7BC5A

Cryo-em structure of acp domain from pichia pastoris fatty acid synthase (fas)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
161
structure length
161
Chain Sequence
PDEPVKAALVLHVLVAHKLKKSLDAVPLSKAIKDLVGGKSTVQNEILGDLGKEFGSTPEKPEDTPLQELAEQFQDTFPGSLGKQTGSLVNRLMSSKMPGGFSLSVARKYLQTRWGLGPGRQDSVLLVALVNEPGARLSSDGEAKEFLDSCAQKYASGAGIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Fatty acid synthase subunit alpha
publication title Structural insight into Pichia pastoris fatty acid synthase.
pubmed doi rcsb
total genus 21
structure length 161
sequence length 161
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2020-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain
A PF01648 ACPS 4'-phosphopantetheinyl transferase superfamily
A PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain
A PF18314 FAS_I_H Fatty acid synthase type I helical domain
A PF18325 Fas_alpha_ACP Fatty acid synthase subunit alpha Acyl carrier domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...