7BYWA

Crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose-bound form)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
QRMGMVIGIKPEHIDEYKRLHAAVWPAVLARLAEAHVRNYSIFLREPENLLFGYWEYHGTDYAADMEAIAQDPETRRWWTFCGPCQEPLASRQPGEHWAHMEEVFHVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords L-fucose mutarotase
publication title Functional and structural characterization of a novel L-fucose mutarotase involved in non-phosphorylative pathway of L-fucose metabolism.
pubmed doi rcsb
source organism Acidovorax avenae subsp. avenae atcc 19860
total genus 29
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05336 rhaM L-rhamnose mutarotase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...