7B93h

Cryo-em structure of mitochondrial complex i from mus musculus inhibited by iacs-2858 at 3.0 a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
138
structure length
138
Chain Sequence
KRLFVVKPSLYYDARFLRLMKFYLMLTGIPVIIGITLVNIFIGEAELAEIPEGYIPEHWEYYKHPISRWIARNFYDGPEKNYEKTLAILQIESEKAELRLKEQEVRRLMRARGDGPWYQFPTPEKEFIDHSPKATPDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADH-ubiquinone oxidoreductase chain 3
publication title Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
pubmed doi rcsb
total genus 36
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2020-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
h PF09781 NDUF_B5 NADH:ubiquinone oxidoreductase, NDUFB5/SGDH subunit
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...