7BT8A

Mevo lectin complex with mannotriose
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
140
structure length
137
Chain Sequence
DNYIYSTEVGGVGGTPFTFMQTITSIKFNWSDQYKLLHHIEVKFINNANIYATGDPKGNHEVILEIDDDETIIGSVIGYKKGNDGRCTGVKLTTSKGKSIMAGYFEESLITTYTGKLAGIKGGAGSDIDRLGLIFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords lectin
publication title Structural and related studies on Mevo lectin from Methanococcus voltae A3. The first thorough characterisation of an archeal lectin and its interactions.
pubmed doi rcsb
source organism Methanococcus voltae (strain atcc baa-1334 / a3)
total genus 32
structure length 137
sequence length 140
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2020-03-31
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...