5SXTA 1MK8A 3M2BA 2CL4X 4JPTA 4JPUA 1BEJA 4CVJA 2X08A 4JMWA 2VNXX 1HCHA 4A71A 5H9EB 2VNZX 4XV7A 5L86A 4CUOA 2E3AA 2XI6A 2EUSA 5SXRA 3CCXA 2EURA 3ZCGA 4FCSA 1AEUA 2PCBA 1LYCA 2V23A 5SW5A 2RC1X 1AEBA 3R99A 1A2GA 1SDQA 1BESA 2N18A 5CIDA 4NVHB 1CCAA 1CMTA 5D6MA 2AS2A 1CCCA 1AEOA 3FM1A 5KSFA 1AESA 4JMVA 1CPFA 1MNPA 1BJ9A 1KOKA 1BVAA 1H55A 5EJXA 1JCIA 1CMPA 5SX6A 1GWOA 3VLJA 1B85A 1H58A 4NVGB 1H57A 1AEFA 1U2KA 3ATJA 4GEDA 4JMTA 2B11A 2EUOA 4NVKB 4CZPA 4BM2A 1CK6A 3RIWA 5L05A 1MN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5SW6 A;  5SYU A;  4NVJ B;  3VLL A;  2XIH A;  1H3J A;  4BLY A;  1GZA A;  3RRW A;  4JM9 A;  1CCL A;  1H5F A;  4NVF A;  3M27 A;  1DSE A;  5AOG A;  3E2O A;  1YYG A;  2XIL A;  2VCF X;  3M23 A;  5FNB A;  3FMU A;  5SYW A;  1ML2 A;  4BLL A;  4C50 A;  3ZCH A;  5CIC A;  1S73 A;  2RC2 X;  1CMU A;  4JQJ A;  1MKQ A;  2RBZ X;  5KQ6 A;  3Q3U A;  2VKA A;  1QO4 A;  1U2J A;  3RIV A;  5SX3 A;  3VLH A;  2B12 A;  2RC0 X;  5SX2 A;  1CCK A;  2GHE X;  1JDR A;  5KQ0 A;  5JQR A;  1AEQ A;  1LY8 A;  4JM6 A;  4P4Q A;  2EUN A;  3FM4 A;  3ZCY A;  1CCP A;  1KRJ A;  1AC4 A;  4JN0 A;  2CCP A;  3VLM A;  4JMS A;  1FHF A;  3WXO A;  4NVC A;  4NVO B;  4JM5 A;  1SJ2 A;  1AEK A;  3M8M A;  5KQ3 A;  1AEN A;  2AQD A;  1U74 A;  1OAF A;  1ARP A;  4JQN A;  1AEV A;  1AEM A;  1DCC A;  2VO2 X;  4BLN A;  1H5L A;  2BCN A;  5CIE A;  1CCB A;  4NVL A;  5SXS A;  2EUQ A;  2ANZ A;  1H5I A;  2GHD X;  5SX1 A;  5AMM A;  1RYC A;  2V2E A;  4NVE A;  4NVI B;  1BEP A;  3M26 A;  1SBM A;  4CVI A;  2IA8 A;  2B0Z A;  5SX0 B;  1Z53 A;  1YZR A;  1LLP A;  4A7M A;  1H5D A;  1ZBZ A;  1CMQ A;  1IYN A;  1GZB A;  1QGJ A;  3M28 A;  1KXM A;  6ATJ A;  1CPE A;  1GX2 A;  1CCG A;  1BGP A;  2E39 A;  3M2F A;  4XV8 A;  5KQ2 A;  4BLK A;  1SCH A;  2AS1 A;  5ALA A;  1PA2 A;  4XV5 A;  1H5G A;  1MKR A;  4USC A;  1EBE A;  2RBX X;  3M2D A;  5L02 A;  2RBV X;  4JQM A;  4A78 A;  1ARV A;  1KZM A;  2EUU A;  2GB8 A;  1U2L A;  7CCP A;  1HSR A;  4CCP A;  1MN2 A;  4OQ7 A;  4NVA A;  4FEF A;  4JMZ A;  3CCP A;  3M2A A;  1AEJ A;  2XJ8 A;  1A2F A;  1CPG A;  2YCG A;  5AL9 A;  1H5A A;  3UW8 A;  2CEP A;  1AC8 A;  2XJ5 A;  5SXX A;  1DJ5 