7BTYB

The mitochondrial sam-mdm10 supercomplex in nanodisc from s.cere
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
314
structure length
299
Chain Sequence
DTFPLQTYAAQTDKDEAVALEIQRRSYTFTELTVEGTYKLGVYNVFLEANTGAALATDPWCLFVQLALCQKNGLVLPTHTCNHEMLVLSRLSNPDEALPILVEGYKKRIIRSTVAISEIMRSRILDDAEQLMYYTLLDTVLYDCWITQIIFCASDAQFMELYSCQKLSGSIVTPLDVENSLLQKLSAKSLKISLTKRNKFQFRHREIVKSMQGVYHNHHNSVNQEQVLNVLFENSKQVLLGLKDMLKSDGQPTYLHLKIASYILCITNVKEPIKLKTFVENECKELVQFAQDTLKNFVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translocase
molecule keywords Mitochondrial outer membrane beta-barrel protein
publication title Mitochondrial sorting and assembly machinery operates by beta-barrel switching.
pubmed doi rcsb
total genus 78
structure length 299
sequence length 314
ec nomenclature
pdb deposition date 2020-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10806 SAM35 SAM35, subunit of SAM coomplex
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...