7BOXM

Mature bacteriorphage t7 tail adaptor protein gp11
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
194
structure length
194
Chain Sequence
SYDMNVETAAELSAVNDILASIGEPPVSTLEGDANADAANARRILNKINRQIQSRGWTFNIEEGITLLPDVYSNLIVYSDDYLSLMSTSGQSIYVNRGGYVYDRTSQSDRFDSGITVNIIRLRDYDEMPECFRYWIVTKASRQFNNRFFGAPEVEGVLQEEEDEARRLCMEYEMDYGGYNMLDGDAFTSGLLTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Tail adaptor protein gp11
publication title Structural changes of a bacteriophage upon DNA packaging and maturation.
pubmed doi rcsb
source organism Escherichia phage t7
total genus 33
structure length 194
sequence length 194
chains with identical sequence N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2020-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF17212 Tube Tail tubular protein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...