A;  5KQK A;  5SXQ A;  2XJ6 A;  1DSO A;  3M2E A;  1W4Y A;  3VLI A;  5JHZ A;  4BM4 A;  1B80 A;  1H5M A;  5SX7 A;  2RBY X;  3M2G A;  1CPD A;  3X16 A;  1ARX A;  1GW2 A;  3M5Q A;  4CCX A;  4BM0 A;  1ARU A;  5FNE A;  1H5C A;  2AS6 A;  4CZN A;  4BM1 A;  2GHH X;  1GWT A;  4XVA A;  3M2C A;  2EUT A;  4CZO A;  4BLX A;  2ICV A;  2E3B A;  5JPR A;  3UT2 A;  4NVB A;  5SYV A;  2GHC X;  1YYD A;  1H5J A;  2GHK X;  4JMA A;  4NFG A;  1LYK A;  1UB2 A;  3VLK A;  1DSG A;  4BLZ A;  4BM3 A;  2X07 A;  5CIF A;  1OAG A;  1C8I A;  2JTI A;  2W23 A;  5CCP A;  2AS4 A;  1BEM A;  4JPL A;  5SYY A;  3E2N A;  4C51 A;  2RBT X;  1DSP A;  1ATJ A;  4JQK A;  1V0H X;  5CIB A;  1AEH A;  4XV6 A;  4ATJ A;  5KQI A;  4XV4 A;  3FKG A;  5CJH A;  3R98 A;  4FDQ A;  5ABO A;  5SX0 A;  1BEK A;  1BEQ A;  1CCI A;  2Y6A A;  2B10 A;  2VCS A;  1LY9 A;  1AET A;  1ARY A;  1B82 A;  1AED A;  1QPA A;  2GGN X;  1U75 A;  5KSK A;  1YZP A;  7ATJ A;  4NVN B;  4JB4 A;  5CIG A;  4NVD A;  5JHX A;  5CIH A;  5SYJ A;  1H5E A;  5SYK A;  3WNU A;  2YLJ A;  3EXB A;  5SYX A;  3FM6 A;  1DS4 A;  5EJT A;  1CYF A;  4A5G A;  4A6Z A;  5SYL A;  1DJ1 A;  1GWU A;  1KXN A;  1H5H A;  1CCE A;  4G05 A;  2Y6B A;  3HDL A;  5KQH A;  4JMB A;  2BOQ A;  5ABN A;  4JM8 A;  3M2H A;  3M29 A;  3M2I A;  5SXW A;  1APX A;  2PCC A;  2CCD A;  4FCN A;  5SYI A;  6CCP A;  2RBW X;  1ARW A;  5SW4 A;  2RBU X;  1W4W A;  4PAE A;  1ITK A;  1SOG A;  1AEE A;  1H5K A;  2Y5A A;  5SYH A;  1STQ A;  4CZQ A;  3M25 A;  5ABQ A;  1AEG A;  1CCJ A;  2AS3 A;  3FJW A;  2VCN A;  5JHY A;  2CYP A;  4CZR A;  2XIF A;  2ATJ A;  1S6V A;  2WD4 A;  1ZBY A;  2EUP A;  2CCA A;  1AA4 A;  1LGA A;  4NVM B;  5SXT A;  1MK8 A;  3M2B A;  2CL4 X;  4JPT A;  4JPU A;  1BEJ A;  4CVJ A;  2X08 A;  4JMW A;  2VNX X;  1HCH A;  4A71 A;  2VNZ X;  4XV7 A;  5L86 A;  4CUO A;  2E3A A;  2XI6 A;  2EUS A;  5SXR A;  3CCX A;  2EUR A;  3ZCG A;  4FCS A;  1AEU A;  2PCB A;  1LYC A;  2V23 A;  5SW5 A;  2RC1 X;  1AEB A;  3R99 A;  1A2G A;  1SDQ A;  1BES A;  2N18 A;  5CID A;  4NVH B;  1CCA A;  1CMT A;  5D6M A;  2AS2 A;  1CCC A;  1AEO A;  3FM1 A;  5KSF A;  1AES A;  4JMV A;  1CPF A;  1MNP A;  1BJ9 A;  1KOK A;  1BVA A;  1H55 A;  5EJX A;  1JCI A;  1CMP A;  5SX6 A;  1GWO A;  3VLJ A;  1B85 A;  1H58 A;  4NVG B;  1H57 A;  1AEF A;  1U2K A;  3ATJ A;  4GED A;  4JMT A;  2B11 A;  2EUO A;  4NVK B;  4CZP A;  4BM2 A;  1CK6 A;  3RIW A;  5L05 A;  1MN1 A; 
