7BIFA

Crystal structure of v22wrap-t, a 7-bladed designer protein
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
286
structure length
286
Chain Sequence
DKTVKLWNRNGQLLQTLTGHSSSVTGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVTGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVTGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVTGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVTGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVTGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVTGVAFSPDGQTIASAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords v22WRAP-T
publication title Structure and stability of the designer protein WRAP-T and its permutants.
pubmed doi rcsb
source organism Synthetic construct
total genus 79
structure length 286
sequence length 286
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2021-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...