7BBIA

Joint x-ray/neutron room temperature structure of h/d-exchanged pll lectin
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
354
structure length
350
Chain Sequence
IENSAIALSGIVSVANNADNRLEVFGVSTDSAVWHNWQTAPLPNSSWAGWNKFNGVVTSKPAVHRNSDGRLEVFVRGTDNALWHNWQTAADTNTWSSWQPLYGGITSNPEVCLNSDGRLEVFVRGSDNALWHIWQTAAHTNSWSNWKSLGGTLTSNPAAHLNADGRIEVFARGADNALWHIWQTAAHTDQWSNWQSLITSDPVVINNCDRLEVFARGADSTLRHISQIGSDSVSWSNWQCLDGVITSAPAAVKNISGQLEVFARGADNTLWRTWQTSHNGPWSNWSSFTGIIASAPTVAKNSDGRIEVFVLGLDKALWHLWQTTSSTTSSWTTWALIGGITLIDASVILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords PLL lectin
publication title Joint X-ray/neutron room temperature structure of H/D-exchanged PLL lectin
rcsb
source organism Photorhabdus laumondii
total genus 95
structure length 350
sequence length 354
ec nomenclature
pdb deposition date 2020-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03984 DUF346 Repeat of unknown function (DUF346)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...