7AYLA

Crystal structure of the gh11 domain of a multidomain xylanase from the hindgut metagenome of trinervitermes trinervoides
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
202
structure length
202
Chain Sequence
ATTLYENKTGTEDGYDYELWKDSGNTSMILNGGGTFSCQWSNINNCLFRKGKKFGGNQSYQQIGNISFDYGCDYHPNGNSYLCVYGWTTSPLVEFYIVDSWGSWRPPGGSPKGQIYVDGGTYDVYETTRVNQPSIQGNTTFQQYFSVRTERRTSGTINVTEHFKAWERMGMRMGNIYEAALNVEGYQSSGSANVYKNNMTIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase
publication title Crystal structure of the GH11 domain of a multidomain xylanase from the hindgut metagenome of Trinervitermes trinervoides
rcsb
source organism Uncultured bacterium
total genus 54
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2020-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...