#chains in the Genus database with same CATH topology
 5SW6 A;  5SYU A;  4NVJ B;  3VLL A;  2XIH A;  1H3J A;  4BLY A;  5CD4 J;  1GZA A;  3RRW A;  4JM9 A;  1CCL A;  1H5F A;  4NVF A;  3WA8 A;  3M27 A;  1DSE A;  5AOG A;  3E2O A;  1YYG A;  2XIL A;  2VCF X;  3M23 A;  5FNB A;  3FMU A;  5SYW A;  1ML2 A;  4BLL A;  4C50 A;  3ZCH A;  5CIC A;  1S73 A;  2RC2 X;  1CMU A;  4JQJ A;  1MKQ A;  2JMX A;  2RBZ X;  5KQ6 A;  3Q3U A;  2VKA A;  1QO4 A;  1U2J A;  3RIV A;  5SX3 A;  3VLH A;  2B12 A;  2RC0 X;  5SX2 A;  1CCK A;  2GHE X;  1JDR A;  5KQ0 A;  5JQR A;  1AEQ A;  1LY8 A;  4JM6 A;  4P4Q A;  2EUN A;  3FM4 A;  3ZCY A;  1CCP A;  1KRJ A;  1AC4 A;  4JN0 A;  2CCP A;  3VLM A;  4JMS A;  1FHF A;  3WXO A;  5H9F B;  4H7A A;  4NVC A;  4NVO B;  4JZA A;  4QYZ B;  4JM5 A;  1SJ2 A;  1AEK A;  3M8M A;  5KQ3 A;  1AEN A;  2AQD A;  1U74 A;  4H79 A;  1OAF A;  1ARP A;  4JQN A;  1AEV A;  1AEM A;  1DCC A;  2VO2 X;  2ZCA A;  4BLN A;  1H5L A;  2BCN A;  5CIE A;  1CCB A;  4NVL A;  5SXS A;  2EUQ A;  2ANZ A;  1H5I A;  2GHD X;  5SX1 A;  5AMM A;  1RYC A;  2V2E A;  4NVE A;  4NVI B;  1BEP A;  3M26 A;  1SBM A;  4CVI A;  2IA8 A;  2B0Z A;  5SX0 B;  1Z53 A;  1YZR A;  1LLP A;  2BO5 A;  4A7M A;  1H5D A;  1ZBZ A;  1CMQ A;  1IYN A;  1GZB A;  1QGJ A;  3M28 A;  1KXM A;  6ATJ A;  1CPE A;  1GX2 A;  1CCG A;  1BGP A;  2E39 A;  3M2F A;  4XV8 A;  5KQ2 A;  4BLK A;  1SCH A;  2AS1 A;  5ALA A;  4GKF A;  1PA2 A;  4XV5 A;  1H5G A;  1MKR A;  4USC A;  2A7U B;  1EBE A;  2RBX X;  3M2D A;  5L02 A;  2RBV X;  4JQM A;  4A78 A;  1ARV A;  1KZM A;  2EUU A;  2GB8 A;  1U2L A;  7CCP A;  1HSR A;  4CCP A;  1MN2 A;  4OQ7 A;  4NVA A;  4FEF A;  4JMZ A;  3CCP A;  3M2A A;  1AEJ A;  2XJ8 A;  1A2F A;  1CPG A;  2YCG A;  5AL9 A;  1H5A A;  3UW8 A;  2CEP A;  1AC8 A;  2XJ5 A;  5SXX A;  1DJ5 A;  5KQK A;  5SXQ A;  2XJ6 A;  1DSO A;  3M2E A;  1W4Y A;  3VLI A;  5JHZ A;  4BM4 A;  1B80 A;  1H5M A;  5SX7 A;  2RBY X;  3M2G A;  1CPD A;  3X16 A;  1ARX A;  