7B0Nb

A 3.7-angstrom structure of yarrowia lipolytica complex i with an r121m mutation in nucm.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
MINANPGFWNGPFRYLRWSAHNRPHLFFAFAIGIAGPVAALTLTPLRRKYLYPDHSPLPQSYPLPQRAREQLTGFDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords NADH-ubiquinone oxidoreductase chain 3
publication title A conserved arginine residue is critical for stabilizing the N2 FeS cluster in mitochondrial complex I.
pubmed doi rcsb
source organism Yarrowia lipolytica
total genus 15
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2020-11-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...