7BOYs

Mature bacteriorphage t7 tail nozzle protein gp12
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
792
structure length
790
Chain Sequence
LISQSIKNLKGGISQQPDILRYPDQGSRQVNGWSSETEGLQKRPPLVFLNTLGDNLGQAPYIHLINRDEHEQYYAVFTGSGIRVFDLSGNEKQVRYPNGSNYIKTANPRNDLRMVTVADYTFIVNRNVVAQKNTKSVNLPNYNPNQDGLINVRGGQYGRELIVHINGKDVAKYKIPDGSQPEHVNNTDAQWLAEELAKQMRTNLSDWTVNVGQGFIHVTAPSGQQIDSFTTKDGYADQLINPVTHYAQSFSKLPPNAPNGYMVKIVGDASKSADQYYVRYDAERKVWTETLGWNTEDQVLWETMPHALVRAADGNFDFKWLEWSPKSCGDVDTNPWPSFVGSSINDVFFFRNRLGFLSGENIILSRTAKYFNFYPASIANLSDDDPIDVAVSTNRIAILKYAVPFSEELLIWSDEAQFVLTASGTLTSKSVELNLTTQFDVQDRARPFGIGRNVYFASPRSSFTSIHRYYAVQDVSSVKNAEDITSHVPNYIPNGVFSICGSGTENFCSVLSHGDPSKIFMYKFLYLNEELRQQSWSHWDFGENVQVLACQSISSDMYVILRNEFNTFLARISFTKNAIDLQGEPYRAFMDMKIRYTIPSGTYNDDTFTTSIHIPTIYGANFGRGKITVLEPDGKITVFEQPTAGWNSDPWLRLSGNLEGRMVYIGFNINFVYEFSKFLIKQTADDGSTSTEDIGRLQLRRAWVNYENSGTFDIYVENQSSNWKYTMAGARLGSNTLRAGRLNLGTGQYRFPVVGNAKFNTVYILSDETTPLNIIGCGWEGNYLRRSSGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Tail tubular protein gp12
publication title Structural changes of a bacteriophage upon DNA packaging and maturation.
pubmed doi rcsb
source organism Escherichia phage t7
total genus 88
structure length 790
sequence length 792
chains with identical sequence t, u, v, w, x
ec nomenclature
pdb deposition date 2020-03-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...