1GW2 A;  3M5Q A;  4CCX A;  4BM0 A;  1ARU A;  5FNE A;  1H5C A;  2AS6 A;  4CZN A;  4BM1 A;  2GHH X;  1GWT A;  4XVA A;  3M2C A;  2EUT A;  4CZO A;  4BLX A;  2ICV A;  2E3B A;  5JPR A;  3UT2 A;  2WSS S;  4NVB A;  5SYV A;  2GHC X;  1YYD A;  1H5J A;  2GHK X;  4JMA A;  4NFG A;  1LYK A;  1UB2 A;  3VLK A;  1DSG A;  4BLZ A;  4BM3 A;  2X07 A;  5CIF A;  1OAG A;  1C8I A;  2JTI A;  2W23 A;  5CCP A;  2AS4 A;  1BEM A;  4JPL A;  5SYY A;  3E2N A;  4U7U B;  3X1L F;  4C51 A;  2RBT X;  1DSP A;  1ATJ A;  4JQK A;  1V0H X;  5CIB A;  1AEH A;  4XV6 A;  4ATJ A;  5KQI A;  4XV4 A;  3FKG A;  5CJH A;  3R98 A;  4FDQ A;  5ABO A;  5SX0 A;  1BEK A;  1BEQ A;  1CCI A;  2Y6A A;  2B10 A;  2VCS A;  1LY9 A;  1AET A;  1ARY A;  1B82 A;  1AED A;  1QPA A;  2GGN X;  1U75 A;  5KSK A;  1YZP A;  7ATJ A;  4NVN B;  4JB4 A;  5CIG A;  4NVD A;  5JHX A;  5CIH A;  5SYJ A;  1H5E A;  5SYK A;  3WNU A;  2YLJ A;  3EXB A;  5SYX A;  3FM6 A;  1DS4 A;  5EJT A;  1CYF A;  4A5G A;  4A6Z A;  5SYL A;  1DJ1 A;  1GWU A;  1KXN A;  1H5H A;  1CCE A;  4G05 A;  2Y6B A;  3HDL A;  5KQH A;  4JMB A;  2BOQ A;  5ABN A;  4JM8 A;  3M2H A;  3M29 A;  3M2I A;  5SXW A;  1APX A;  2PCC A;  2CCD A;  4FCN A;  5SYI A;  6CCP A;  2RBW X;  1ARW A;  5SW4 A;  2RBU X;  1W4W A;  4PAE A;  1ITK A;  1SOG A;  1AEE A;  1H5K A;  2Y5A A;  5SYH A;  1STQ A;  4CZQ A;  3M25 A;  5ABQ A;  1AEG A;  1CCJ A;  2AS3 A;  3FJW A;  2VCN A;  5JHY A;  2CYP A;  4CZR A;  2XIF A;  2ATJ A;  1S6V A;  2WD4 A;  1ZBY A;  2EUP A;  2CCA A;  1AA4 A;  1LGA A;  4NVM B;  5SXT A;  1MK8 A;  1ABV A;  3M2B A;  2CL4 X;  4JPT A;  2OEB A;  4JPU A;  1BEJ A;  4CVJ A;  2X08 A;  4JMW A;  2VNX X;  1HCH A;  4A71 A;  5H9E B;  2VNZ X;  4XV7 A;  5L86 A;  4CUO A;  2E3A A;  2XI6 A;  2EUS A;  5SXR A;  3CCX A;  2EUR A;  3ZCG A;  4FCS A;  1AEU A;  2PCB A;  1LYC A;  2V23 A;  5SW5 A;  2RC1 X;  1AEB A;  3R99 A;  1A2G A;  1SDQ A;  1BES A;  2N18 A;  5CID A;  4NVH B;  1CCA A;  1CMT A;  5D6M A;  2AS2 A;  1CCC A;  1AEO A;  3FM1 A;  5KSF A;  1AES A;  4JMV A;  1CPF A;  1MNP A;  1BJ9 A;  2ZOP A;  1KOK A;  1BVA A;  1H55 A;  5EJX A;  1JCI A;  1CMP A;  5SX6 A;  1GWO A;  3VLJ A;  1B85 A;  1H58 A;  4NVG B;  1H57 A;  1AEF A;  1U2K A;  3ATJ A;  4GED A;  4JMT A;  2B11 A;  2EUO A;  4NVK B;  4CZP A;  4BM2 A;  1CK6 A;  3RIW A;  5L05 A;  1MN1 A; 
