7BMEA

Crystal structure of a r18w mutant of the dna-binding protein rema from geobacillus thermodenitrificans
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
MKFINIGYGNMVSAAWIITIVSPDSAPIKRIIQDAREKGKLVDATHGRRTRAVIITDSDHVILSSVQPETVANRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Putative regulatory protein GTNG_1019
publication title Structural and functional characterization of the bacterial biofilm activator RemA.
pubmed doi rcsb
source organism Geobacillus thermodenitrificans (strain ng80-2)
total genus 20
structure length 75
sequence length 75
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2021-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04025 DUF370 Domain of unknown function (DUF370)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...