7BLQF

Vps26 dimer region of the fungal membrane-assembled retromer:grd19 complex.
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
292
structure length
292
Chain Sequence
FSTPVDIDIVLADADKRAMVDVKLDKNRREKVPLYMDGESVKGCVTVRPKDGKRLEHTGIKVQFIGTIEMFFDRGNHYEFLSLVQELAAPGELQHPQTFDFNFKNVEKQYESYNGINVKLRYFVRVTVSRRMADVIREKDIWVYSYRIPPELNSSIKMDVGIEDCLHIEFEYSKSKYHLKDVIVGRIYFLLVRLKIKHMELSIIRRETTGVAPNQYNESETLVRFEIMDGSPSRGETIPIRLFLGGFDLTPTFRDVNKKFSTRYYLSLVLIDEDARRYFKQSEIILYRQPPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Vacuolar protein sorting-associated protein 35
publication title Architecture and mechanism of metazoan retromer:SNX3 tubular coat assembly
rcsb
source organism Chaetomium thermophilum (strain dsm 1495 / cbs 144.50 / imi 039719)
total genus 58
structure length 292
sequence length 292
chains with identical sequence J
ec nomenclature
pdb deposition date 2021-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03643 Vps26 Vacuolar protein sorting-associated protein 26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...