#chains in the Genus database with same CATH homology
 5SW6 A;  5SYU A;  4NVJ B;  3VLL A;  2XIH A;  1H3J A;  4BLY A;  5CD4 J;  1GZA A;  3RRW A;  4JM9 A;  1CCL A;  1H5F A;  4NVF A;  3WA8 A;  3M27 A;  1DSE A;  5AOG A;  3E2O A;  1YYG A;  2XIL A;  2VCF X;  3M23 A;  5FNB A;  3FMU A;  5SYW A;  1ML2 A;  4BLL A;  4C50 A;  3ZCH A;  5CIC A;  1S73 A;  2RC2 X;  1CMU A;  4JQJ A;  1MKQ A;  2RBZ X;  5KQ6 A;  3Q3U A;  2VKA A;  1QO4 A;  1U2J A;  3RIV A;  5SX3 A;  3VLH A;  2B12 A;  2RC0 X;  5SX2 A;  1CCK A;  2GHE X;  1JDR A;  5KQ0 A;  5JQR A;  1AEQ A;  1LY8 A;  4JM6 A;  4P4Q A;  2EUN A;  3FM4 A;  3ZCY A;  1CCP A;  1KRJ A;  1AC4 A;  4JN0 A;  2CCP A;  3VLM A;  4JMS A;  1FHF A;  3WXO A;  5H9F B;  4H7A A;  4NVC A;  4NVO B;  4JZA A;  4QYZ B;  4JM5 A;  1SJ2 A;  1AEK A;  3M8M A;  5KQ3 A;  1AEN A;  2AQD A;  1U74 A;  4H79 A;  1OAF A;  1ARP A;  4JQN A;  1AEV A;  1AEM A;  1DCC A;  2VO2 X;  2ZCA A;  4BLN A;  1H5L A;  2BCN A;  5CIE A;  1CCB A;  4NVL A;  5SXS A;  2EUQ A;  2ANZ A;  1H5I A;  2GHD X;  5SX1 A;  5AMM A;  1RYC A;  2V2E A;  4NVE A;  4NVI B;  1BEP A;  3M26 A;  1SBM A;  4CVI A;  2IA8 A;  2B0Z A;  5SX0 B;  1Z53 A;  1YZR A;  1LLP A;  4A7M A;  1H5D A;  1ZBZ A;  1CMQ A;  1IYN A;  1GZB A;  1QGJ A;  3M28 A;  1KXM A;  6ATJ A;  1CPE A;  1GX2 A;  1CCG A;  1BGP A;  2E39 A;  3M2F A;  4XV8 A;  5KQ2 A;  4BLK A;  1SCH A;  2AS1 A;  5ALA A;  1PA2 A;  4XV5 A;  1H5G A;  1MKR A;  4USC A;  1EBE A;  2RBX X;  3M2D A;  5L02 A;  2RBV X;  4JQM A;  4A78 A;  1ARV A;  1KZM A;  2EUU A;  2GB8 A;  1U2L A;  7CCP A;  1HSR A;  4CCP A;  1MN2 A;  4OQ7 A;  4NVA A;  4FEF A;  4JMZ A;  3CCP A;  3M2A A;  1AEJ A;  2XJ8 A;  1A2F A;  1CPG A;  2YCG A;  5AL9 A;  1H5A A;  3UW8 A;  2CEP A;  1AC8 A;  2XJ5 A;  5SXX A;  1DJ5 A;  5KQK A;  5SXQ A;  2XJ6 A;  1DSO A;  3M2E A;  1W4Y A;  3VLI A;  5JHZ A;  4BM4 A;  1B80 A;  1H5M A;  5SX7 A;  2RBY X;  3M2G A;  1CPD A;  3X16 A;  1ARX A;  1GW2 A;  3M5Q A;  4CCX A;  4BM0 A;  1ARU A;  5FNE A;  1H5C A;  2AS6 A;  4CZN A;  4BM1 A;  2GHH X;  1GWT A;  4XVA A;  3M2C A;  2EUT A;  4CZO A;  4BLX A;  2ICV A;  2E3B A;  5JPR A;  3UT2 A;  4NVB A;  5SYV A;  2GHC X;  1YYD A;  1H5J A;  2GHK X;  4JMA A;  4NFG A;  1LYK A;  1UB2 A;  3VLK A;  1DSG A;  4BLZ A;  4BM3 A;  2X07 A;  5CIF A;  1OAG A;  1C8I A;  2JTI A;  2W23 A;  5CCP A;  2AS4 A;  1BEM A;  4JPL A;  5SYY A;  3E2N A;  4U7U B;  4C51 A;  2RBT X;  1DSP A;  1ATJ A;  4JQK A;  1V0H X;  5CIB A;  1AEH A;  4XV6 A;  4ATJ A;  5KQI A;  4XV4 A;  3FKG A;  5CJH A;  3R98 A;  4FDQ A;  5ABO A;  5SX0 A;  1BEK A;  1BEQ A;  1CCI A;  2Y6A A;  2B10 A;  2VCS A;  1LY9 A;  1AET A;  1ARY A;  1B82 A;  1AED A;  1QPA A;  2GGN X;  1U75 A;  5KSK A;  1YZP A;  7ATJ A;  4NVN B;  4JB4 A;  5CIG A;  4NVD A;  5JHX A;  5CIH A;  5SYJ A;  1H5E A;  5SYK A;  3WNU A;  2YLJ A;  3EXB A;  5SYX A;  3FM6 A;  1DS4 A;  5EJT A;  1CYF A;  4A5G A;  4A6Z A;  5SYL A;  1DJ1 A;  1GWU A;  1KXN A;  1H5H A;  1CCE A;  4G05 A;  2Y6B A;  3HDL A;  5KQH A;  4JMB A;  2BOQ A;  5ABN A;  4JM8 A;  3M2H A;  3M29 A;  3M2I A;  5SXW A;  1APX A;  2PCC A;  2CCD A;  4FCN A;  5SYI A;  6CCP A;  2RBW X;  1ARW A;  5SW4 A;  2RBU X;  1W4W A;  4PAE A;  1ITK A;  1SOG A;  1AEE A;  1H5K A;  2Y5A A;  5SYH A;  1STQ A;  4CZQ A;  3M25 A;  5ABQ A;  1AEG A;  1CCJ A;  2AS3 A;  3FJW A;  2VCN A;  5JHY A;  2CYP A;  4CZR A;  2XIF A;  2ATJ A;  1S6V A;  2WD4 A;  1ZBY A;  2EUP A;  2CCA A;  1AA4 A;  1LGA A;  4NVM B;  5SXT A;  1MK8 A;  3M2B A;  2CL4 X;  4JPT A;  4JPU A;  1BEJ A;  4CVJ A;  2X08 A;  4JMW A;  2VNX X;  1HCH A;  4A71 A;  5H9E B;  2VNZ X;  4XV7 A;  5L86 A;  4CUO A;  2E3A A;  2XI6 A;  2EUS A;  5SXR A;  3CCX A;  2EUR A;  3ZCG A;  4FCS A;  1AEU A;  2PCB A;  1LYC A;  2V23 A;  5SW5 A;  2RC1 X;  1AEB A;  3R99 A;  1A2G A;  1SDQ A;  1BES A;  2N18 A;  5CID A;  4NVH B;  1CCA A;  1CMT A;  5D6M A;  2AS2 A;  1CCC A;  1AEO A;  3FM1 A;  5KSF A;  1AES A;  4JMV A;  1CPF A;  1MNP A;  1BJ9 A;  1KOK A;  1BVA A;  1H55 A;  5EJX A;  1JCI A;  1CMP A;  5SX6 A;  1GWO A;  3VLJ A;  1B85 A;  1H58 A;  4NVG B;  1H57 A;  1AEF A;  1U2K A;  3ATJ A;  4GED A;  4JMT A;  2B11 A;  2EUO A;  4NVK B;  4CZP A;  4BM2 A;  1CK6 A;  3RIW A;  5L05 A;  1MN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...